Full TextThe first law enacted in Canada to protect existing Aboriginal rights was section 35 of the Constitution Act, 1982.2 The first law in Canada to recognize the rights of non-human animals as anything other than property has yet to be enacted. The first Supreme Court of Canada (hereafter referred to as the Court) case to interpret section 35 was R. v. Sparrow.3 The 1990 case confirmed an Aboriginal right of the Musqueam peoples of British Columbia to fish for food, social and ceremonial purposes. Since this precedent-setting case, many similar claims have been brought before the courts by way of the fluctuating legal space created by s.35. Many of these cases have been about establishing rights to fish4, hunt5, and trap non-human animals (hereafter referred to as animals). The Court has developed, and continues to develop tests to determine the existence and scope of Aboriginal rights. These tests primarily embody cultural, political and, to a surprisingly lesser degree, legal forces. One of the principal problems with these tests is that they privilege, through the western philosophical lens, the interests of humans. Animals are, at best, the resources over which ownership is being contested. The Euro-centric legal conceptualization of animals as 'resources' over which ownership can be exerted is problematic for at least two reasons. First, the relegation of animals solely to a utilitarian role is antithetical to Indigenous-animal relationships and therefore demonstrates one of the fundamental ways the Canadian legal system is ill equipped to give adequate consideration to Indigenous law. Second, failure to consider animals' inherent value and agency in this context reproduces the human-animal and culture-nature binaries that are at the root of many of western Euro-centric society's inequities. This paper argues that Aboriginal peoples' relationships with animals are a necessary, integral and distinctive part of their cultures6 and, therefore, these relationships and the actors within them are entitled to the aegis of s.35. Through the legal protection of these relationships, animals will gain significant protection as a corollary benefit. If the Court were to protect the cultural relationships between animals and Aboriginal groups, a precondition would be acceptance of Indigenous legal systems. Thus, this paper gives a brief answer to the question, what are Indigenous legal systems and why are animals integral to them? The Anishinabe (also known Ojibwe or Chippewa) are Indigenous peoples who have historically lived in the Great Lakes region. The Bruce Peninsula on Lake Huron is home to the Cape Croker Indian Reserve, where the Chippewas of Nawash First Nation live. The people of this First Nation identify as Anishinabe. The Anishinabek case of Nanabush v. Deer is a law among these people and is used throughout the paper as an example of Indigenous-animal relationships. Making the significant assumption that s.35 has the capacity to recognize Indigenous law, the subsequent section of the paper asks why we should protect these relationships and how that protection should be achieved. Finally, the paper concludes that both the ability of s.35 to recognize Indigenous-animal relationships, and the judicial and political will to grant such recognition, are unlikely. Indigenous-animal relationships are integral to the distinctive culture of the Anishinabek, however the courts would be hesitant to allow such an uncertain and potentially far-reaching right. This is not surprising given that such a claim by both Indigenous and animal groups would challenge the foundations upon which the Canadian legal system is based. There are many sensitive issues inherent in this topic. It should be noted the author is not of Indigenous ancestry, but is making every effort to learn about and respect the Indigenous legal systems discussed. While this paper focuses on a number of Anishinabek laws; it is neither a complete analysis of these practices, nor one that can be transferred, without adaptation, to other peoples. Finally, Indigenous peoples and animal rights and Indigenous law scholars, such as Tom Regan and Mary Ellen Turpel-Lafond, respectively, may insist on an abolitionist approach to animal 'use' or reject the legitimacy of s.35 itself.7 These perspectives are worthy and necessary. This paper positions itself amongst these and other sources in order to reflect upon the timely and important issue of the legal status of Indigenous-animal relationships. I:WHAT ARE INDIGENOUS LEGAL SYSTEMS? The Law Commission of Canada defines a legal tradition as "a set of deeply rooted, historically conditioned attitudes about the nature of law, the role of law in the society and the polity, the proper organization and operation of a legal system, and the way law is or should be made, applied, studied, perfected and taught."8 Indigenous legal traditions fit this description. They are living systems of beliefs and practices, and have been recognized as such by the courts.9 Indigenous practices developed into systems of law that have guided communities in their governance, and in their relationships amongst their own and other cultures and with the Earth.10 These laws have developed through stories, historical events that may be viewed as 'cases,' and other lived experiences. Indigenous laws are generally non-prescriptive, non-adversarial and non-punitive and aim to promote respect and consensus, as well as close connection with the land, the Creator, and the community. Indigenous laws are a means through which vital knowledge of social order within the community is transmitted, revived and retained. After European 'settlement' the influence of Indigenous laws waned. This was due in part to the state's policies of assimilation, relocation and enfranchisement. 11 Despite these assaults, Indigenous legal systems have persevered; they continue to provide guidance to many communities, and are being revived and re-learned in others. For example, the Nisga'a's legal code, Ayuuk, guides their communities and strongly informs legislation enacted under the Nisga'a Final Agreement, the first modern treaty in British Columbia.12 The land and jurisdiction claims of the Wet'suwet'en and Gitxsan Nations ultimately resulted in the Court's decision in Delgamuukw,13 a landmark case that established the existence of Aboriginal title. The (overturned) BC Supreme Court's statement in Delgamuukw14 reveals two of the many challenges in demonstrating the validity of Indigenous laws: "what the Gitxsan and Wet'suwet'en witnesses[es] describe as law is really a most uncertain and highly flexible set of customs which are frequently not followed by the Indians [sic] themselves." The first challenge is that many laws are not in full practice, and therefore not as visible as they could be and once were. What the courts fail to acknowledge, however, is that the ongoing colonial project has served to stifle, extinguish and alter these laws. The second challenge is that the kind of law held and practiced by Indigenous peoples is quite foreign to most non-Indigenous people. Many Indigenous laws have animals as central figures. In Anishinabek traditional law, often the animals are the lawmakers15: they develop the legal principles and have agency as law givers. For instance, the Anishinabek case Nanabush v. Deer, Wolf , as outlined by Burrows, is imbued with legal principles, lessons on conduct and community governance, as well as 'offenses' and penalties. It is not a case that was adjudicated by an appointed judge in a courtroom, but rather one that has developed over time as a result of peoples' relationships with the Earth and its inhabitants. An abbreviated summary of the case hints at these legal lessons: Nanabush plays a trick on a deer and deliberately puts the deer in a vulnerable position. In that moment of vulnerability, Nanabush kills the deer and then roasts its body for dinner. While he is sleeping and waiting for the deer to be cooked, the Wolf people come by and take the deer. Nanabush wakes up hungry, and out of desperation transforms into a snake and eats the brains out of the deer head. Once full, he is stuck inside the head and transforms back into his original shape, but with the deer head still stuck on. He is then chased and nearly killed by hunters who mistake him for a real deer. This case is set within the legal context of the Anishinabek's treaty with deer. In signing the treaty, the people were reminded to respect beings in life and death and that gifts come when beings respect each other in interrelationships.16 Nanabush violated the rights of the deer and his peoples' treaty with the deer. He violated the laws by taking things through trickery, and by causing harm to those he owed respect. Because his actions were not in accordance with Anishinabek legal principles, he was punished: Nanabush lost the thing he was so desperately searching for, and he ended up nearly being killed. This case establishes two lessons. The first is that, like statutory and common law, with which Canadians are familiar, Indigenous law does not exist in isolation. Principles are devised based on multiple teachings, pre- vious rules and the application of these rules to facts. That there are myriad sources of Indigenous law suggests that the learning of Indigenous law would require substantial effort on the part of Canadian law-makers.17 The second is that animals hold an important place in Indigenous law, and those relationships with animals – and the whole 'natural' world – strongly inform the way they relate to the Earth. II: CAN CANADIAN LAW ACCEPT INDIGENOUS LEGAL SYSTEMS? If there were a right recognized under s.35 concerning the Indigenous-animal relationship, what would it look like? Courts develop legal tests to which the facts of each case are applied, theoretically creating a degree of predictability as to how a matter will be judged. Introduced in Sparrow, and more fully developed in Van der Peet, a 'test' for how to assess a valid Aboriginal right has been set out by the Court. Summarized, the test is: "in order to be an Aboriginal right an activity must be an element of a practice, custom or tradition integral to the distinctive culture of the Aboriginal group claiming the right."18 There are ten, differently weighted factors that a court will consider in making this assessment. The right being 'tested' in this discussion is the one exemplified in Nanabush v. Deer: the ability of Indigenous peoples to recognize and practice their laws, which govern relationships, including death, with deer and other animals. The courts have agreed that a generous, large and liberal construction should be given to Indigenous rights in order to give full effect to the constitutional recognition of the distinctiveness of Aboriginal culture. Still, it is the courts that hold the power to define rights as they conceive them best aligning with Canadian society19; this is one way that the Canadian state reproduces its systems of power over Indigenous peoples.20 The application of the Aboriginal right exemplified in Nanbush v. Deer to the Sparrow and Van der Peet tests would likely conclude that the Anishinabek do have an integral and distinctive relationship with animals. However, due to the significant discretion of the Court on a number of very subjective and politically sensitive factors, it is uncertain that the Nanabush v. Deer case would 'pass' Van der Peet's required ten factors.21 This is indicative of the structural restraints that s.35 imposes. 22 The questions it asks impair its ability to capture and respect the interrelationships inherent in Indigenous peoples' interactions with animals. For example, the Court will characterize hunting or fishing as solely subsistence, perhaps with a cultural element. Shin Imai contends these activities mean much more: "To many…subsistence is a means of reaffirming Aboriginal identity by passing on traditional knowledge to future generations. Subsistence in this sense moves beyond mere economics, encompassing the cultural, social and spiritual aspects for the communities."23 Scholar Kent McNeil concludes that: "regardless of the strengths of legal arguments in favour of Indigenous peoples, there are limits to how far the courts […] are willing to go to correct the injustices caused by colonialism and dispossession."24 It is often not the legal principles that determine outcomes, but rather the extent to which Indigenous rights can be reconciled with the history of settlement without disturbing the current economic and political structure of the dominant culture. III:WHY PROTECT THE ANIMAL-INDIGENOUS RELATIONSHIP? Legally protecting animal-Indigenous relationships offers symbiotic, mutually respectful benefits for animals and for the scope of Aboriginal rights that can be practiced. For instance, a protected relationship would have indirect benefits for animals' habitat and right to life: it would necessitate protecting the means necessary, such as governance of the land, for realization of the right. This could include greater conservation measures, more contiguous habitat, enforcement of endangered species laws, and, ideally, a greater awareness and appreciation by humans of animals and their needs. Critical studies scholars have developed the argument that minority groups should not be subject to culturally biased laws of the mainstream polity.24 Law professor Maneesha Deckha points out that animals, despite the central role they play in a lot of 'cultural defences,' have been excluded from our ethical consideration. Certainly, the role of animals has been absent in judicial consideration of Aboriginal rights.26 Including animals, Deckha argues, allows for a complete analysis of these cultural issues and avoids many of the anthropocentric attitudes inherent in Euro-centric legal traditions. In Jack and Charlie27 two Coast Salish men were charged with hunting deer out of season. They argued that they needed to kill a deer in order to have raw meat for an Aboriginal religious ceremony. The Court found that killing the deer was not part of the ceremony and that there was insufficient evidence to establish that raw meat was required. This is a case where a more nuanced consideration of the laws and relationships with animals would have resulted in a more just application of the (Canadian) law and prevented the reproduction of imperialist attitudes. A criticism that could be lodged against practicing these relationships is that they conflict with the liberty and life interests of animals.28 Theoretically, if Indigenous laws are given the legal and political room to fully operate, a balance between the liberty of animals and the cultural and legal rights of Indigenous peoples can be struck.29 Indeed, Indigenous peoples' cultural and legal concern for Earth is at its most rudimentary a concern for the land, which is at the heart of the challenge to the Canadian colonial system. If a negotiated treaty was reached, or anti-cruelty and conservation laws were assured in the Indigenous peoples' self government system, then Canadian anti-cruelty30 and conservation laws,31 the effectiveness of which are already questionable, could be displaced in recognition of Indigenous governance.32 Indigenous peoples in Canada were – and are, subject to imposed limitations – close to the environment in ways that can seem foreign to non-Indigenous people.33 For example, some origin stories and oral histories explain how boundaries between humans and animals are at times absent: Animal-human beings like raven, coyote and rabbit created them [humans] and other beings. People …acted with respect toward many animals in expectation of reciprocity; or expressed kinship or alliance with them in narratives, songs, poems, parables, performances, rituals, and material objects. 34 Furthering or reviving these relationships can advance the understanding of both Indigenous legal systems and animal rights theory. Some animal rights theorists struggle with how to explain the cultural construction of species difference: Indigenous relationships with animals are long standing, lived examples of a different cultural conception of how to relate to animals and also of an arguably healthy, minimally problematic way to approach the debate concerning the species divide.35 A key tenet of animal-Indigenous relationships is respect. Shepard Krech posits that Indigenous peoples are motivated to obtain the necessary resources and goals in 'proper' ways: many believe that animals return to the Earth to be killed, provided that hunters demonstrate proper respect.36 This demonstrates a spiritual connection, but there is also a concrete connection between Indigenous peoples and animals. In providing themselves with food and security, they 'manage' what Canadian law calls 'resources.'37 Because of the physical nature of these activities, and their practical similarity with modern 'resource management,' offering this as 'proof' of physical connection with animals and their habitat may be more successful than 'proving' a spiritual relationship. Finally, there are health reasons that make the Indigenous-animal relationship is important. Many cultures have come to depend on the nutrients they derive from particular hunted or fished animals. For example, nutrition and physical activity transitions related to hunting cycles have had negative impacts on individual and community health.38 This shows the multidimensionality of hunting, the significance of health, and, by extension, the need for animal 'resources' to be protected. IV: HOW SHOULD WE PROTECT THESE ABORIGINAL RIGHTS? If the Anishinabek and the deer 'win' the constitutional legal test ('against' the state) and establish a right to protect their relationships with animals, what, other than common law remedies,39 would follow? Below are ideas for legal measures that could be taken from the human or the animal perspective, or both, where benefits accrue to both parties. If animals had greater agency and legal status, their needs as species and as individuals could have a meaningful place in Canadian common and statutory law. In Nanabush v. Deer, this would mean that the deer would be given representation and that legal tests would need to be developed to determine the animals' rights and interests. Currently the courts support the view that animals can be treated under the law as any other inanimate item of property. Such a legal stance is inconsistent with a rational, common-sense view of animals,40 and certainly with Anishinabek legal principles discussed herein.41 There are ongoing theoretical debates that inform the practical questions of how animal equality would be achieved: none of these in isolation offers a complete solution, but combined they contribute to the long term goal. Barsh and James Sákéj Youngblood Henderson advocate an adoption of the reasoning in the Australian case Mabo v. Queensland,42 where whole Aboriginal legal systems were imported intact into the common law. Some principles that Canada should be following can also be drawn from international treaties that Canada has or should have signed on to.43 Another way to seek protection from the human perspective is through the freedom of religion and conscience section of the Charter. Professor John Borrows constructs a full argument for this, and cites its challenges, in Living Law on a Living Earth: Aboriginal Religion, Law and the Constitution.44 The strongest, but perhaps most legally improbable, way to protect the animal- Indigenous relationship is for Canada to recognize a third, Indigenous order of government (in addition to provincial and federal), where all three orders are equal and inform one another's laws. This way, Indigenous laws would have the legal space to fully function and be revived. Endowing Indigenous peoples with the right to govern their relationships would require a great acquiescence of power by governments and a commitment to the establishment and maintenance of healthy self-government in Indigenous communities. Louise Mandell offers some reasons why Canada should treat Aboriginal people in new ways, at least one of which is salient to the third order of government argument: To mend the [E]arth, which must be done, governments must reassess the information which the dominant culture has dismissed. Some of that valuable information is located in the oral histories of Aboriginal Peoples. This knowledge will become incorporated into decisions affecting the [E]arth's landscape when Aboriginal Peoples are equal partners in decisions affecting their territories.45 V: CONCLUSION A legal system that does not have to justify its existence or defend its worth is less vulnerable to challenges.46 While it can be concluded that s.35 has offered some legal space for Indigenous laws and practices, it is too deeply couched in Euro-centric legal traditions and the anthropocentric cultural assumptions that they carry. The most effective strategy for advancing Indigenous laws and culture, that would also endow many animals with greater agency, and relax the culture-nature, human-animal binaries, is the formal recognition of a third order of government. Lisa Chartrand explains that recognition of legal pluralism would be a mere affirmation of legal systems that exist, but which are stifled: "…this country is a multijuridical state, where the distinct laws and rules of three systems come together within the geographic boundaries of one political territory." 47 Revitalizing Indigenous legal systems is and will be a challenging undertaking. Indigenous communities must reclaim, define and understand their own traditions: "The loss of culture and traditions caused by the historic treatment of Aboriginal communities makes this a formidable challenge for some communities. Equally significant is the challenge for the Canadian state to create political and legal space to accommodate revitalized Indigenous legal traditions and Aboriginal law-making."48 The project of revitalizing Indigenous legal traditions requires the commitment of resources sufficient for the task, and transformative change to procedural and substantive law. The operation of these laws within, or in addition to, Canadian law would of course cause widespread, but worthwhile controversy. In Animal Bodies, Cultural Justice49 Deckha argues that an ethical relationship with the animal Other must be established in order realize cultural and animal rights. This paper explores and demonstrates the value in finding legal space where cultural pluralism and respect for animals can give rise to the practice of Indigenous laws and the revitalization of animal-Indigenous relationships. As Borrows writes: "Anishinabek law provides guidance about how to theorize, practice and order our association with the [E]arth, and could do so in a way that produces answers that are very different from those found in other sources."50 (see PDF for references)
Author's introductionThe media landscape has changed dramatically in recent decades, from one predominated by traditional mass communication formats to today's more personalized communications environment. Mobile telephony plays a central role in this transition, with adoption rates that surpass even those of the Internet. This article attempts to situate the role of mobile communication technology in the changing media environment by examining key areas of social change associated with its widespread diffusion and use. These areas include symbolic meaning of technology, new forms of coordination and social networking, personalization of public spaces, and the mobile youth culture. Drawing from these areas of change, we advance the argument that mobile telephony is iconic of a larger socio‐technological shift toward a new 'personal communication society.'Author recommendsRheingold, Howard 2002. Smart Mobs: The Next Social Revolution. Cambridge, MA: Basic Books.From Tokyo to Helsinki, Manhattan to Manila, Howard Rheingold takes us on a journey around the world for a preview of the next techno‐cultural shift – a shift he predicts will be as dramatic as the widespread adoption of the PC in the 1980s and the Internet in the 1990s. The coming wave, says Rheingold, is the result of super‐efficient mobile communications – cellular phones, personal digital assistants, and wireless‐paging and Internet‐access devices that will allow us to connect with anyone, anywhere, anytime. From the amusing ('Lovegetty' devices in Japan that light up when a person with the right date‐potential characteristics appears in the vicinity) to the extraordinary (the overthrow of a repressive regime in the Philippines by political activists who mobilized by forwarding text messages via cell phones), Rheingold gives examples of the fundamentally new ways in which people are already engaging in group or collective action. He also considers the dark side of this phenomenon, such as the coordination of terrorist cells, threats to privacy, and the ability to incite violent behavior. Applying insights from sociology, artificial intelligence, engineering, and anthropology, Rheingold offers a penetrating perspective on the brave new convergence of pop culture, cutting‐edge technology, and social activism. At the same time, he reminds us that, as with other technological revolutions, the real impact of mobile communications will come not from the technology itself but from how people use it, resist it, adapt to it, and ultimately use it to transform themselves, their communities, and their institutions.Katz, James E. and Mark A. Aakhus (eds.) 2002. Perpetual Contact: Mobile Communication, Private Talk, Public Performance. Cambridge, UK: Cambridge University Press.This edited volume contains a landmark collection of chapters from researchers all over the world. The book offers a multi‐national perspective on some of the key themes that were identified at the outset of the emergent new field of mobile communication studies, ranging from the private sphere of interpersonal relations to the public performance of social groups and structures. In their conclusion, the editors advance the theoretical orientation of Apparatgeist (translation: 'spirit of the machine') to explain cross‐cultural consistencies in how people conceptualize and use personal communication technologies such as the mobile phone.Ling, Rich 2004. The Mobile Connection: The Cell Phone's Impact on Society. San Francisco, CA: Morgan Kaufmann.This book, based on worldwide research involving tens of thousands of interviews and contextual observations, looks into the impact of the mobile communication on our daily lives. Areas of impact include accessibility, safety and security, coordination of social and business activities, use of public places, and the social emancipation of youth.Ito, Mizuko, Daisuke Okabe, and Misa Matsuda (eds.) 2005. Personal, Portable, Pedestrian: Mobile Phones in Japanese Life. Cambridge, MA: MIT Press.This edited volume explores how Japan's enthusiastic engagement with mobile technology has become part of its trendsetting popular culture. The chapters document the emergence, incorporation, and domestication of mobile communications in a wide range of social practices and institutions. The book first considers the social, cultural, and historical context of keitai (i.e., mobile phone) development in Japan, including its beginnings in youth pager use in the early 1990s. It then discusses the virtually seamless integration of keitai use into everyday life, contrasting it to the more escapist character of Internet use on the PC. Other essays suggest that the use of mobile communication reinforces ties between close friends and family, producing 'tele‐cocooning' by tight‐knit social groups. The book also discusses mobile phone manners and examines keitai use by copier technicians, multitasking housewives, and school children.Castells, Manuel, Mireia Fernandez‐Ardevol, Jack Linchuan Qiu and Araba Sey 2007. Mobile Communication and Society: A Global Perspective. Cambridge, MA: MIT Press.This book looks at how the possibility of multimodal communication from anywhere to anywhere at any time affects everyday life at home, at work, and at school, and raises broader concerns about politics and culture both global and local. Drawing on data gathered from around the world, the authors explore who has access to wireless technology, and why, and analyze the patterns of social differentiation seen in unequal access. They explore the social effects of wireless communication – what it means for family life, for example, when everyone is constantly in touch, or for the idea of an office when workers can work anywhere. The authors consider the rise of a mobile youth culture based on peer‐to‐peer networks, with its own language of texting, and its own values. They examine the phenomenon of flash mobs, and the possible political implications. And they look at the relationship between communication and development and the possibility that developing countries could 'leapfrog' directly to wireless and satellite technology. Drawing from a global body of research, the book helps answer the key questions about our transformation into a 'mobile network society'.Ling, Rich 2008. New Tech, New Ties: How Mobile Communication Reshapes Social Cohesion. Cambridge, MA: MIT Press.In New Tech, New Ties, Rich Ling examines how the mobile telephone affects both mobile‐mediated and face to face interactions. Ling finds that through the use of various social rituals the mobile telephone strengthens social ties within the circle of friends and family – sometimes at the expense of interaction with those who are physically present – and creates what he calls 'bounded solidarity'. Ling argues that mobile communication helps to engender and develop social cohesion within the family and the peer group. Drawing on the work of Emile Durkheim, Erving Goffman, and Randall Collins, Ling shows that ritual interaction is a catalyst for the development of social bonding. From this perspective, he examines how mobile communication affects face‐to‐face ritual situations and how ritual is used in interaction mediated by mobile communication. He looks at the evidence, including interviews and observations from around the world, which documents the effect of mobile communication on social bonding and also examines some of the other possibly problematic issues raised by tighter social cohesion in small groups.Katz, James E. (ed.) 2008. Handbook of Mobile Communication Studies. Cambridge, MA: MIT Press.This edited volume offers a comprehensive view of the cultural, family, and interpersonal consequences of mobile communication across the globe. Leading scholars analyze the effect of mobile communication on all parts of life, from the relationship between literacy and the textual features of mobile phones to the use of ringtones as a form of social exchange, from the 'aspirational consumption' of middle class families in India to the belief in parts of Africa and Asia that mobile phones can communicate with the dead. The contributors explore the ways mobile communication profoundly affects the tempo, structure, and process of daily life around the world. They discuss the impact of mobile communication on social networks, other communication strategies, traditional forms of social organization, and political activities. They consider how quickly miraculous technologies come to seem ordinary and even necessary – and how ordinary technology comes to seem mysterious and even miraculous. The chapters cut across social issues and geographical regions; they highlight use by the elite and the masses, utilitarian and expressive functions, and political and operational consequences. Taken together, the chapters demonstrate how mobile communication has affected the quality of life in both exotic and humdrum settings, and how it increasingly occupies center stage in people's lives around the world.Ling, Rich and Scott W. Campbell (eds.) Forthcoming in Fall/Winter 2008. The Reconstruction of Space and Time: Mobile Communication Practices. New Brunswick, NJ: Transaction Publishers.Mobile communication enables us to call specific individuals, not general places. This advancement had changed, and continues to change, human interaction. It also alters the ways people experience both space and time. This edited volume explores these changes through a collection of studies from some of the top mobile communication researchers from around the world. Collectively, the contributions highlight nuanced changes in coordination and cohesion across space and time, the ways people manage mobile communication and mobility in new spatio‐temporal realms, and how individuals relate to their co‐present surroundings while using mobile communication technology.Online materials Resource Center for Mobile Communication Studies http://www.scils.rutgers.edu/ci/cmcs/ The Center for Mobile Communication Studies is the world's first academic unit to focus solely on social aspects of mobile communication. Established in June 2004 at Rutgers University's School of Communication, Information and Library Studies, the Center has become an international focal point for research, teaching, and service on the social, psychological, and organizational consequences of the burgeoning mobile communication revolution. International Journal of Mobile Communication Studies https://www.inderscience.com/browse/index.php?journalID=40 The International Journal of Mobile Communication (IJMC), a fully refereed journal, publishes articles that present current practice and theory of mobile communications, mobile technology, and mobile commerce applications. The objectives of the IJMC are to develop, promote, and coordinate the development and practice of mobile communications. The IJMC aims to help professionals working in the field, academic educators, and policy makers to contribute, to disseminate knowledge, and to learn from each other's work. The international dimension is emphasised in order to overcome cultural and national barriers and to meet the needs of accelerating technological change and changes in the global economy. IJMC is an outstanding outlet that can shape a significant body of research in the field of mobile communications and in which results can be shared across institutions, governments, researchers, and students, and also industry. Wi: The Journal of Mobile Media http://wi‐not.ca/ Wi publishes the latest in Canadian mobilities research, encompassing disciplines such as design, engineering, computer science, communications, and media studies. MobileActive.org http://mobileactive.org/ MobileActive.org is an all‐volunteer community of people and organizations using mobile phones for social impact. They are committed to increasing the effectiveness of NGOs around the world who recognize that the 3.5 billion mobile phones provide unprecedented opportunities for organizing, communications, and service and information delivery. They work together to create the resources NGOs need to effectively use mobile phones in their work: locally relevant content and services, support and learning opportunities, and networks that help MobileActives connect to each other. With these things on hand, tens of thousands of NGOs will be in a better position to enrich and serve their communities. The MobileActive.org community includes grassroots activists, NGO staff, intermediary organizations, content and service providers, and organizations who fund mobile technology projects. Mobile Society http://www.mobilesociety.net/ Mobile Society is an academic research website focusing on social aspects of the mobile phone. The site includes links and information about news, events, publications, and other related sites pertaining to the social consequences of mobile communication. SmartMobs: The Next Social Revolution http://www.smartmobs.com/ A Website and Weblog about topics and issues discussed in the book 'Smart Mobs' by Howard Rheingold.Select sample syllabus topics and readings for course on 'the social consequences of mobile communication' History and adoption of the mobile phone
Ling, Rich. 2004. 'The Mobile Connection' Chapter 1: Introduction. Castells et al. 2007. 'Mobile Communication and Society' Chapter 1: The Diffusion of Wireless Communication in the World.
Theoretical perspectives on the relationship between technology and society: Part 1, social and technological determinism
Ling, Rich. 2004. 'The Mobile Connection' Chapter 2: Making Sense of Mobile Telephone Adoption. Campbell, Scott W. and Tracy C. Russo 2003. The Social Construction of Mobile Telephony. Communication Monographs 70: 317–34.
Theoretical perspectives on the relationship between technology and society: Part 2, the 'network' perspective
Castells, Manuel. 2000. 'The Rise of Network Society' Opening Chapter: The Network is the Message. Castells et al. 2007. 'Mobile Communication and Society' Chapter 5: The Space of Flows, Timeless Time, and Mobile Networks.
Mobile communication in everyday life: Part 1, safety and security
Ling, Rich. 2004. 'The Mobile Connection' Chapter 3: Safety and Security.
Mobile communication in everyday life: Part 2: new forms of coordination
Ling, Rich. 2004. 'The Mobile Connection' Chapter 4: The Coordination of Everyday Life.
Mobile communication in everyday life: Part 3: new social networking practices
Ling, Rich and Birgitte Yttri. 2002. 'Hyper‐coordination via Mobile Phones in Norway' in Katz & Aakhus (eds.) Perpetual Contact. Licoppe, Christian. 2003. 'Two Modes of Maintaining Interpersonal Relations through Telephone: From the Domestic to the Mobile Phone' in J. Katz (ed.) Machines that Become Us. Campbell, Scott. W. and Michael Kelley. 2006. Mobile phone use in AA networks: An exploratory study. Journal of Applied Communication Research 34: 191–208.
Apparatgeist: 'Spirit of the machine' and the fashion and function of the mobile phone
Katz, James E. and Mark Aakhus. 2002. 'Conclusion: Making meaning of mobiles – a theory of Apparatgeist' in Katz & Aakhus (eds.) Perpetual Contact. Campbell, Scott W. 2008. 'Mobile Technology and the Body: Apparatgeist, Fashion and Function' in J. Katz (eds.) Handbook of Mobile Communication.
SMS and the language of wireless communication
Ling, Rich. 2004. 'The Mobile Connection' Chapter 7: Texting and the Growth of Asynchronous Discourse. Castells et al. 2007. 'Mobile Communication and Society, Chapter 6: The Language of Wireless Communication.
Use of mobile technology in public settings
Ling, Rich. 2004. 'The Mobile Connection' Chapter 6: The Intrusive Nature of Mobile Technology. Okabe, Daisuke and Ito, Mizuko. 2005. 'Keitai in public transportation' in Ito, Okabe, & Matsuda (eds.) Personal, Portable, Pedestrian. Ito, Mizuko, Daisuke Okabe and Ken Anderson 2008. 'Portable Objects in Three Global Cities: The Personalization of Urban Places' in Ling & Campbell (eds.) Reconstruction of Space and Time: Mobile Communication Practices. Campbell, Scott W. 2006. Perceptions of mobile phones in college classrooms: Ringing, cheating, and classroom policies. Communication Education 55: 280–294.
M 10/22 Use of the technology around co‐present others and the challenge of 'absent presence'
Cumiskey, Kathleen. 2007. 'Hidden meanings: Understanding the social‐psychological impact of mobile phone use through storytelling' in Goggin & Hjorth (eds.) Mobile Media Proceedings. Gergen, Kenneth. 2002. 'The challenge of absent presence' in Katz & Aakhus (eds.) Perpetual Contact.
The mobile youth culture
Ling, Rich. 2004. 'The Mobile Connection' Chapter 5: The Mobile Telephone and Teens. Castells et al. 2007. 'Mobile Communication and Society' Chapter 4: The Mobile Youth Culture.
Mobile communication in the socio‐political sphere
Castells et al. 2007. 'Mobile Communication and Society Chapter 7: The Mobile Civil Society: Social Movements, Political Power, and Communication Networks. Rheingold, Howard. 2002. 'Smart Mobs' Chapter 7: Smart Mobs – The Power of the Mobile Many. Campbell, Scott W. and Nojin Kwak. 2008, May. Mobile communication and the public sphere: Linking patterns of use to civic and political engagement. Paper presented at the ICA pre‐conference, The Global and Globalizing Dimensions of Mobile Communication: Developing or Developed?, Montreal.
W 11/7 Mobile communication in the developing world
Castells et al. 2007. 'Mobile Communication and Society' Chapter 8: Wireless Communication and Global Development: New Issues, New Strategies. Donner, Jonathan. 2008. Research approaches to mobile use in the developing world: A review of the literature. The Information Society 24: 140–159. Donner, Jonathan. 2008. The rules of beeping: Exchanging messages via intentional 'missed calls' on mobile phones. Journal of Computer‐Mediated Communication, 13(1). Available: http://jcmc.indiana.edu/vol13/issue1/donner.html.
M 11/12 Mobile communication and work
Andriessen, Erick and Mattai Vartianen. 2006. Emerging Mobile Virtual Work in Andriessen & Vartianen (eds.) Mobile Virtual Work: A New Paradigm? Perry, Mark and Jackie Brodie. 2006. Virtually Connected, Practically Mobile in Andriessen & Vartianen (eds.) Mobile Virtual Work: A New Paradigm? Chesley, Noelle. 2005. Blurring boundaries? Linking technology use, spillover, individual distress, and family satisfaction. Journal of Marriage and Family 67: 1237–1248.
OptionalFocus questions
To what extent does mobile communication lead to changes in family dynamics? On the one hand, mobile communication empowers youth to carry out their social relations 'under the radar' of parental supervision. In the 'old days', kids had to share a domestic landline phone and had less privacy, or had to shut themselves up in their room when on the phone to get privacy. The mobile phone is anytime/anywhere and it a personal object (not shared), so users have much more control over their private relations. Text messaging is an especially effective way of having private communication. Because of all this, young people have more autonomy to live out their social lives as they see fit. On the other hand, the mobile phone also gives parents more control by being able to better keep tabs on their kids and their kids' whereabouts. In some respects, it can actually be considered as an 'umbilical cord' keeping kids accountable to their parents. This is an interesting dichotomy for discussion. To what extent and how does the mobile phone support 'perpetual contact' among social ties? There seems to be a continual flow of communication now, which some refer to as 'perpetual contact'. Follow‐up questions could be: how is this a good thing? Are there negative aspects of perpetual contact? How is the mobile phone used for boundary management (i.e., demarcating in‐group members from out‐group members)? This can be seen in names kept in contact lists, who people text with, whose calls they screen, and even the style or brand of a phone ... some groups of friends get the same types of phones. What are the effects of taking/placing a phone call when interacting with physically co‐present others? What are norms for doing this? How can people mitigate the intrusion? On a related note to the questions above ... to what extent does the mobile phone lead to 'absent presence?' The notion of absent presence refers to being physically present, but socially absent. To what extent is this problematic? To what extent might mobile communication lead to 'tele‐cocooning?' Some are concerned that people are getting so wrapped up in their tight little social networks now, that they are less engaged with others who are weak social ties. If this is true, then it begs the question about whether there are benefits to having weak social ties. Most feel there are benefits, like being exposed to a diversity of perspectives and ideas. With regard to the changing media landscape, where else do we see increased 'personalization' in our uses of traditional mass media? In this sense, 'personalization' can refer to personalized content, interactivity, control, etc.
Research project idea (note this approach can be taken with any of the topics recommended above)Description of the paperMobile communication technology has become a common artifact in public settings, offering a means for social connection for its users and unsolicited melodies, chirps, and half conversations for co‐present others. Because social norms for behavior around others often conflict with those for phone conversations, mobile communication can present as many challenges as it does opportunities for maintaining social order. In class, we will discuss numerous perspectives on this topic, such as absent presence, symbolic fences, front stage‐back‐stage dynamics, and cocooning through mobile media. The purpose of this paper is to conduct an original investigation of the use of mobile communication technology around others. Each student will select a particular aspect of this phenomenon to explore in depth by collecting data first‐hand, analyzing those data, and drawing conclusions to shed new light on this topic. Students may choose to examine mobile communication in a particular setting, compare mobile communication in different social contexts or across different users, examine or compare the use of certain types of mobile technologies, observe reactions of and effects on non‐users of the technology, or select some other such 'angle' for the project that sheds light on this topic.Paper guidelinesYour paper should contain the following sections: (1) An introduction that justifies the importance of your topic and provides a clear explanation of the purpose of the paper, (2) a review of relevant literature/theory/key concepts to frame your particular project followed by specific research questions, (3) a method section explaining how you collected data (observation, interviews, questionnaires, and/or otherwise) and how you analyzed your data, and (4) a discussion section that develops conclusions based on the findings. Each paper should have at least 10 scholarly citations, of which at least half should come from readings other than those assigned for class. Use American Psychological Association (5th edition) to format citations and reference list. Papers should be about 10 pages in length, double‐spaced. In addition to meeting these guidelines, the writing should be clearly organized within each section and (of course) well‐written. Students will present their papers in class at the end of the semester.
Issue 18.1 of the Review for Religious, 1959. ; A.M.D.G. Review for Religious JANUARY 15, 1959 Cloistered Contemplatives . Plus XII Keeping the Rules . p. DeLetter Mental Illness Among Religious . . . Ricl~arg P. Vaugl~an Christ and the Supernatural Life . Daniel ,J. M~ Callahan Book Reviews :(~.uestio~s and Answers Delayed Vocations Roman Documents about: China Sacred Music and the Liturgy VOLUME 18 NUMBER REVIEW FOR RELIGIOUS VOLUME 18 JANUARY, 1959 NUI~IBER 1 CONTENTS EDITORIAL NOTE . 3 PIUS XII'S ALLOCUTION TO CLOISTERED CONTEMPLATIVES~ Translated by Frank C. Brennan, S.J . 4 KEEPING THE RULES~P. DeL~tter, S.J . 13 OUR CONTRIBUTORS . i . 24 DELAYED VOCATIONS . 24 SEVERE MENTAL ILLNESS AMONG RELIGIOUS-- Richard P. Vaughan, s.J . 25 COMMUNICATIONS . 36 CHRIST THE AUTHOR AND SOURCE OF THE SUPERNATURAL LIFE-- Daniel J. M. Callahan, s.J . ~ .37 SURVEY OF ROMAN DOCUMENTS~R. F. Smith, S.J . 42 QUESTIONS AND ANSWERS: 1. "Brain-washed" Religious . i~ . 49 2. Custom of General Permission for Christmas Gift.s .50 3. Is Permission All That Is Required in Poverty . 51 4. Changing the Constitutions on the Eucharistic Fast .51 SOME BOOKS RECEIVED . 52 SUMMER INSTITUTES . 52 BOOK REVIEWS AND ANNOUNCEMENTS . 53 REVIEW FOR RELIGIOUS, January, 1959. Vol. 18, No. 1. Published bi-monthly by The Queen's Work, 3115 South Grand Boulevard, St. Louis 18, Missouri. Edited by the Jesuit Fathers of St. Mary's College, St. Marys, Kansas, with ecclesiastical approval. Second class mail privilege authorized at St. Louis, Missouri. Copyright, 1958, by The Queen's Work. Subscription price in U.S.A. and Canada: 3 dollars a year; 50 cents a copy. Printed in U.S.A. Editor: R. F. Smith, S.J. Associate Editors: Augustine G. Ellard, S.J.; Gerald Kelly, S.J.; Henry W'illmering, S.J. Assistant Editors: John E. Becker, S.J.; Robert F. W'eiss, S.J. Departmental Editors: Joseph F. Gallen, S.J.; E~arl A. Weis, S.J. Please send all renewals, new subscriptions, and business correspondence to: Review for Religious, 3115 South Grand Boulevard, St. Louis 18, Missouri. Please send all manuscripts and editorial correspondence to: Review for Religious, St. Mary's College, St. Marys, Kansas. Review For Religious EDITOR R. F. Smith, S.J. ASSOCIATE EDITORS Augustine G. Pllard, S.J. Gerald Kelly, S.J. Nenry Willmering, S.d. ASSISTANT EDITORS John E. Becker, S.J. Robert F. Weiss, S.J. DEPARTMENTAL EDITORS Quest:ions and Answers-- Book Reviews-- Joseph P, Gallon, S.J. Earl A. Weis, S.J. Woodstock College West Baden College Woodstock, I~a~land West Baden Springs, Indiar~a Volume 18 1959 Editorial Office ST. MARY'S COLLEGE St:. Marys, Kansas Publisher THE QUEEN'S WORK St:. Louis, Missouri Published in January, March, May, July, September, November on the fifl;eenth of the month REVIEW FOR RELIGIOUS is indexed in the CATHOLIC PERIODICAL INDEX EDITORIAL NOTE SEVENYETARES' agEo inNJanuary, 1942, REVIEW FOR "RELIGIOUS published its first issue. The publication of that issue was due to the initiative of three men: Father Augustine G. Ellard, Father Adam C. Ellis, and Father Gerald Kelly, all of the Society of Jesus .and members of the teaching staff of St. Mary's College, St. Marys, Kansas. As co-founders of the l/1WIE\\r, they also served as the editorial board for the new magazine, cbntinuing this to the° year 1955; ih that: year Father .Ellis, finding it necessary to curtail his work, withdrew from the editorial board of the I/ErIE\\;, being replaced by Father Henry Willmering, S.J. Now as REVIEW FOIl RELIGIOUS begins'its eighteenth' ye.ar of publication, further editorial changes have been found advisable. H~nceforth the editorship of the REVIEW will be entrusted to an individual, assisted by associate, assistant, and departmental editors. On the occasion of /uch a cha~ge it is only" fitting that the new editor should express in a public way hi/ appreciation and his congratulations to the members of the former editorial board for the time and effort [vhich they generously gave to the I/EVlEW aid which made of it so successful a magazine. It is a matter of great satisfaction to him that the members of the former editorial board will remain as associate editors to gi.v.e the REVIEW the frdit of their knowledge and their long experience. It is also fitting on this occasion that a special word of thanks be given to Father Gerald Kelly. .For a long time the major part of the editorial work" of the Ill;VIEW has been borne by him; ¯ accordingly, to a large extent the. godd that the RF.VIEW has done is due to ¯his ufistilating' ~fforts. From the rdaders of REVIEW FOIl RELIGIOUS the new editor seeks first of all prayers that the REVIEW in it~ future issues may continue to serve, religious as well as it has done in the past; .secgndly he requests suggestions for changes and improvements in the magazine. The Editor Plus XIl's AIIocu ion I:o Clois!:ered Cont:emplat:ives Translat:ed by Frank C. Brennan, S.J. [The successive parts of this allocution, which will" be published in this and two following issues of the REVIEW FOR RELIGIOUS, were broadcast by Plus XII on July 19, July 26, and August 2, 1958. The official text of the allocution is to be found in Acta Apostolicae Sedis (AAS), v. 50 (1958), pp. 562-86. All divisions and subtitles in the translation are also found in the official text.] GLADLY YIELDING to your many iequests, We are happy, beloved daughters, to address all the cloistered nuns of the Catholic world on the subject which is closest to their hearts: their vocation to the contemplative life. At times you have perhaps envied the joy of pilgrims who fill to overflowing the gre.at basilida of St. Peter and the audience chambers of the Vi~tican to assure Us of their pride in belonging to the Catholic Church and of their delight in welcoming the words of its universal head. At this time We are mindful- of your three thousand two hundred monasteries spread throughout the whole world and in each of them We visualize a recollected audience which, though silent and invisible, yet pulsates with the charity that unites you. How could you be absent from Our mind and Our heart--you who constitute a chosen group in the Church, called as you are to a more intimate participa-tion in the mystery of the redemption? Thus it is with all Our paternal affection that We wish you to preserve intact that religious life o~ yours which in its essential elements is identical for all of you but" whidh varies ~evertheless in accord-ance "with the inspiration of your different founders and according to the historical circumstances through which their work has lived. The canonical contemplative life is a path toward God, an ascent which is often rough and austere but in which the labor of each day, supported as it is by divine p~omises, is enlightened by the obscure yet certain possession of Him toward Whom you strive with all your strength. In order to CLOISTERED CONTEMPLATIVES respond better to your vocation, listen to Our message which will help you to understand it more, to love it~ with a purer and more generous love, and to realize it more perfectly in every detail of your lives. This ascent toward God is not the simple movement of inanimate creation, nor is it merely the impulse of beings who, endowed with reasofi, recognize God as their Creator and adore Him as the infiriite Being Who transcends immeas-urably all that is great and true and beautiful and good) It is more than the ascent of the ordinary Christian life, more even than the general tendency toward perfection'. It is an ideal of life, fixed by the laws of the Church, and for this reason called thecanonical contemplative life. Far from being restricted, however, to one rigidly determined form, it is of various types corresponding to the character and customs dis-tinctive of and proper to each of the various religious families such as the Carmelites, the Poor Clares, the Cistercians, the Carthusians, the Benedictines, the Dominicans, the Ursulines, and the Visitandines. This contemplative life; diversified as it is by the different religious orders and even within each of them by the subjects themselves, is a path toward God. God is the beginning and end of it; God it is who sustains its fervor and perva~es it entirely. PART I: KNOWLEDGE OF THE CONTEMPLATIVE LIFE Knowledge of the Contemplative Life as a Way Leading to God "First of all, We wish to speak to you of the knowledge of the contemplative life as a way leading to God. In order to live out in its fullness the ideal which you propose to your-selves, it ;is important .that you know what you are and just What you are seeking to accomplish. The apostolic constitution Sponsa Christi of November I, 1950, includes in its first part'-' a discussion of "virgins See the Vatican Council, Session III, Chapter 1; Denzinger n. 1782. 2AAS, v. 43 (1951), pp. 5-10. P~us,XII Review for Religious consecrated to God," as constituting a state of life which.has existed from the beginnings of Christianity down to the most recent, institutes of nuns. Without repeating what We there wrote, We' call to your attention the advantag~ which you reap from a knowledge, at least in summary form, of the evolution of the religious life for women, and of the different forms it has taken throughout the ages. Thus .you~ will better appre-ciate the dignity of your state of life, as well as the originality of the order to which you belong and its bond with the whole Catholic tradition. General Principles Concerning the Nature of the Contemplative Life At this time We shall dwell only on those general prin-ciples which distinguish your life from that of others. For this purpose we have recourse to the sound and reliable teach-ing of St. Thomas. According to this master of Catholic theology, human activity can be distinguished into active and contemplative, jugt as the unde'rstanding, that uniquely human power, can be considered either as active or passive.'~ The human intellect is ordered either to the knowledge of truth-- and this is the work of the contemplative understanding, or to external action--and this is proper to the active or practical intellect. But the contemplative life, according to St. Thomas, far from being confined to a lifeless intellectualism or abstract speculation, also brings into play the heart and the affections. The reason for this he finds in the very nature" of man. Since it is the human will which impels the other human faculties to act, it is likewise the will which moves the intellect to operation. Now the will belongs to the domain of the affections; accordingly it is love which moves the under-standing in all of its acts, whether it be love of knowledge itself or love of the thing which is known. Citing a text St. Gregory, St. Thomas underlines the part played by the love of God in the contemplative life in the expression ". Summa Theologiae, 2-2, q. 179, a. 1 ad 2; a. 2 in c. January, 1959 CLOISTERED CONTEMPLATIVES in quantum scilicet aliquis ex dilectione Dei inardescit ad eius pulchritudinem conspiciendam" (in as far as one is inflamed by love of God to seek the contemplation of His beauty). The love of God which St. Thomas places at the very beginning of contemplation he also proposes as its final goal, for contemplation reaches its fullness in 'that joy and peace which the soul tastes when it possesses the beloved object of its search) Thus the contemplative life is completely permeated by divine charity which, inspires its very. first steps and rewards its efforts. The object of contemplation for St. Thomas, is prin-cipally divine truth, the final goal of human life. Contem-plation requires, as a necessary preparation, the , subject's exercise of the moral virtues; and it is aided throughout its development by other acts of the understanding. Before arriv-ingat the end of its search, it is also aided by the visible works of creation which reflect invisible realities) But its ultimate perfection is achieved only in the contemplation of di, v.ine truth, the supeme beatitude of the human spirit." Misunder-standing, narrow mindedness, and. erroneous opinions will be avoided if in speaking of the contemplative life, care is taken to recall the Angelic Doctor's teaching which We have just outlined in its essentials." The Nature of the Contemplative Life According to the Apostolic Constitution Sponsa Christi We must now determine the nature of the canonical contemplative life which you are leading. We take our defini-tion of it from the apostolic constitution Sponsa Christi, Article 2, parggraph 2: "On the general statutes of cloistered nuns." "By the canonical contemplative life we do not mean that interior, God-centered life to which all sbuls living in religion and even in the world are called and which each one can lead individually. Rather we mean the external profession of a Summa Theologiae, 2-2, q. 180, a. 1 iffc. 5See Rom. 1:20. Sumraa Theologiae, 2-2, q. 180, a. 4 in c. PIus XII Review for Religion,s religious life which, whether by cloister or by exercises of piety, of prayer, and of mortification, or finally by the labor which is requii:ed of the nuns, is so ordered to interior con-templation that the whole of life and every detail of it can and should be easily and efficaciously penetrated by the search after this contemplation.''v Subsequent articles in the consti-tution single out other features in the canonical contemplative life for women. Among these are the solemn vows of religion, pontifical cloister, the divine o~ce, the autonomy of monas-teries, the federation and confederation of monasteries, monas-tic work, and .finally the apostolate. We do not propose to treat each of these points here but only to explain briefly the definition cited above. What the Contemplative Life is Not We shall first of all state what the canonical contempla-tive life is not. It is not, according to the constitution, "that interior, God-centered life to which all souls living in religion and'~even in the world are called and which each one can lead individually."s The constitution Sponsa Christi adds no further distinc-tion to this negative part of its definition. It makes it clearly understood that it will not discuss this aspect of the religious life and that it is not addressed to those who practice it exclu-sively. It further states that all are invited by Christ to this kind of life, even those who live in the world in whatever state of life, including that of marriage. But since the "apostolic constitution does not speak of this kind of contemplative life, We wish here to single out the existence of a contemplative life practiced in secret by a small number of persons who live in the world. In Our allocution of December 9, 19:57, to the Second International Congress of the States of Perfection,9 We said that there are today Christians "who, known to God alone, are engaging in the practice of the evangelical counsels AAS, v. 43 (1951), pp. 15-16. Ibid., p. 15. AAS, v. 50 (1958), pp. 34-43. Janl~ary, 1959 CLOISTERED CONTEMPLATIVES by private and secret vows, and are guided with respect to obedience and poverty by persons whom the Church has deemed fitted for this work and to whom she has entrusted the direction of others in the exercise of perfection." These people lead an authentic life of Christian perfection although it is outside any canonical form of the states of perfection. And We concluded this address by saying that "none of the elements which constitute Christian perfection is found want-ing among these men and women. They truly participate, therefore, in the life of perfection, even though they may not be engaged in any juridical or canonical state of perfection.''~° We can repeat this statement now in connection with a type of life wherein one strives toward perfection by living a contempla-tive life and by the practice of the three vows of religion, but privately and independently of the canonical forms envisioned by the apostolic constitution Sponsa Christi. No doubt, the external conditions necessary for such a life are more diffi-cult to verify than those required for the active .life; but they can be met. Since these persons are not protected by any kind of canonical cloister, they practice solitude and recollection in a heroic manner. We find a good example of this in the Gospel of St.~' Luke wl~ewree read of the prophetess Anna, a widow after seven years of marriage, who retired into the Temple wher~ she served the Lord night and day in prayer and fasting.'1 Such a private form of the con-templative life is not unknown in the Church, and the Church approves of it in principle. Primacy of Contemplation in the Canonical Conti~mplative Life The positive part of the definition given in paragraph 2 of the Constitution Sponsa Christi defines the canonical con-templative life as "the external profession of a religious life that is so ordered to interior contemplation that the whole of PIUS XII Review for Religious life and every detail of it can and should be easily and effica-ciously penetrated by the search after this contemplation." Among the prescriptions of religious discipline the text speci-fies cloister, exercises of piety, of prayer, of mortification, and finally the manual labor which is suitable for nuns. But these particulars are enumerated only as means of attaining the essential goal which is interior contemplation. What is first of all required of the nun is .that she so unite herself to God in prayer, meditation and ~ontemplation that. all herthoughts and actions be suffused with a realization of God's pr.esence and be ordered to His service. If that should ever be lack-ing, the very soul of the contemplative life would be lacking, and no canonical pr~scription could supply it. The contem-plative life, to be sure, is not restricted exclusively to contem-plation. It includes many other elements, but contempla-tion does occupy the first place. We might go so far as to say that contemplation completely pervades the contempla-tive life, not in the sense that it prevents one from thinking of anything else or from doing other things, but in the sense that in the ultimate analysis it is contemplation that gives meaning, value, and orientation to the contemplative life. What we wish to emphasize with all Our authority is the preemi-nence of meditation and contemplation over every other path to perfection, over all practices and all forms of organiza-tion and federation. If you are not firmly anchored in God, if your mind is not continually returning to Him as to a pole of irresistible attraction, then it must be said of your con-templative life what St. Paul in his First Epistle to the Corin-thians said of certair~ Christians who overestimated the charis-' matic gifts and failed to accord first place to charity: "If I have not charity, I am become as sounding brass or.a tinkling cymbal. If I have not charity, it profiteth me nothing.''1"~ It can rightly be said of a contemplative life without con-templation that "it profiteth nothing." 12 1 Cor. 13 : 1 and 3. 10 January, 1959 CLOISTERED CONTEMPLATIVES just as the human body in possession of all its organs but bereft of the soul. is not .a man, so all the rules and exer-cises of a religious order do .not constitute the' contemplative life when contemplation itself, the vital principle, is absent, Formation of Religious in the contemplative Life If the~reti~al comments, such as the one We have just sketched," can help" to enrich .your.okn~wledge of the con-templati~, e life, 'certainly. the daily practice of your vocation brings, for its part, an abundant variety of lessons/For cen- ~ur~!~s hol~" women, ~hether they be Carmelites, Ben~edictines, Poor Clares, Dominicans, Ursulines, or Visitan-din. es, have reached a profound under.standing of the nature and of the requirements .of. the canonical contemplative life. From their very entrance intg" t.h.e .cloiste~r, candidates are taught the rules and the customs of their order; and this fo'rmation 6f mind and will which" is .begun in the novitiate continues ~throughOut their entire religious life. Such is the purpose of the instruction and spiritual direction given by superiors of the order br by the priests who are confessors, spiritual directors, and retreat masters. Usually nuns Who live according" to a ~listinctive .spirituality are directed by priests belonging to the masculine branch of their, order and there-fore possessing the s~me"spi~ituality. In addition, the Church h~ts throughout the ages cultivated the science of mystical theology which "has proved itself not only useful but ever~ necessary for the direction of c~ontemplatives. It gives proper orientation and renders signal service by ferreting out illu-sions and by distinguishing what is authentically supernatural from what is pathological., In this delicate field women them-selves have been of great service to theology and to directors of souls. ,It is enough to mention here. the writings of-the great St. Theresa of Avila who, as we know, when ther~ was question of settling difficult proble~ms of.the contemplative life,~ preferred the advice of an experienced theologian to that of a mystic who lacked clear and precise theological knowledge. 11 P~us XII In order to deepen by daily practice your appreciation of. the contemplative life, it is important to remain receptive to the teaching that is provided, to welcome it with attention and with the desire of mastering it, each one according to her capacity and stage of development. It would be equally erroneous to let your aim be too high or too low, or to try following only one way identical for all, or to demand of all the same efforts. Superiors responsible for the formation of their subjects will know how to establish a just mean. They will not demand too much from the less gifted nor will they compel them to go beyond the limits of their abilities. Like-wise an Asian or an African will not be obliged to adopt religious attitudes that are natural for Europeans. A cultured and carefully'educated young girl will not be bound to a form of contemplation which is suited .to those who are less gifted. At times the invectives of St. Paul against worldly wis-dom, found in his First Epistle to the Corinthians, are cited to thwart the legitimate desire of nuns wishing to reach a degree of contemplation in keeping with their abilities. These words of the Apostle are quoted to them: "We preach Christ crucified'''~ and "I have desired to know nothing among you, except Jesus Christ and Him crucified.'''4 But this is a mis-understanding of St. Paul, who intends to denounce the vain pretensions of human knowledge. The desire to have an ade-quate spiritual formation is not at all reprehensible nor in any way opposed to tha~ spirit of humility and self-denial which a sincere love of the cross of Chris~ demands. We here conclude, beloved daughters, the first part of our discussion; and We call down upon you the light of the Holy Spirit that He may help you to understand the splendor of your vocation and to live it Out in all its fullness. As a pledge of these divine favors, We impart to you with all Our heart Our paternal and apostolic benediction. I Cor. 1:23. Ibid., 2:2. 12 Keeping !:he Rules P. DeLel:t:er, S.J. IWILL BURST ASUNDER rather than transgress volun-tarily even the least order or regulation." Thus resolved the young Jesuit saint, John Berchmans. And the future apostle of the Sacred Heart, Blessed Claude de la Colombi~re, when in tertianship, took a vow to keep his rules according to a formula approved by his director. Both this resolve and this vow express an identical faith in the religious rules and a like love for them. Both John and Claude believed in their rules as the divinely intended way to holiness, and they loved them as directing their eager desirefor progress along the way of the divine will and good pleasure. This faith and this love led them to a grim determination of fidelity at any price. But they were saints! and of another time! Today, religi-ous are liable to take a different view of the practice of their rules. Modern people, it is ~aid, and particularly the young, loathe regulations and constraint. They dream of a free expan-sion of their personalities; they have greater faith in their own initiative and personal inventions than they have in external laws and rules. Not surprisingly, they sometimes lose their balance and incline to depreciate and neglect accepted ways and customsla one-sidedness that is not without risk and dan-ger. Religious today~ who once lived according to these ideas of the "world" and who continue to live and work in the midst of this world without being of it may well fail to keep immune from this dangerous stand concerning rules and regulations. Unless they shield themselves against influences from the world by prayer and reflection, they gradually fall victims to this sort of practical "modernism," both in their theoretical views of the rules and in their practical observance or non-observance of them. They do believe, no doubt, that it is their duty to keep the rules', that. this fidelity is for them 13 P. DELETTER Review for Religious the safe way to sanctity and apostolic .fruitfulness traced out by unmistakable providential indications. But at times, particularly on busy days or at times of spiritual low ebb, they may feel perplexed about how to manage to keep all the rules. There are so many of them; it is scarcely possible to know and remem-ber, let alone to keep them! In those moments especially, the iriclination to depreciate and .neglect 'the rules is fanned by the breeze" that blows from the outside world into the precinct~ of the cloister. Unless they build up by prayer and meditation a firm motivation and an enlightened resolve to keep the rules, religious may unwittingly be contaminated by the modern dis-esteem for regulations. It may be well then to" ask ourselves: What do:we mean by keeping the rules? How shall we manage ifi practice? Why must we take the trouble? Rules of Two Kinds Among the religious rules which of themselves do not bind under sin--we leave aside the rules that determine the "matter of the vows and for that reason entail obligations under pain of sin--we should for our present purpose distinguish two cate-gories or kinds. There are the disciplinary'prescriptions which concern mainly external observances and community order. These aim in the first place at the common good of the insti-tute and the external discipline .of the religious communit~y. They impose on individual-religious, members of the community, some ways of speaking, acting, or dealing with people; an order of the day, times of silence and of talking, of work and rest or re.creation. They concern the religious as. members of the community .and .determine. their individual, contributions to the good of the community; they do not directly or primarily intend their personal spiritual profit, but only indirectly and consequently, 'to the extent that each individual religious cannot fail to profit by the regularity and'order' of a community life in which these rules are properly kept and by the° personal sacrifices this "regularity demands of each of them. 14 Jan~ary~ 1959 KEEPING THE RULES There are also in the religious rules spiritual directives that propose to our endeavors ideals for the spiritual life and for the Work of the apostolate and the means to strive after them. These determine the particular spirit of each institute, its. form of spirituality, and its apostolate. They often explicitly state the proper virtue of the institute. They aim directly at the spiritual perfection of individual religious' and at their spiritual apostolate, indirectly at ~he common spiritual good of the com-munity and the institute, since the fervor of a community and of an institute results from the spiritual and apostolic quality of its members. These rules prescribe and propose obligations that are more a matter of interior spirit than of external practice and, consequently, are less open to control and check than are disciplina.ry rules. It requires little reflection to see that keeping the rules means one thing with regard to the first category and another with regard to 'the second. Keeping Disciplinary Rules We keep disciplinary rules when we actually do what they prescribe, for example, keep silence, make a visit to the Blessed Sacrament, study, or follow the common exercises, and do not do what they forbid, for instance, not go out without due leave nor recreate outside the appointed time. This external fulfillment of the rule is an easy matter to control. We can easily know, and others too can see whether we do and omit what is expected of us. It may be well, however, to note that an occasional break-ing o~ a rule which is not frequent or habitual and happens out of human frailty and forgetfulness, however regrettable, need not and generally does not take away our real desire and resolve to keep the rules. Our fidelity remains intact even then, provided we endeavor to make good our neglect as far as we can and do penance for our transgression even on our own initiative and without awaiting official correction. These occa- 15 P. DELETTER Review for Religion,s sional failures generally imply, on the part of the religious, little guilt. They can and should be rather an occasion for humility and patience; never should they be a reason for open or hidden discouragement. They do not affect our fervor and, when taken humbly and patiently, can turn to greater spiritual good. Moreover, they gradually decrease in number and in guilt in the measure that our resolve of fidelity grows in intensity and we by practice acquire the habit of living according to the rules. Nor do these occasional lapses much affect the common good, which is the first purpose of disciplinary rules. They do not ruin the general discipline and regular observance. This regularity supposes that we habitually keep the rules and correct occasional failings. It does not demand of us the impossible ideal that human beings should as it were turn angels and be raised above all human frailty. It is a saint who said that the difference between a fervent and a lax community does not lie in this, that in the first no failings occur while in the second they do. No, failings happen in both; but in a fervent com-munity they are less frequent and are corrected, while in a lax community they go unpunished. On both counts, there-fore, that of the individual religious's conscience and that of the good of the community, occasional breaking of disciplinary " rules need not label a religious or a community as guilty of infidelity to the rules. Only those religious must be said not to keep their rules who neglect them habitually or frequently, who care little and take little trouble to regulate their manner of living according to the rules. These, in spite of occasional fidelity {for they need not be violating the rules all the time), do not bring to the common observance the share they are expected to con-tribute. Their negligence does harm to the regularity of the community and to the common discipline. And they them-selves suffer spiritual harm from their neglect and unconcern about the common good. For though the breaking of rules is 16 January, 1959 KEEPING THE RULES not of itself a sinful transgression, .yet in the habitually negligent a sinful motive all too often prompts their manner of a~ting and turns their infidelity into sin. Actually, the habitual observance of disciplinary rules, for all its being mainly a matter of external conduct, is not well possible without an interior spirit. Whether we view it from the angle of the community or from that of the indi-vidual religious, in both respects it supposes an interior dis-position that prompts the external fulfillment. Regula¥ observ-ance is the contribution each religious is to make to the com-mon discipline and order; it must be prompted by the genuine and effective desire for the good of the community and of the other members. Then only can religious infuse a living soul into their habitual fidelity. Without this soul, that fidelity is precarious and liable to decay. And for the religious them-selv, es, fidelity to disciplinary rules, besides being the fulfill-ment of God's express desire, is actually a practice of religious courtesy toward all members of the community. It demand~ that they inconvenience themselves in order not to inconveni-ence others. Seen in this 'light, it should not be difficult to say what is for every religious habitual fidelity to these disci-plinary rules. Following Spiritual Directives Less simple and definite is the idea of fidelity or infidelity to the rules that propose spiritual directives. This is not a matter of a mere yes or no. When religious rules prescribe humility or charity or right intention or a spirit of prayer, they do not just demand one or more definite acts, whether external or even purely internal. "They rather propose an ideal to be striven after; they demand an interior spirit that should animate our manner of living and our whole activity. Fidelity to these rules varies in perfection. All religious who are ever so little concerned to be what they are supposed to be may be said to keep these rules to some degree. But there are many degrees of fidelity, from" a minimum degree in the mediocre 17 P. DELETTER Review for Religion,s and tepid religious to an ever growing fidelity in the fervent who are keen on their spiritual progress. What these rules demand of religious may be reduced to two points.First of all, they require that religious wish to know and to grasp the ideal of spiritual and apostolic perfection propdr to their institute and the means it expects them to use for its realization. There are within Catholic spirituality different types of ascetical and apostolic ways. Some great schools of spirituality bear the name of a religious order, such as the Franciscan or Dominican or Benedictine schools. Actually it i's normal that a religious institute develop its own form of spirituality and of apostolate and wish to see in its members, unifying possibly wide individual varieties, some common family traits. These are generally summed up in what we call the spirit of the institute--a phrase whose meaning is more easily sensed and graspe~l from actual experience of the religious life than expressed in definite concepts and words. It always designates the proper manner in which a religious institute strives after perfection and practices the apostolate. And we find it laid down in the set of rules which give the spiritual directives we are considering. A first duty of religious then is evidently to know, less perhaps in theory than in actual practice, the spirit of their institute and its particular type of spirituality and spiritual perfection. A second duty these rules impose on religious is that they should make the effort necessary to acquire the virtues that belong to their proper spirituality. This is an objective never fully achieved; there always remains room for further progress. Consequently, these rules demand of religious that they endeavor to progress in the virtues proper to their institute and at all times keep up this effort. There never is a moment when they can say they have done what they had to do. Keeping these rules is an ever-unfinished task. Nor is fidelity to these rules impaired when religious see their efforts apparently rewarded with scant or no success. It is not success ~hat the rules demand, 18 January, 1959 KEEPING THE RULES but the effort. All this goes to show that there can be many degrees in fidelity to these rules of spirituality. The more genuine one's desire of perfection and apostolic usefulness, the more effective also grows this fidelity. On the other hand, infidelity in keeping these rules is no mere matter of saying no or of not doing. It is rather a question of a habitual disposition. Religiouswho do not care to know and to make their own the spirituality of their institute and who more or less deliberately warp their own outlook on the spiritual life and on the apostolate by adopting a spirit and ways tha~ are not in keeping with their vocation would evidently be unfaithful to these rules. It may be difficult to say definitely by what particular acts they break them, yet there is no doubt that these religious do not live up to the demands of their rules. Similarly, religious who would set aside the effort to put into practice, in the measure of the grace God deigns to give them, .the spiritual and apostolic ideal of their rules' and institute would fail to keep these rules. Even without such wholesale defeatism or practical scepticism and indifference toward their ideal of spirituality, religious incline to abandon the directives of these rules when they relax their effort for progress and allow it gradually to dwindle to less and less. Low spiritual fervor means in practice a declining fidelity to these rules. Exceptions to the Rules From the above it should be clear what keeping the rules means in actual practice. One more point remains to be made which is not unimportant. There are, proverbially, exceptions to all rules, also to religious rules." There are cases in which it is right and lawful to act in .a manner which on the face of it looks like breaking the rules. (We have in mind here mainly the disciplinary rules.) The question is this. At times we hear it said that religious rules do not bind under sin in theory but that in practice breaking the rules will more often than not, if not always, be sinful because of the wrong motive that prompts the violation or because of the scandal that folldws from it~ 19 P1. DELETTER Review fo~" Religious This seems to be an overstatement. If it were correct as a general statement, then the intention of religious founders who expressly said that the rules of themselves do not bind under sin would be more nominal than real and would never materialize in concrete facts. Actually, practical experience of the religious life shows that there are cases, and they are not altogether excel~tional, in which there is no such sinful motive for an apparent breaking of rules nor any attending scandal. This happens whenever a sincere desire of greater good, especially spiritual, promp.~s a manner of acting which is not in material conformity with the letter of the ~ules. Charity for a fellow religious may require that we speak in time of silence. A too rigid application of the rule of not interfering in another's office may preclude a useful and necessary help. In these and similar cases it is better to follow the spirit of the rule rather than its letter, for that is exactly what the exception comes to. Evidently, these cases are not of everyday or every-hour occurrence. The very approval of the religious rules by ecclesiastical authority is a guarantee that they are sufficently adapted to the common run of the religious life. Yet such situations are not so exceptional as hardly ever to arise. The reason for saying so is not mysterious. Religious legisl~ltors, as any other human lawgivers, are not in a position to foresee in detail ttie concrete and chang-ing circumstances in which their laws will have to be applied. They can foresee only the common and normal situations ,and legislate according to the general laws of human psychology and of Christian asceticism. Individual cases may arise--and in actual fact, all real cases are individual and not general--in which elements enter that no one could forecast and which may, as it were, reverse the whole situation in such manner that a material application of certain prescriptions would have the very opposite effect of what the legislator intended. In such cases it is clearly the spirit of the rule that one should follow. Then such exceptions merely confirm the rule. 20 January, 1959 KEEPING THE RULES In actual practice one should say that ordinarily the right thing for religious to do will be. to follow both the spirit and the letter of the rule, for generally these two do not clash. When, however, there is an opposition between them on account of special circumstances, then it is right to keep the spirit rather than the letter of the rules. But this manner of conduct supposes on the part of religious a thorough sincerity and purity of intention in desiring the greater good. Otherwise self-love too easily may blind them and turn this so-called sinless break-ing of a rule into a cloak for egoism and other unworthy motives. Breaking of Rules Besides these legitimate exceptions to the rules, there may be cases when it is not the desire to follow thdir spirit that prompts one.to :neglect them but a disordered.motive, such as laziness or selfishness or vanity. Must we say that such a breaking of disciplinary rules, which of themselves do not bind under gin, will always be sinful because of the disordered motive or because of the scandal following from the violation? The problem is delicate and difficult. It is delicate, for which religious will claim that he never breaks a rule out of more or less disorderly motives? Will he each time sin at least venially? It is difficult, because it involves the theological problem of positive imperfections. ,We do not wish to enter here upon a detailed discussion, but only to note that there are two opinions on the question. The more rigorous, and perhaps the more common, holds that the disorderly motives will always infect the violation of the rule in such manner as to make it sinful, at least venially. The more lenient opinion, and perhaps the more realistic, says that the disordered motive does not make a transgression of a rule sinful unless the rule binds under sin; the breaking of rules which do not bind under sin, such as disciplinary rules, even from a wrong motive, consti-tutes as such a positive imperfection. The two opinions also solve differently the question of scandal, supposing there was an occa- 21 P. DELETTER Review for Religious sion of scandal in the breaking of rules; the bad example may lead others to what is considered either as sinful or as a positive imperfection. Without definitely opting for one of these two opifiions, we may perhaps say this: for all practical purposes, the breakin~ of a disciplinary rule from a disordered motive will be sinful only when it would be sinful even supposing that there were no rule. Then the sinful motive clearly would make the action -or omission an act of selfishness or vanity or laziness. If this suggestion is acceptable, then we may say that in practice negli-gent or tepid religious, who care little about even deliberate venial sins and commit these rather frequently, may often be led by venially sinful motives when they break rules. Their breaking of rules more often than not may well be sinful. But with religious who earnestly endeavor to live up to their ideal, it need not be so. They may happen to neglect a rule now and then even from a wrong motive, but this will be more a "failing" ~han a "transgression." Ii: need not be sinful. Despite their failings in externals, they may. not mean deliberately to-neglect the spirit of their rules. The Spirit of Our Observance The preceding remarks point to the importance of the spirit in which we keep our rules. This is in a way. more important than the material fidelity to their prescriptions. It is, moveover, the only guarantee, of steadiness and thoroughness in our regular observance. What we must come to is this: to see the rules not merely as restrictions to our liberty and initia-tive- they are this/ no doubt, to some extent; and to some modern eyes they show mainly this unappealing aspect--but first and foremost as helps to our weakness and generous good-will, helps which we need badly to shield us against our own inconstancy and passions and against seductive influences from outside." This is true of both kinds of rules we considered above. The regularity and order in the community which are the .fruit of common fidelity to disciplinary rules are a great help 22 January, 1959 KEEPING THE RULES to all its members for both spiritual and apostolic effectiveness. By keeping these rules we ourselves are helped, and w'e help others as well. And the spiritual directives of our rules show the safe way in which our effort i~or spiritual progress should push on. The rule guarantees the ever-necessary help of grace, for all religious at all times, receive the graces necessary to fulfill the duties of their state. And keeping the rules is one of the main duties of their state. Accordingly, the spirit that must guide our endeavor in keeping the rules is one of gratitude and love. It should not be one of fear and anxiety, not even fear of doing wrong. It is precisely, we are told, to do away with a spirit of fear that religious founders, and Holy Church after them, do not wish the rules to bind under sin." Fe~lr, moreover, does not lead to generosity; and without generosity who could actually keep the ruleS? It is gratitude for the help the rules afford us that should inspire our fidelity in keeping them--a gratitude shown less in words than in deeds, in the very deeds of our fidelity. It is above all love for Christ, whose call to perfection and to the apostolate we answered with the help of grace when we joined, the religious life, that must motivate our fidelity to the rules. Actually, this fidelity is nothing less than our continued answer to His call. For every day and every hour He beckons us to draw nearer to Him and to bring others with us, and He does so particularly through the. i, ery directives of our rules. To do what the rules prescribe is nothing else but love for Christ in deed. This spirit of love for Christ will silently and effectively show us how to manage concretely to keep Our rules in such manner that we, as it were, feel at ease and happy in the practice of this fidelity. It will not, evidently, do away with every constraint and every sacrifice. To toe the line always means restrictions on our inclinations and whims. But, for love of Christ, we can come to love this very self-denial demanded by 23 P. DELETTER fidelity to the rules, love it as the way in which we can show Christ the genuineness of our love for Him--and for His. Love gives new eyes to see. And when we have under-stood, as the Lord cannot fail to teach us, that we cannot love Him iti truth unless we also love our neighbor and Him in our neighbor, then we shall also find other reasons for keeping our rules, particularly those that concern the good of the community. Regular external observance, animated by a genuine interior spirit, is a dut~ and help we owe to all members of our com-munity. Each one of us is responsible for the influence he has in the community. Whether we think of it or not, whether we intend it or not, our very manner of l~eeping the rules makes fidelity to them either easier or harder for our fellow religious. If we truly love Christ, we shall' not refuse Him the help He asks of us in our brethren, the help our regularity gives them in a silent but effective manner. He on His pare will not with-hold the help of His grace we need to be faithful. Thus keep-ing .the rules in union with our brethren we can steadily push on in the uphill climb to Christian perfection. OUR CONTRIBUTORS FRANK C. BRENNAN is stationed at St. Mary's College, St. Marys, Kansas. P. DE LETTER is a member of the faculty of St. Mary's Theological College, Kurseong N. E. Ry., India. RICHARD P. VAUGHAN, an assistant professor of psychology at the University of San Francisco and a staff member of the McAuley Clinic, St. Mary's Hospital, is currently engaged in psychotherapy with religious men and women. DANIEL J. M. CALLAHAN is professor of asceticM and mystical theology at Woodstock College, Woodstock, Maryland. DELAYED VOCATIONS In several previous issues of RJ~\'~I~\V ~:()R .qEI.It~U)US (November, 1957, p. 342'; March, 1958, p. 90; and July, 1958, p. 193) informa-tion has been published on religi.ous communities which will accept women who wish to dedicate their lives to God but who are older than the usual age limit for admission. Two other groups have asked to be mentioned. One group is the Daughters of St. Francis. The members of this lay apostolate live a semi-community life, become members of (Continued on page 36) 24 Severe AAeni:al Illness Among Religious Richard P. Yauc~han, S.J. LIKE ANY OTHER sickness, mental and emotional ill-ness has a wide range of variation. This variation extends anywhere from the common phobia or irrational fear of dogs or cats to the debilitating disorder which causes the' patient in the mental hospital to think that he is God. The minor manifestations of emotional disorder are more or less common in our civilization. They are accepted as inevitable parts of everyday living. There are few who do not have an occasional day when they seem to be more tense or anxious than usual, just as there are few who do not experience an occasional cold or upset stomach. Many refer to these bad days as times when their "nerves are .on edge." On these days their mental health is not perfect; but, on the other hand, they are far removed from serious mental illness. At the other end of the scale, there are those who are severely disturbed. In psychiatric language these people are usually described as psychotic. In times past, they were called insane. In any article dealing with the subject of serious mental illness, there always exists the potential danger that the reader will apply to himself or herself many of the symptoms which are described as typical of the psychotic and, as a result, come to the conclusion that he or she is severely disturbed. Hence, a word of caution to the reader is well in order. A serious mental disorder is both chronic and disabling. The psychotic is a person who carries truly debilitating symptoms with him month after month. This is what best distinguishes him from the average person who may occasionally have similar symptoms but whose symptoms are not chronic and severely handicapping over long periods of time. The ordinary person is able to cope with the symptoms that will be described during the course of 25 RICHARD P. VAUGHAN Review for Religious this article, should they occur. In spite of them, he is able to lead a fairly productive~ life. The psychotic collapses under the impact of his symptoms. As a result, he usually has little to offer the world and his fellow man. Characteristics of a Psychosis Perhaps the most significant quality of the psychotic is his reaction to the world in which he lives. As a general rule, he either has completely separated himself from reality or has drastically changed reality. Thus, it is not uncommon to find a psychotic experiencing hallucinations through which he is convinced that he sees the devil or hears the voice of the devil speaking to him. These hallucinations are as real to him, if not more real, than his dealing with his own family. Often it is following the advice given through the medium of a hallu-cination that leads the psychotic into some kind of anti-social behavior and eventually to commitment in a mental hospital. Other psychotics, beginning from ~/ false premise, develop a system of delusions through which they are convinced that mem-bers of their own families are spending most of their days and nights concocting new ways of persecuting them. These delu-sions are soreal to the psychotic that he sees no other alternative but to fight back so as to preserve his life and integrity. When severe mental illness has completely shattered the psychotic's personality, it produces prolonged states of stupor which may on occasion be broken by some form of incoherent speech. As can easily be gathered, most psychotic conditions are extremely debilitating and handicapping. The majority of psychotics are unable to carry on everyday activities, especially those activities which involve relationships with others. Few can assume and maintain the responsibilities involved in holding~ down a position. The greater majority are confined to hospitals, at least during the active phases of their illness. One of the most distressing qualities of the psychotic is the lack of insight into the nature of his condition. He seldom realizes or appreciates the seriousness of his disorder. 26 January, 1959 SEVERE MENTAL ILLNESS When he has hallucinations or delusions, he is firmly convinced that these phenomena are as true to reality as the fact that he is sitting in a chair before you. As a consequence of this convic-" tion, he builds many of his activities around these imagined events. This confusion of the imagined with the real not in-frequently makes him a menace to himself and others. The Psychotic Religious Since religious vocations are, for the most part, drawn from the same familial and environmental background that pro-duces psychotics among the laity, it should not be surprising that a certain small percentage of religious are afflicted with serious mental illness. Unfortunately, both the laity and i'eligious frequently are bewildered by the priest or sister who becomes psy-chotic~ This bewilderment can be attributed to two factors. The first is connected with "the humiliating symptoms of a psychosis. For this disorder strikesman's highest faculty, namely his intel-lectual ability. It generally deprives him of his power to think and reason clearly. In many ways it reduces the sufferer to a state which appears to be less than human. To see a priest or a sister (a chosen soul of God) so afflicted and acting accord-ingly is a traumatic experience for the religious and lay person alike. The second reason for bewilderment rests upon a false conception of the_cause of mental illness. I.n spite of research data to the contrary, there still persists a vague suspicion that mental illness is in some way connected with a sinful life or at least that it cannot occur if a person is leading a truly holy life. A psychosis is a type of sickness, just as are ulcers of the stomach or cirrhosis of the liver. Whether the cause of the psychotic condition is psychological or organic or a combination of both (which is more likely) has not yet been established. "It can, however, safely be stated that a psychosis (with the exception, perhaps, of a condition brought on by alcoholism or drug addiction) is not the result of a sinful life. The idea that it is the effect of sin is simply, a remnant of past attitudes which still prevail from an era when little was known about 27 RICHARD P VAUGHAN Rewew for Rehgwus psychiatry and psydhology. The fact, therefore, that a religious person becomes psychotic does not in any way imply past moral indiscretions. Religious, even though they follow a more perfect way of life, are no more immune from severe mental illness than the average lay person. Prepsychotics and Religious Li~e Unfortunately, there are certain aspects of the religious life which attract individuals who have a tendency toward a very prevalent type of psychotic disorder. This disorder is called schizophrenia and accounts for a large portion of the psychotics in our nation. The schizoid personality and the incipient schizophrenic are characterized by withdrawal from social contacts and a love of solitude. Generally speaking, they also find considerable comfort in a highly routinized form of life. These are the seeming characteristics of the religious life which attract t~e incipient schizophrenic and lead him to believe that he has a vocation. Father T. V. Moore conducted a study: on the prevalence of mental illness among religious. After polling 93 percent of the state and private mental hospitals, he was able to determine the number of religious confined to these institutions. Through the use of the Catholic Directory, he was then able to establish the ra~io of mental illness among religious and compare this ratio with that of the general population. One of the most significant conclusions of this study was the high rate of schizo-phrenia among religious women, particularly among those who follow the contemplative life. From these findings Father Moore concluded that preschizophrenic women tend to gravi-tate toward the religious life as an escape from the hard reality of the world outside the cloister. Psychological Screening One of the major functions of a psychological screening program is to point out just such individuals. To allow an incipient schizophrenic to enter the religious life does a positive The American Ecclesiastical Re~ie~v, 95 (1936), 485-96. 28 January, 1959 SEVERE MENTAL ILLNESS disservice both to the order or congregation and to the individual involved. Many a community has spent thousands of dollars for the hospitalization of a single psychoti~ member, and this at considerable sacrifice to the other members of the community. And then after all this expense, it not infrequently happens that the religious is finally d~agnosed as incurable. In such cases one might well ask whether such a diagnosis would have been r.eached if the psychotic religious had never been ~subj~cted to the strain and disillusionment of the religious life. Although personality evaluation through the medium of psychological testing and interview has proved useful, still it is a relativdly new pr6cess. Because this process is as yet in a developmental st~lge, it should be expected that for some time psychological screening will not be completely effective in fer-reting out those candidates who are incipient schizophrenics or who may become schizophrenic at some later date. Even with a greater understanding of the causes of mental illness and the development of more perfect screening devices, in all probability we will never reach that point where psychotic. disorders will be eliminated from the religious life. Charity, therefore, demands that we make an effort to understand the sufferings of our fellow religious who are afflicted with severe mental disorders, so that we can be more effective in bringing help and comfort to them. Schizophrenia As previously indicated, schizophrenia is the most preva-lent mental disease among both the laity and religious. It is the major mental health problem which faces our nation today. This particular type of psychosis, even in its incipient stages, is marked by a number of symptoms which seriously handicap community living. As a rule, the schizophrenic has consider-able difficulty adjusting to any situation which calls for social relationships. He is a person who has withdrawn from social contacts and lives within himself. He finds it almost impossibl~ to form any emotional response normally demanded by a close 29 RICHARD P. VAUGHAN Review ]or Religions friendship. Because he is convinced that others feel the same way about him as he feels about others, he spends most of his time by himself. He finds it difficult to talk to others. He has little to say. He absents himself from community recreations and will go to great lengths to avoid contact with other mem-bers of the community. Aside from this withdrawal symptom, he will sometimes make use of odd behavior which marks him out as different from the rest of the community. It is this behavior which is usually a prelude to the final breakdown. He may become re-bellious and rude toward superiors or develop unusual habits of dress and eating. It is usually such behavior, coupled with the increasing, withdrawal from community life, that calls a superior's attention to the fact that all is not right with a particular subject. When schizophrenia takes control of the various human powers, a marked deterioration becomes quite noticeable. The schizophrenic religious will often manifest an abnormal interest ¯ in abstract and philosophical thought, but the conclusions from his thinking will not follow the rules of logic. He may even lapse into heretical positions as a result of his faulty thinking processes. The part of his personality which probably is the most acutely affected is his emotions. Either he passes through long periods when he is completely apathetic and blasS, or he has violent emotional reactions which are totally out of propor- -tion to the stimuli producing them. Thus, for example, he may become extremely angry over some minor incident which the average religious would pass over almost unnoticed. In gen-eral, he manifests a loss of interest in the things ~which interest most religious. The religious life becomes empty and mean-ingless. In the active phase, hallucinations are not infrequent among religious who suffer from schizophrenia. These hallu-cinations may take the form of visions or the hearing of heavenly voices. Since the schizophrenic is convinced that these voices 30 January, 1959 SEVERE MENTAL ILLNESS are commands from God, he feels compelled to follow what-ever they suggest. The fact that much that they command may be entirely illogical and unbecoming the wisdom of God makes little or no difference to him. The discerning of hallu-cinations from true gifts of God has produced many a trying session for spiritual directors. For the ~chizophrenic, the most distressing feature of his disorder is a feeling of complete isolation. He is like a man totally cut off from the outside world. He is surrounded by towering walls. He can sit in a crowded recreation room and" still feel that he is alone. A sense of belonging is foreign to him. He is keenly aware that he is very different from his brethren. He is convinced that they look upon him as some-one very different from themselves. As much as he would like to get outside of himself, he is still unable to reach out to others. The wall must first be breached f~om the outside before he will ever be able to allow himself to reach out to others. In brief, fraternal charity in its fullest sense must inevitably play a part in the cure of the schizophrenic religious. Paranoia Of all the psychotic disorders, paranoia is the most dis-ruptive to community life. The priest, brother, or sister who becomes paranoid almost inevitably turns.against his or her community or certain members of the community. He sees his brethren as dangerous threats to his persorial integrity and sometimes even to his life. Starting from a few false premises which usually stem from his own deep feelings of inferiority and in-adequacy, he becomes convinced that the other members of the community are persecuting him in a variety of wgys. Thus, for example, a fellow priest may open a window to allow a little more air into a stuffy recreation room. He is immediately accused of deliberately trying to make the paranoid religious catch a cold. An unpleasant scene results with the paranoid slamming the window closed and storming out of the room. As the delusional system develops, the sick religious may no 31 RICHARD P. VAUGHAN Review for Religious longer trust the food that is offered at the regular meals. He may become convinced that the other members of the com-munity are trying to poison him. In an attempt to escape such a fate, he will make use of many forms of unusual behavior. The most distressing aspect of paranoia is the seeming normalcy of the individual in all other areas--those that are not connected with the delusion system. He can ,carry on a very intelligent conversation, and those who do not know him well can see nothing different about, him. Unfortunately, in the initial stages most religious fail to recognize the odd behavior of the paranoid as an indication of sickness. They interpret the threatening words and violent acts as simple manifestations 6f vice. Sometimes they lash back at him, only to make the psychotic episode worse. Had they calmly stood their ground and pointed out to the ailing religious that they had no intention of perseciating him by their action, they could have been of positive assistance. The apparent normalcy of the paranoid priest, brother, or sister causes him or h~r to become a great problem to the community. *Frequently, he or she is not sick enough to be hospitalized and thus must remain in the community. As a consequence; many a superior is at a loss as to just how such a subject should be treated. Should he be allowed to continue his provoking and sometimes destructive behavior, or should he be threatened with drastic action if he persists? Once a superior takes the latter stand, he immediately becomes deeply allied with the enemy.as far as the pa.ranoid is concerned. He then ceases to have any influence over the afflicted religious. If, on the other hand, he allows the outbursts of anger or even the physical assaults to continue, he is doing an injustice to the community. Expedience usually wins out, with the paranoid religious being moved from house to house or being left in a community where he can do the least damage. In general, it can be stated that paranoia is the least suscep-tible of all the psychotic disorders to the" influence of psycho- 32 January, 1959 SEVERE MENTAL ILLNESS kherapy. To break through a well-knit system of delusions that has been standing for some time is an almost Herculean task. The chief obstacle to therapy is the attitude of the para-noid toward the therapist, who is likely to become just one more in the ranks of the enemy. This is particularly true in the case of a religious, because he has usually been sent to the psychia-trist for help by a superior. The paranoid immediately suspects that the superior and the psychiatrist are plotting against him. The chance of a cure, therefore, is poor. The best solution to this vexing problem is the use of preventive measures. A well-conducted psychological screening program can detect paranoid tendencies. Moreover, if a religious manifests characteristics of a paranoid during his formative years, there should be serious question as to his suitability for community life. Severe Depressions A third psychotic disorder which occurs among religious is a state of severe depression. This condition is characterized by a deep sadness which completely overwhelms the individual. It is often "triggered" by some anxiety-provoking incident; but, instead of being able to handle the situation, the religious lapses into a state of profound grief and sorrow that closely approximates despair. This state is generally accompanied by restlessness and disturbances in sleeping and eating habits. The afflicted individual is filled with a deep sense of guilt and personal worthlessness. He is prone to worry and self-re-proach. Depression in some form is a component of almost all emotional and mental disorders. It becomes a psychotic symp-tom when the sufferer loses his grasp on reality. The religious who is so afflicted gives up all interest in living and, as a con-sequence, fails to care for the ordinary needs of life. He Will sit in his room by the hour in mute silence. He seems oblivious. to the comforting remarks of his fellow religious. He can see nothing, good in himself or his past life. He feels that he has 33 RICHARD P. VAUC, HAN Review for ReligioUs been a total failure. He sees no use in trying to continue in the religious state. Frequently he despairs of saving his sou!. He is convinced that God has justly abandoned him. Needless to say, when a priest, brother, or sister his reached this condi-tion of mind, the possibility of suicide is a factor which must be taken into consideration. A psychotic depression is more apt to strike a religious in the middle-forty years or later rather than in the earlier years of religious life. Sisters who are passing through that period which is called ~th~ change of life" are more prone to be so afflicted. If the religious is eventually going tb regain his or her mental balance, true understanding and immediate med-ical care are imperative." A psychotic depression is not a spiritual problem, even though the element of despair may be present. The condition cannot be eliminated by the more fruitful use of the sacraments and greater effort at prayer. The severely depressed religious has lost contact with God, just as he has lost contact with the rest of reality. This contact must be reestablished through the medium of competent psychiatric help. Attitude Toward Psychotics The attitude of a community plays 'a major role in the ultimate recovery or relapse of a psychotic member. Whether the severely ill member will accept psychiatric help frequently depends upon how such help is viewed by the other' members of the community. If being hospitalized or undergoing exten-sive psychotherapy becomes one of those issues that is hidden in the back closet of the cloister or convent and not even revealed to other members of the same order or congregation, then it can only be expected that this attitude will tend to isolate the psychotic'even more. He then becomes sure that he is entirely different from any other member in the community. As a consequence, he wil! be seriously handicapped in making the step which will allow him to undergo treatment willingly, for that °deep feeling of isolation will not permit him to reach 34 January, 1959 SEVERE MENTAL ILLNESS out even to the therapist who wants to help him. On the other hand, granted that he has assented to psychiatric treatment and has been helped, whether this help will be lasting will depend to a great extent upon how he is received once he has returned to his community. Perhaps there is no situation in community life where there is a. greater need of charity. Only charity can help the psychotic religious regain that sense of belonging with the community. Only charity; can give him confidence in himself and that sense of security which he so sadly lacks. If he can see that others are truly interested in him as a person, then perhaps he will gradually come to think of himself in a less derogato'ry manner. Eventually, it is hoped that .he will be able to view objectively some of his assets and see how he can put these assets to use by helping others. Left to himself, he and all that he is and has is locked within himself. Only understanding and love can open the door. Though the psychotic religious may not realize it at the time, he is very like to our Lord as He knelt 'in the Garden of Olives. The religious who has been psychotic, better than any other mortal, can appreciate this phase of the Passion. For, just as the Master felt the terrible weight of others' guilt pressing Him to the ground and almost crushing the life out of Him, so too has the psychotic been burdened and crushed by his own imagine~l guilt. He has known the meaning of abandonment. He has experienced loneliness. His disorder cuts him off from those who are near and dear to him. He feels that no one else can really understand what he is still suffering and has suffered. He too came to his brethren and, with a note of despair in his voice, pleaded, "Can you not watch one hour with me?" His words fell on deaf ears because ~they could not understand what he was enduring. Then, like our Blessed Lord, he returned alone to do battle with the violent conflict that was going on within his soul. He can only hope RICHARD P. VAUGHAN that one day his resurrection from this terrifying ordeal will be a full reality. That day can be hastened by the understanding and love of the members of his community. Corn m un ica!:ions Reverend Fathers: Just a word regarding one point of Fatt~er Thomas Dubay's "Retreats in Retrospect" in the January, 1958, issue. He says that "if there is such a thing as a psychology of religions women . it is the religious women themselves who must give an account of it." Many retreat masters (and any re!!gious women who are plan-ning to give an account of such a psychology) wiil find mostinter-esting and helpful paragraphs in the pamphlet, The Society of the Sacred Heart, by Janet Erskine Stuart. I believe it can be obtained from any convent of the Religious of the Sacred Heart. We hap-pened on it accidentally and have often mentioned the splendid points she develops regarding the particular needs of religious women and their particular failings, seldom, if ever, mentioned even in spir-itual books. Another thought occurs to me: that the presentation of the vow and virtue of chastity needs a slightly different emphasis for women religious, which is sometimes overlooked. The same blunt way which might be all right for men offends the sensibilities of women. A Sister DELAYED VOCATIONS ~Condnued from page 24) the Third Order Secular, and yearly make the vow of chastity and the promises of poverty and obedience. Catholic women eighteen years of age or older who are free from all legal impediments, who have the right intention, and who are capable of fulfilling the duties required of them can be admitted. There is no age limit, but certain restrictions are observed for women past fifty. For further information write to: Mother Superior, St. Francis Aposto-late, 114 East Kings Highway, San Antonio 12, Texas. The Sisters of Our Lady of Charity are also willing to consider the applications of candidates who are over thirty years of agd. Widows and married women who are legally and permanently sep-arated with ecclesiastical permission are acceptable if otherwise quali-fied. Address: Mother Superior, 485 Best Street, Buffalo 8, New York. 36 Christ: t:he Aut:hor and Source ot: :he Supernat:ural Lit:e Daniel J.'/~. Callahan, S.J. TO COUNTERACT prevalent errors, the Council of ~Frent devoted the entire sixth session to a succinct exposition of: "The true and salutary doctrine on justification which the 'Sun of Justice' (Mal. 4:2) Christ.Jesus, 'The Author and Finisher of faith' (Hebr. 12:2) taught, which the Apostles transmitted, and which the Catholic Church under the inspira-tion of the Holy Spirit has always maintained" (Introduction). Then, after a brief indication of our human weakness and helplessness in Chapter One, the next chapter unfolds for us the role of Christ in our rehabilitation.~ He offered abundant reparation for our sins, restored our adopted sonship of God, and, having thus redeemed us, became for us the source of all grace in the present life and of eternal glory in the next. In the first paragraph of the encyclical, Mediator Dei, Pope Plus XII stresses the identical truth in these words: Mediator between God and men and High Priest who has gone before us into heaven, Jesus the Son of God quite clearly had one aim in view when He undertook the mission of mercy which was to endow mankind, with the rich blessings of supernatural grace. Sin had dis-turbed the right relationship between man and his Creator; the son of God would restore it. The children of Adam were wretched heirs to the infection of original sin; He would bring them back to their heavenly Father, the primal source and final destiny of all things. He ¯ . . gave Himself besides in prayer and sacrifice to the task of saving souls, even to the point of offering Himself as He hung from the cross, a victim unspotted unto God, to purify our conscience of dead works, to serve the living God. Thus happily were all men summoned back from the byways leading them down to ruin and disaster, to be set squarely once again upon the path that leads to God. We shared in the lamentable sin of Adam, forfeited sanc-tifying grace and our celestial heritage; and of our unaided strength we never could have retrieved the loss. A mediator, one acceptable to God and to man because sharing the nature of each, was indispensable; and where could he be found? 37 DANIEL J. M. CALLAHAN Review for Religiou.u On.ly a divine person.incarnate could supply the need. The Second Divine Person became a member of the human family, substituted Himself for us, assumed our responsibility and in-debtedness, freely and lovingly submitted to humiliation and suffering of every description, made perfect atonement, ren-dered boundless honor, praise, and service to God, reopened heaven, and placed within our reach all the means requisite for holiness.of life here and endless happiness hereafter. Such was and is our compassionate and ideal Intermediary who re-leased us from the servitude of Satan, appeased His 'Father, reinstated us in the love and friendship of the adorable Trinity and proffered to us the priceless treasures of grace and of participation in His own life. Such is the revealed Catholic dogma on our redemption through the satisfaction and merits of Christ our M~diator with His Father. By satisfaction is meant the payment or restitution of What is due. When it is offered in reparation f6r personal offense, we call it moral; and it consists in the spontaneous submission and honor sufficient to make amends for the indig-nity and to conciliate the person offended. If it is morally equivalent to the affront, it is said to be condign; if it is not but is nonetheless accepted by the aggrieved party, we call. it con-gruous. Christ, really God and really man, in His. human nature became our sponsor offering to" God vicarious satisfac-tion. His least suffering, His slightest humiliation would have been amply su~cient to expiate every sin, for every action and suffering of His was of.infinite value since it was performed or accepted by a divine person. But, to bring home to us more impressively the infinite sanctity of God, the enormity of sin, and the ineffable love of Jesus for us, the eternal Father exacted from Him all the sacrifices of His earthly career and their consummation in His passion and death in ato.n.ement for our blindness, our ingratitude, our r~bellion, and our malice. Logically satisfaction precedes merit. The culprit must repent of his sin in order that it be pardoned and grace infused. 38 January, 1959 THE SUPERNATURAL LIFE Actually all the free acts of Christ were both satisfactory and meritorious. Supernatural merit is a right to a supernatural reward issuing from a supernatural deed freel~ accomplished ~or God's sake and from His promise to compensate for it. Christ's merit for us is founded on His grace as Head of the human race and on the supreme liberty and boundless love with which He" underwent His passion for all men. And, since He who thus merited is .God, His merits are of infinite value and inexhaustible efficacy. Though Christ's reparation was superabundant and readily accepted by God, it was achieved, not by us, but by our sponsor; and therefore God could and did attach compliance with definite conditions for its application to us individually. Though God created us without our cooperation, He will not sanctify nor save us apart from it. And provided we concur with Him, we have the divine assurance of the full remission of our sins, no matter how heinous they may be, and of our restoration to His grace and intimate friendship. Though the glorified Christ no longer makes reparation nor merits for us, His acquired satisfaction and merits are most advantageous to us. Ceaselessly He offers them for us: "To appear now before the face of God on our behalf. He is able to save those who come to God through Him, since He lives always to make intercession for them,", as St. Paul writes in Hebrews 9:24; 7:25. And in acknowledging our helplessness and unworthiness and in pleading with the Church through the satisfaction and merits of Jesus, we glorify God and proclaim that His Son is the omnipotent Mediator whom He has been pleased to give .us. We are to have a resolute faith and trust in the exhaustless riches amassed for us by our blessed Lord; and, receiving all from Jesus, we should render to Him and our common Father in the unity of the Holy Spirit praise, glory, and thanksgiving. United with Christ our Head, we have also been enabled to offer reparation for sin and to merit supernaturally. This 39 DANIEL J. M. CALLAHAN Review for Religious we accomplish by means of every good action done in the state of grace and with purity of intention, and thus we co-operate with Him in our personal growth in holiness and in that of the neighbor. Like the living cell~ in our body, each one of us can greatly contribute to the spiritual welfare and expansion of the Church, the Mystical Body.of Christ, of which He is the Head and we the members. And while thus assisting others, we effectively ~omote our own sanctity and together with our Head practicg:the purest charity and share in ~the same life. Such association with our Savior evidences the abundance of His redemption, is most glorious to Him and a tremendous comfort to us. We are not to infer that with His "Consummatum est" Christ terminated His activity on our behalf. He is still con-tinually operative in the sanctuary of our souls, imparting grace, enabling us to ~levelop our sup.ernatural life and to partake ever more of the life that is His. He remain~ our universal Mediator, High Priest, and Redeemer dispensing through His human nature divine blessing with a lavish hand. "Christ our Lord brings the Church to live His own supernatural life, by His divine power permeates His whole Body and nourishes and sustains each of the members according to the place which they occupy in the Body, very much as the vine nourishes and makes fruitful the branches which are joined to it" (Encyclical on the Mystical Body of Christ, n. 67). Since Christ's Ascension, He continues to dispense His .graces through the sacraments. It is He who through the Church baptizes, teaches, rules, looses, binds, offers, sacrifices . Holiness begins from Christ; by Christ it is effected. For no act conducive to salvation can be performed unless it proceeds from Him as its supernatural cause. "Without me," He says, "you can do nothing." If we grieve and do penance for our sins, if with filial fear and hope we turn again to God, it is because He is leading us. Grace and glory flow from His unfath-omed fulness. Our Saviour is continually pouring out His gifts of counsel, fortitude, fear and piety, especially on the leading members of His Body, so that the whole Body may grow daily more and 4O January, 1959 THE SUPERNATURAL LIFE more in spotless holiness. When the Sacraments of the Church are administered by external rite, it is He who produces their effect in souls. He nourishes the redeemed with His own flesh and blood, and thus calms the soul's turbulent passions; He gives increase of grace and is preparing future glory for souls and bodies. (Encyclical on the Mystical Body of Christ, nn. 67, 63) The Christian sacraments signify and produce grace; they envelop our entire life; at all its momentous stages they provide for our spiritual needs. They may be likened to so many channels through which the life of Christ is communicated to us. It remains for us to intensify our appreciation of them, to enlarge the capacity of our souls through rep.entance, hu-mility, confidence, and above all through love, thus rendering the efficacy of the sacraments more profound, vast, enduring. Even apart from the sacraments, Christ is energetic in us whenever we approach Him. Divine strength issues from Him and permeates our, souls. In the words of the Council of Trent: "As-the head in the members and as the vine in the branches, Christ Jesus constantly exercisesHis sanctifying power in the just, which salutary influenacleways precedes, accompanies, and follows their good works"(Sess. 6, Chap. 16). Animated faith in His divinity, His almighty power, and His undying love communicates to the soul the grace to elim-inate sin, imperfections, inordinate attachment to self and other creatures, the courage to eliminate all obstacles and thus effect our unconditioned surrender to Him. Dedicated to God and to the attainment of perfection, the better we religious understand the relation of our spiritual life to Christ, the more shall we love Him, the more shall we treasure our vocation, and the more shall we endeavor to attract others to Him. Then, too, shall we more readily appreciate why no sins are irremissible, why through the sacrifice of the Mass we can offer the most acceptable reparation for past sins and how by means of the remedial efficacy of the sacraments we can be loyal to Him for the future. 41 Survey of Roman Document:s R. F. Smit:h, S.J. [The present article wil! summarize the documents published in Acta Apos-tolicae Sedis (AAS) from August 1, 1958, to September 22, 1958, the latter date being that of the last issue of AAS that was published before the death of Pius XII. All page references throughout the survey are to the 1958 AAS (v. 50).] An Encyclical to Chinese Catholics U NDER "J'H.E. DATE of June 29, 1958 (AAS, pp. 601-14), the late Holy Father issued the encyclical Ad apostolorum prin-cipis sepu!chrum (At the Tomb of the Prince of the Apostles) directed to the hierarchy and the faithful~ of China. Having noted that the Church is foreign to no country and hostile to no land, the Po~pe expressed his alarm over a new association formed in China under civil auspices, membership in which is being forced upon Catholics. The association, he noted, ostensibly combines love of religion and country, desire for world peace, and devotion to religious liberty. In reality, however, the chief purpose of the association is to gradually lead Catholics to embrace atheistic materi-alism; it accuses Catholic bishops and even the Holy See of insane desires for temporal power and of extorting money from the people; and under a campaign for religious liberty it really seeks to make the Church completely subservient to civil authority. Because all this is attempted in the name of patriotism, Pius XII recalled to the minds of all Chinese Catholics their duty of loving their country with a strong, sincere affection; they must obey civil authority, provided nothing is commanded that is against divine law; and they nlust seek to foster and increase the prosperity of their country, fulfilling in these ways the saying of our Redeemer: "Give to Caesar the things that are Caesar's" (Lk 20:25). Nevertheless, he added, they must also remember that if civil authority should command anything that is against the rights of God, then all Catholics must repeat and follow the words of St. Peter: "Man must obey God rather than man" (Acts 5:29). Having. reminded the Chinese Catholics that true peace can be had only by the i~rinciples of justice and love and that the" teach-ing power of the Church extends to all human actions in so far as they are morally good or bad, Plus XII went on to point out that 42 ROMAN DOCUMENTS the civil government in China has no right to appoint bishops; con-sequently bishops appointed by the Chinese government have no power of teaching or of ju~:isdiction. Moreover, even if they should be validly consecrated, their actions would nevertheless remain gravely illicit. The Holy Father concluded his encyclical by expressing the sorrow that the Church's condition in China has caused him and told the faithful ia China to strengthen themselves with the hope that the present persecution will lead to a new growtl~ of the Church and to days of happiness and joy. Sacred Music and the Liturgy On September 3, 1958 (AAS, pp. 630-63), the Sacred Congrega-tion of Rites issued an instruction on sacred music and the liturgy in accordance with the principles laid down by the encyclicals Musicae sacrae disciplina and Mediator Dei. The first of the three chapters that form the body of the instruction defines sacred liturgy as those actions which were insti-tuted by Christ or by the Church and which are performed in their names by legitimately designated persons according to the liturgical books approved by the Holy See. All other sacred functions, whether performed, in or outside a church, are to be called devotional exercises, even when they are conducted by a priest. The second chapter notes that devotional exercises should not be inserted into liturgical functions. It further states that the language of liturgical functions is Latin unless exceptions are made in certain cases in approved liturgical books. In sung Masses, every-thing must be in Latin, except where a hundred-year or immemorial custom allows the insertion of vernacular hymns after the liturgical words have been duly sung in Latin. At low Masses all those who directly participate in the Mass must use only Latin; other prayers, however, and hymns may be'in the vernacular. St is, however, desirable that on Sundays and feast days the Gospel and the Epistle be read by a lector in the vernacular. In the third chapter the document gives special norms to be observed in the various liturgical functions. It begins by taking up the matter of lay participation in sung Masses, pointing out that three levels of such participation a~re possible. The first level is had when" the faithful give all the liturgical responses; the second occurs when the laity sing all or some of the parts of the Ordinary of the Mass; while the third level of lay participation involves the 43 R. F. SMITH Review for Religious singing of the Proper of the Mass. This last level is urged especially for religious communities and for seminaries. The Congregation then adds various other regulations for sung Masses. A Latin hymn may be added after the Offertory and Communion Antiphons. The faithful who go to Communion may say the threefold Domine, non sum dignus with the celebrant. The Sanctus and ~lenedictus are not to be separated if they are sung in Gregorian chant; in other cases the Benedictus is to be sung after the Consecration. The Congregation suggests that silence be had from the Consecration to the Pater noster, unless the Benedictus is to be sung during that time. Finally the document notes that the organ should not be played during the priest's blessing at the conclusion of Mass. The instruction then considers the matter of lay participation in low Masses. The first level of such participation is had when the faithful join in the Mass by reading their Missals or by engaging privately in other suitable prayers and devotions. In these cases organ or other instrumental music may be played except during the following parts of the Mass: after the priest's arrival at the altar to the Offertory; from the verses preceding the preface to the Sanctus; where the custom exists, from the Consecration to the Pater noster; from the Pater noster to the dgnus Dei; during the Confiteor before the communion of the faithful; and during the last blessing. The second level of lay participation at low 'Mass is had when the faithful sing hymns or recite suitable prayers in common. The third level includes various grades of participation according as the faithful make all or some of the liturgical responses or, besides this, recite the Gloria, Credo, Sanctus-Benedictus, and Agnus Dei with the celebrant. The highest grade of this third level of participation in low Mass is had when the faithful, besides observing the foregoing, recite with the priest the Introit, the Gradual, the Offertory, and the Communion. Finally the instruction permits the faithful at low Masses to recite in Latin with the priest the Pater noster, adding the ~ltaen at its conclusion. The instruction then regulates conventual Masses, prescribing that these should be solemn Masses or at least high Masses to be celebrated after Terce, though the superior of the community may for grave reasons have it celebrated after Sext or None. The docu-ment then approves the practice on special occasions of many priests attending a Mass where they all receive communion but prohibits 44 January, 1959 ROMAN DOCUMENTS "synchronized" Masses wh~re two or more priests celebrate Mass simultaneously at different altars in the same church, each one keep-ing in complete unison with the other(s). With regard to the Divine Office, the instruction notes that the recitation of the Office by those obliged to it is always an act of public worship. It also urges that at least on some Sundays and feast days of the year Vespers should be sung with the people .and warns local ordinaries to see to it that evening Masses do not prevent such Vespers. Benediction of the Blessed Sacrament, the document remarks, is a liturgical function and hence should be held in accordance with the prescriptions of the Roman Ritual, though other methods of conducting Benediction can be permitted by the local ordinary if these are based on immemorial tradition. In the next part the instruction notes that polyphonic music an~l modern sacred music used at liturgical functions must follow the norms set down in Musicae sacrae disciplina; it emphasizes the need of fostering popular religious hymns; and it forbids religious music, that is, music intended to arouse and foster pious sentiments but not composed for divine worship, to be played in church, though for exceptional reasons local ordinaries may. permit concerts of such music in church. After repeating existing legislation about liturgical chant books and after noting that some musical instruments are not fitted for Church use, the document points out that the principal instrument of the liturgy is the pipe organ, though a reed organ may also be used. Electrophonetic organs may be tolerated temporarily with the explicit permission of the local ordinary. Other instruments, espe-cially string instruments played with a bow, may be used provided they are played with religious gravity and decorum. All recorded or broadcast music is forbidden to be used during liturgical functions and during devotional exercikes, whether in or out of church; ampli-fiers, however, or loudspeakers may be used. No movies of any type may be shown in churches for any reason; liturgical functions, however, may be broadcast or televised if express permission for this is given by the local ordinary. The Congregation then notes that organ music, except for Benediction of the Blessed Sacrament, is forbidden during Advent, Lent, Passiontide, at the Office and Mass of the Ember Days of September; and at all Offices and Masses for the dead. Other 45 R. F. SMITH Review for Religious instrumental music is prohibited besides on Septuagesima, Sexagesima, and Quinquagesima Sundays and the ferials following these days. "Within these forbidden times for music, however, the Congregation lists certain exceptions. Thus organs and other instruments are permitted on holy days of obligat!on that fall on week days, on the feast of the principal .local patron, on the titular feast or on the dedication anniversary of the church, on the titular feast or founder's feast of a religious family, and wheneger an extraordinary solemnity takes place. Moreover, pipe and reed organs are permitted on the third Sunday of Advent and on the fourth Sunday of Lent, at the Mass of Chrism or/ Holy Thursday, and at evening Mass on Holy Thursday.from the beginning to the Gloria. During all the forbiddefi times pipe and reed organ.s may be tlsed at Mass and Vespers to accompany the chant; during the last three days of Holy Week; however, the organ may not be used even for this purpose, except for ¯ the exceptions on Holy Thursday noted above. Finally during the last three days of Holy Week all use of the organ, is prohibited during devotional exercises, even though a contrary custom may now exist. The instruction next insists that every effort be made that churches as well as public and semi-public oratories have one or two bells which should be consecrated or at least blessed. Carillons, however, are to be excluded from all liturgical use; nor may record-ings of bells be used. In the next section the document suggests that at Mass and at the more complicated liturgical functions use be made of a "com-mentator''~ who would briefly explain the individual parts of the services and direct the faithful's response and singing. If possible, the "commentator" should be a priest; if necessary, however, a lay man of upright life may perform this office. The rest of the document is concerned with" parish and diocesan organizations to foster proper execution and appreciation of sacred music. Finally, in its concluding paragraph the instruction notes that Plus XII approved in a special way all the contents of the document. Notice should also be taken here of an admonition of the Holy Office given on July 24, 1958 (AAS, p. 536). Having received a report that the phrase "the mystery of faith" had been omitted from the formula for the consecration of the wine in a vernacular trans- 46 January, 1959 ROMAN L)OCUMENTS lation of Holy Week Services and that some priests had omitted these words in celebrating Mass, the Holy Office recalled that it is forbidden to make such changes in the sacred rites or to remove anything from the liturgical books. Allocutions and Messages On July 19, J~uly 25, and August 2, 1958 (AAS, pp. 562-86), the late Holy Father broadcast a three-part aIlocution to the contempla-tive nuns of the world. Since the full text of the allocution will be given in REWEW ~:Og RELIGIOUS beginning in the present issue, no further notice need be taken of the address here. On July 2, 1958 (AAS, pp. 523-30), Plus XII spoke to the Women's Union of Italian Catholic Action. After giving a long history of the achievements of the Union since its founding by pope St. Plus X, the Holy Father recalled to his listeners what he termed "the triangle of Christian life": personal sanctity, external apostolate, socio-civic activity. He told them that of these three facets of Christian life, the first is the most important, since it must always be successful, even when because of external conditions the other two are not. The Union, he concluded, like all other apostolic groups in the Church, has no greater enemy than spiritual sterility. Later, on July 13, 1958 (AAS pp. 530-35), the Pope spoke to the young women's section of Italian Catholic Action, discussing with them the two main vocations of Christian womanhood: consecrated virginity and Christian motherhood. On June 29, 1958 (AAS, pp. 518-23), the Vicar of Christ spoke to an international group of ear, nose, and throat specialists. After considering the conditions necessary for progress in medical matters, he concluded by urging, the doctors to imitate Christ as He passed among the suffering of the human race. Like Him, they should seek to assuage the pain of men in the hope of preparing their hearts for the coming of the kingdom of God. To the members of the First International Catholic Conference on Health, Plus XII on July 27, 1958 /AAS, pp. 586-91), stressed the necessity of co-operation among all those who are concerned with private and public health matters. He also reminded them that as Christ healed physical and moral sickness in order to lead men to recognize Him as the resurrection and the life, so Catholics in health work should conduct themselves in such a way that observers may be able to divine from their conduct their attachment to the Church and to the Holy Spirit who animates the Church. 47 R. F. SMITH Review for Religion,s On June 22, 1958 (AAS, pp. 514-18), the Holy Father addressed a group of Italian brokers, telling them that economic activity, like every type of human activity, must submit itself to divine law. After recalling the moral duties of brokers, he concluded by urging his listeners to remember that there is onIy one mediator (the Italian word for broker is t~¢diat,,re) between God and man. Like Christ the Mediator, he said, the brokers in their professional work should try to be instruments of salvation a~3d of sanctification, thereby assist-ing the world of business to become a truly Christian world. Under the date of July 21, 1958 (AAS, pp. 592-93), Plus XII sent a written message to.an international group of workers on pilgrimage at Lourdes, bidding them to look at the Blessed Virgin and thereby realize that man's supreme goal is not an earthly, but a heavenly, one. On August 15, 1958 (AAS, pp. 622-25), the Holy Father despatched a written message to those present at the sacred functions held in the pontifical pavilion at the Brussels World Exposi-tion, telling them that the human accomplishments on exposition in the city are incomplete unless they lead to the adoration of God from whom all good .things come. He also expressed his satisfaction that in the pontifical pavilion Christ is really present in the Eucharist, for this is an attestation of those absolute values of religion and of morality without which all material things do not find their unity or their ultimate perfection. Miscellaneous Matters By an apostolic letter of February 14, 1958 (AAS, pp. 512-.13), Plus XII declared St. Clare to be patroness of television. On May 29, 1958 (AAS, pp. 544-46), the Sacred Congregation of Rites approved the introduction of the cause of the Servant of God Dominic of the Blessed Sacrament (1901-1927), professed priest of the Order. of the Most Holy Trinity. On the same date {AAS, pp. 594-98) the same Congregation si~nilarly approved the introduction of the cause of the Servant of God Emmanuel d'Alzon {1810-1880}, priest, founder of the Assumptionists as well as of the Oblate Sisters of the Assumption. In the issues of AAS under consideration the Sacred Penitentiary released the official text of two prayers written by Plus XII. The first, issued under the date August 2, 1957 (AAS, pp. 599-600), is a prayer to the Blessed Virgin to be recited by all Christian women who, when they recite the prayer devoutly, may gain an indulgence of three years. The second prayer, the text of which was published 48 January, 1959 QUESTIONS AND ANSWERS under the date of June 24, 1958 (AAS, pp. 547-48), is a prayer be recited during the coming National Italian Eucharistic Congress; the faithful who say the prayers during the congress may gain an indulgence of three years. The final document to be noted here is one from the Pontifical Commission for the Oriental Code of Canon Law; the document gives a textua[ change that henceforth is to be incorporated in Canon 215, § 2 of the Oriental Code. Ques 'ons and Answers [The following answers are given by Father Joseph F. Gallen, S.J., professor of canon law at Woodstock College, Woodstock, Maryland.] ¯ How justifiable is the phrase "brain-washed" religious? Let us hope there is no justification. The essence of the religious life is a personal and complete consecration of one's self to God. A vow is a free promise made to God. This personal element can never be abandoned in the actual living of the religious life nor in forma-tion, direction, or government. The members of the one institute should manifest common traits but they should never lose their in-dividuality. All life demands a measure of adjustment and conformity, but not complete conformity. A formation that would stifle all in-" dividual thinking, judgment, initiative, and responsibility would be evidently defective and equally dangerous. All cannot be fitted into one mold; and if this is attempted, some will escape with no less violence than damage. Grace purifies, assists, and elevates natural abilities, but does not create them nor .destroy them. Perfect conform-ity is not even desirable, simply because the common way of thinking and acting is rarely the highest. An evident cause of the force of bad example is the fact that so few think for themselves. A religious institute should be grateful to its prudent dissenters. The soft bed of the same and of what everybody else is doing is molded so com-fortably to the many; but let us thank God that it is a torture to a few intelligent, spiritual, and prudent religious. "There are counterfeits of obedience. The ps);chological inferior-ity complex created by a habit of submission must not be confused with the virtue of obedience, which encourages in oneself many. quali- 49 QUESTIONS AND ANSWERS Review for Religious ties, much spontaneity, and interior freedom. The obedience oi: the perfect is not only perfection in obedience strictly so called; it is accompanied by perfection in all other virtues." Reverend M. J. Nicholas, O. P., Religious Sisters, 82. "Obedience should not be based on an excessive multiplicity of orders or be so minute as to fix every moment and action of the re-ligious life. The result would be to materialize obedience and the life it.self; and the religious, confined in such a circle, would end by acting as an automaton." Reverend Maurus a Grizzana, O. F. M. Cap., Acta et Documenta Congressus Generalis de Statibus Pertrectionis, II, 177. "The man should be formed in the religious. Isn't it highly proper that a formed r~ligious should be a man of principle, of char-acter, who is not in constant need of help and support from outside himself, who can find within himself the intelligence and the force necessary for action, at least in normal circumstances, in a word, a re,an, and not a perpetual infant?" Reverend R. Arnou, S.J., ihiJ., 542. "But in the convent, nearly everything is built on the passive. The activity of thesisters is directed in every detail. Nearly every minut~ has its task. The concept of obedience and detachment appeals more to the passive than the active type. But not all possess the ability to. put themselves into a mold. It is astonishing how men religious in general retain their personality in religious life, wh'ile nuns easily lose theirs because they try to conform themselves to the type their con-gregation sets up as an ideal, taking on their manners, style of lilCe, and mentality." Sister Agnes, S. H. C., Religious Life Today, 163. 12-- It is a rather generally accepted custom in our institute for the local superiors to give permission to the religious to retain and use the Christmas gifts they receive. May this custom be followed? We are to presume that the will of a superior is reasonable and in accbrd with the norms of the religious life. The reasonable inter-pretation of this custom is that the superior intends the religious to retain only the things that are necessary and proportionately useful. All other gifts are to be handed in. We are likewise to presume that a superior in no way intends to exclude mortification and detachment and "therefore is in no sense averse to religious handing in gifts that they could consider even necessary. ' 50 Jan~a~'y, 1959 QUESTIONS AND ANSWERS I have heard many retreat masters say that the only thing de-manded by poverty is permission. Is this true? It is not complete and is misleading. Permission in poverty merely excludes sin from the action. To be fully accurate, it ex-cludes sin only t:rom the object of the action, not from its motive or circumstances. I do not say this frequently happens, but it is possible for a religious to have a sinful motive in something he secures permis'sion for. The statement is especially inadequate because it neglects the~ higher degrees of poverty-and minimizes the entire purpose of poverty in the religious life, which is detachment from material things. Securing permissiori is an aid to detachment, bdt it is obviously possible /:or a religious to b~ attached to something for which he has secured permission. "It seems that particularly in the study of moral theology and canon law a sufficient distinction is not made between the viewpoint of simple morality, sin and no sin, and that of Christian perfection. The norm of life of the religious is not merely the sin.less but the more perfect." Reverend Benjamin of the Most Holy Trinity, O~C.D., Acta et Documenta Congressus Genera~is de Statibus Per° fectionis, II, 195. "Moral theology is too often taught in a negative and legalistic way, which results in its boring those who require to live on what they are learning. One cannot live on prohibitions. In reality, the teaching of moral theology, rightfully understood, is the basis of spiritual theology." Reverend Lucien-Marie de St. Joseph, O.C.D., The Doctrinal Instruction of Religious Sisters,. 95.° The constitutions of our pontifical congregation of ~isters, in the chapter on the care of the sick, contain the following article: "The sick who have been in bed for a month and hav~ nb certain hope of speedy recovery, may, on the prudent advice, of their con-fessor, receive the Holy Eucharist once or twice a week even though they have taken medicine or something to drink." We were later instructed that this should be changdd to: "On "the prudent advice of a confessor, the sick; even though not confined to bed, may take something to drink before ~Communion~ if their sickness does not permit them to observe the full fast without real inconvenience; they may also take solid or liquid medicines. All alcoholic liquids are ~UESTIONS AND ANSWERS excluded." We are now told that the article should be changed to: "Without any limitation of time before the reception of Holy Com-munion, the sick, even though not confined to bed, may take non, alcoholic liquids and anything that is truly a medicine, whether liquid or solid." We are about to reprint our constitutions. Do .we need the permission of the Holy See to change the wording of. this article? No. It is true that a change in the constitutions demands the permission of the Holy See in a pontifical congregation and that of all the ordinaries in whose dioceses the institute has houses in the case of a diocesan congregation. However, the constitutions in this case are merely stating an enactment of the Church. Since the enactment has been changed, the statement of it in your constitu-tions should also be changed. SOME BOOKS RECEIVED [Only bobks sent directly to the Book Review Editor, West Baden College, West Baden Springs, Indiana, are included in our Reviews and Announcements. The following books were sent to St. Marys.] Saint Clare Patroness of Television. By Mabel Farnum. Society ¯ -of St. Paul, 2187 Victory Boulevard, Staten Island 14, New York. 25c (paper cover). Life in Christ: Instructions in the Catholic Faith, By Reverends James Killgallon and Gerard Weber. Life in Christ, 720 North Rush Street, Chicago 11, Illinois. $1.00 (paper cover). What Is Faith? By Eugene Joly. Translated by Dora Illtyd Trethowan. Hawthorn Books, 70 Fifth Avenue,. New York 11, New York. $2.95. What Is the Bible? By Henri Daniel-Rops. Translated by J. R. Foster. Hawthorn Books, 70 Fifth Avenue, New York 11, New York. $2.95. Bibliographie Ignatienne: 1894-1957. By J. F[ Gilmont, S.J., and P. Daman, S.J. Descl~e de Brouwer, Paris. 165 Belgian francs (paper cover). Education and the Liturgy: 18th North American Liturgical Week. The Liturgibal Conference, EIsberry, Missouri. $2.00 (paper Cover) . SUMMER INSTITUTES FOR RELIGIOUS The Reverend Owen M. Cloran, s.J., will conduct an institute in canon law for superiors of religious congregations of women at Loyola University, in Chicago, June 22-26. Applications should be directed to the Reverend Robert W. Mulligan, S.J., Lewis Towers, 820 North Michigan Avenue, Chicago 11, Illinois. 52 Book Reviews [Material for this department should be sent to Book Review Editor, REVIEW FOR RELIGIOUS, West Baden College, West Baden Springs, Indiana.] DIOCESAN PRIEST SAINTS. By Rev. R. A. Hutchinson. Pp. 219. B. Herder Book Company, St. Louis 2, Missouri. 1958. $3.95. The author gives us some insight into his purpose when he writes: "In the past quarter century the number of secular priests in the U. S. has increased 60% . Though encouraging this figure fails far short of the 125% increase in priests reported by religious orders in the same period. The discrepancy here is the result in part of skillful propaganda on the one hand and confusion about the nobility of the diocesan priesthood on the other." His book is intended to remedy this "situation, but it turns out to be propaganda for the other side. One example will suffice. He writes: "We may think of asceticism in terms of nocturnal prayer, flowing .robes, silent figures gliding down shadowy cloister walks, community life, and the monastery bell. But these are elements of just one kind of asceticism, not all kinds. The ascetical life of the secul:~r priest cannot be considered inferior to that of the monk because it excludes the capuche, shaved tonsure, and the weekly chapter of faults. It does include opportunities for endless self-control, the fostering of gentle-ness, tolerance, and consideration in dealing with the parishioners . . generosity to the needy. (Could a secular priest be generous to the needy if he had given away all his money because of some passage in a spiritual book that said he should be poor?)" Men will forget that vocations are made in heaven and not on earth, that in the matter of vocation the only thing that counts is to choose not the one that is theoretically the most excellent, but to choose the one that God wants chosen. To do God's will and to do it perfectly, that is sanctity. Theoretically it is true that it is easier to save one's soul and to achieve sanctity in the religious state--the author to the contrary notwithstanding--but practically only for those whom God has chosen for that life. If the author should attempt another book--and we hope that he will, for he writes well--he would attain his purpose of promoting vocations to the secular priesthood much more surely and effectively if he gave us the biographies of secular priest saints and omitted all pr~paganda.--F;. A. H~,US~,IAt~N, S.J. 53 BOOK REVIEWS Review fo~" Religious BASIL ANTHONY MOREAU. By Canon Etienne Catta and Tony CattY. Translated by Edward L. Heston, C.S.C. Vol. I, pp. xxx~i, 1016; Vol. II, 1108. The Bruce Publishing Company, 400 North Broadway, Milwaukee 1, Wisconsin. 1955. $30.00. It is a widely held error that a scholarly, well-documented biography cannot possibly be as interesting as a so-called popular one. If this were not already many times over proved false, this life of Basil Anthony Mary Moreau would be adequate to accomplish the task. Because of a misunderstanding, the interested parties have indicated, no review copies were distributed at the time of publication, 1955; hence only now is this life being reviewed. It is just that the record should be made complete, for this is the definitive life prepared for the cause of the beatification of the Servant of God, a contemporary of the Curt of Ars. At the outset, however, let us say th~it weighty and controversial affairs, partic~ularly in the history of Holy Cross but pertaining also sonlewhat to the history of the Sisters of the Good Shepherd, are constantly dealt with in this work; these accounts only the specialist in the history of these con-gregations can assess for accuracy and historical wi~rth. Caution is called for indeed in dealing with the life o'f the founder of Holy C'ross, for Father Moreau's life was filled with controversy. So it is that estimates of his character covered a rather ~ide range. This man, whose cause for beatification has been introduced, had St. Mary Euphrasia PeIletier say of him, "That man is a rod beat.ing us to blood!" She added, "Ah, what an enemy! May God forgive him! . . . He is the cruelest enemy of all our work. Never .could I have dreamed that the human heart was capable of so much treachery." 'The pope of his time, Pius IX, allegedly characterized Father Moreau as "that good old man whom I love." Yet this same pope was not pleased, having ordered this "good old man" to come to Rome, to find the order, at least for a time, not c6mplied with.' This noncompliance (though based on theological reasoning) should have sealed the fate of any effort to introduce the cause of Father Moreau at Rome. Oddly enough it didn't. Plus XII encouraged his spiritual children to seek for him the honors of the altar. This book, fbrtunately, is an attempt to put some rationality into the crazy abstractionist portrait that could result from elements like those above. The founder and first superior general of Holy Cross, originally an association of fathers, brothers, and sisters working together under 54 January, 1959 BOOK REVIEWS one superior, has the misfortune of being necessarily classed among those many founders and foundresses (the authors have counted some thirty) more or less repudiated by their spiritual children. Father Moreau's successor as superior general petitioned that Father Moreau be freed from all his obligations toward the congregation, a petition to which Rome did not accede. Nevertheless, his motherhouse was sold to pay outstanding debts; Father Moreau did not die in a house of Holy Cross, but rather in the home of his two sisters," whither he had gone from a house of his congregation without even the necessaries to celebrate the Holy Sacrifice of the Mass. How a retiring seminary professor ~tarted on his career as founder and how eventually he came to such straits is the engrossing story of these two massive volumes. Many individuals great and small were respon-sible for his stormy passage--great as the t:ounder of the University of Notre Dame, Father Sorin, and small as the petty sacerdotal literateur whose observations of the lady boarders in the community where he was in residence resulted in "Little Portraits of Great Ladies," a contribution to literature that ran indeed to two editions. Nor do the authors fail to show that the holy founder's own short-comings played a part in causing him difficulties. However, amidst the frailties which God allows to remain even in His loved ones the spiritual stature of the man stands out. The volumes are filled with material as engrossing as it is well-written, not relative just to the private life of Father Moreau or, more generally, to the progress of his institutes, but pertinent also to the stirring times in which he lived. French politics, the theological scene, the philosophical scene, dominant personalities (like Pius IX), others not dominant but intensely interesting (like Father Sorin) or inspiring (like Father Mollevaut)--all these are presented, their tan-gential influences explored. And many of the incidents recounted are memorable. For instance, there is the occasion when on a walk with Father Moreau the famous French Jesuit De Ravignan urged Basil to enter the Society oi: Jesus with him. They had stopped in the Meudon woods to sit together while De Revignan read aloud to Basil, as was his custom, the life of St. Francis Xavier. Suddenly De Ravignan stood up. Punctuating his persuasion with a gesture toward the nearby Jesuit novitate at Montrouge, he asked, "Do you want to come with me? Do you want to come with me?" It would have been good for Father Moreau, had he joined, good for the Jesuits, but in the long run a loss for the Church. Another interesting event is 55 BOOK REVIEWS Review for Religious the audience with the Pope during which the august hand itself removed from the throat of Father Moreau his winged rabat, a symbol to Rome of Gallican insubordination (and for that reason, it might be added, thoroughly out of place as part of Father Moreau's apparel). And there are sad events--Father Moreau's exclusion from the general chapter so that he could exercise no influence. His invitation to another so that he could ruin himself. The general chapter consoled itself, according to one chronicler, that it would not be punished for the faults of its father founder. Truly Father Moreau erected the tree of Holy Cross only to find himself eventually crucified on it. Whether or not this definitive life is the definitive life it is probably too early to j~adge. What is set down here, all 2,000 pages of it, is solid, urbane, well written, though not without traces of the passions that the founder of Holy Cross's work and actions aroused even, or especially, when he was alive. It is a work that reflects the effort and devotion that have been put into it. Sometimes the materials are skimpy--Father Moreau's first twenty-two years are covered in twenty-seven pages. And sometimes the writers have contented themselves with telling us of the congregations' progress without showing how Father Moreau's life affected these events or was affected by them. But in general this is a worthy work, capabl~. executed. It can be recommended for reading in the dining room of mature religious. A few small points: The erroneous implication seems to be made, on page twenty of volume one, that at the present day a cassock is worn in no preparatory seminary. The reviewer feels that Father Bardeau's account of Monsignor Simeoni's audience with the Holy Father, quoted on page 941 of volume two in a footnote, should be put with the record of Father Moreau's audience with the Pope, since it is an historical document pertaining to that audience and necessary for a balanced view of testimony available about it. On page 856, volume t~)o, the name of the then general of the Society of Jesus is misspelled three times. Moreover, volumes so rich in illustrations (twenty-one in the first volume alone) should accommodate the reader with a listing, preferably at the front of each volume, of the drawings and photographs. But these are tiny defects in a great undertaking successfully prosecuted.-- EARL A. W~s, S.J. 56 January, 1959 BOOK REVIEWS STAGES IN PRAYER. By John G. Arintero, O.P. Translated from the Spanish by Kathleen Pond. Pp. x, 178. B. Herder Book Company, St. Louis 2, Missouri. 1957. $3.25. Stages in Prayer is a short treatise on the phases of progress in the spiritual life. The author, an eminent Spanish theologian, is also known for his Evoluci6n M~stica, a work on mystical the~logy. In Stages in Prayer the author outlines in some detail various levels of prayer. His thesis is clear-cut: the higher levels of prayer are for all Christian souls and not merely for those few who are commonly termed "mystics." These higher phases ought not to be considered as extraordinary, for they are of their own nature ordinary in the perfect Christian life. The book is an attempt to indicate the ordinary manifestations of the various stages in prayer. Admittedly the subject is of its nature difficult to treat clearlyl especially in a spiritual compendium of this sort. Unfortunately the author does little to remedy this inherent difficulty. In an, area where sharp distinctions are important, words such as stages or union are 9mployed loosely and often in different senses from one chapter to the next. Though the author's stages are based on those of St. Teresa, the classifications of other spiritual writers are used freely and at times without careful indication of the source. Subdivisions of stages in one chapter are raised to the rank of full stages in other chapters, thus" leading to further confusion. At least half of the printed matter in the volume consists of direct or indirect quotations, mostly from Spanish mystics. These quotations are deployed in various places; in the text itself, in lengthy footnotes, as separate chapters, or in the seventy-eight pages of appendices. Unfortunately many of these quotations are not directly to the point under consideration and serve but to confuse an already complicated thought pattern." Moreover, the translator might well have broken down the author's numerous complex sentences into a size more familiar to English readers; the single seventeen-line sentence on page sixty-nine, for instance, borders on the ludicrous. While not denying that the successful attainment of the higher. stages of prayer depends on God's grace, the author nevertheless is rather severe with those who do not labor strenuously to attain these heights; in one place he practically assures them of eternal ruin (p. 84). Nowhere does he indicate that there is another acceptable 57 I~OOK REVIEWS Review for Religious school of spirituality which rejects the notion that the more lofty levels can be obtained by all who simply love and try to obtain them. Stages in Prayer contains much valuable material for spiritual directors, especially those who are somewhat reluctant to lead their charges toward the higher forms of prayer. However, the sketchy treatment of complex and disputed problems, together with the numerous unqualified statements which require further explanation, do not recommend the book for the open shelves of the convent or seminary library.--R. GERARD flILBRIGHT, THE ACTS OF THE APOSTLES: Text and Commentary. By Giuseppe Ricciotti. Translated by Laurence E. Byrne, C.R.L. Pp. xii, 420. Bruce Publishing Company, 400 North Broadway, Milwaukee 1, Wisconsin. 1958. $8.00. To the books of Al~bot Giuseppe Ricciotti already published in English translation (The History of Israel, The Life of Christ in both the regular and popular abridged editions, and Paul, the Apostle) Bruce now adds The Acts of the Apostles. Those acquainted with Ricciotti's work will recognize in this volume the same level of "high popularization" which has characterized the previous writings of the Italian scholar. Introductory material deals with the text" of Acts, authorship, sources used by Luke, his purpose in writing, date and composition of the book, and an account of modern criticism. The text itself of Acts, which is a translation of Ricciotti's original translation of the Greek, is printed at the top of the page .in' boldface type; and the rest of the p.age--prac.tically always more
Issue 16.4 of the Review for Religious, 1957. ; A. M. D. G. Review for Reh ious JULY 15, 1957 St. ~John of the Cross . Sister'Mary St. Rose R~vitalizing Our Spiritual Life . Harold F. Cohe. Departure After Temporary Profession . . .Joseph F. Gallen AIIocution Concerning Tertianship . pope plus- Book Reviews Questions and Answers Roman Documents VOLUME 16 NUMBER 4 RI::VII::W FOR R LIGIOUS VOLUM/~ 16 JULY, 1957 NUMBER 4 CONT£NTS ST. JOHN OF THE CROSS: DOCTOR OF DIVINE LOVE-- Sister Mary St. Rose, S.N.D . 193 REVITALIZING OUR SPIRITUAL LIFE-- Harold F. Cohen, S.J . 211 DEPARTURE FROM RELIGION ON THE EXPIRATION OF A TEMPORARY PROFESSION--Joseph F. Gallen, S.J . 215 FONTI FIFE . 223 SURVEY OF ROMAN DOCUMENTS~R. F. Smith, S.J . 224 ALLOCUTION CONCERNING TERTIANSHIP-- Pope Pius XII . 236 OUR CONTRIBUTORS . 240 BOOK REVIEWS AND ANNOUNCEMENTS-- Editor: Bernard A. Hausmann, S.J. West Baden College West Baden Springs, Indiana . 241 REVIEW OF CATHOLIC CHURCH MUSIC . 249 QUESTIONS AND ANSWERS: 19. Bows at Benediction . 250 20. Recourse Against Exclusion from Profession . 250 21. Seasonal Prefaces . 251 22. Ordinary Confessor and Cases Reserved in the Institute . 251 23. Occasional Confessor and Jurisdiction for One Other Woman. 252 24. Occasional Confessor Only for Professed and Novices . 252 25. Transfer to Another Monastery . 253 26. Using School Section of Minor Cloister for Community During Vacations . 254 27. Restoration of Solemn Vows in Monasteiies of Nuns . 255 28. Mass To Be Said on a Ferial Day . 256 REVIEW FOR RELIGIOUS, July, 1957. Vol. 16, No. 4. Published bimonthly by The Queen's Work, 3115 South Grand Blvd., St. Louis 18, Mo. Edited by the Jesuit Fathers of St. Mary's College, St. Marys, Kansas, with ecclesiastical approval. Second class mail privilege authorized at St. Louis, Mo. Editorial Board: Augustine G. Ellard, S.J.; Gerald Kelly, S.J.; Henry Willmering, S.J. Literary Editor: Robert F. Weiss, S.J. Copyright, 1957, by The Queen's Work. Subscription price in U.S.A. and Canada: 3 dollars a year; 50 cents a copy. Printed in U.S.A. Please send all renewals and new subscriptions to: Review for Religious, 3115 South Grand Boulevard, St. Louis 18, Missouri. St. dbhn ot: the Cross Doctor ot: Divine Love Sister Mary St. Rose, S.N.D. THE name of St. John of the Cross sometimes elicits a strange reaction: a gentle, modest man.who sincerely pre-ferred oblivion-to power, solitude to lecture hall, and peace to self-justification or defense of the major work of his life, he seems to cause a kind of recoil; perhaps an awe-inspiring viril-ity beneath the disarming serenity, is sensed even after the lapse of almost four hundred years; perhaps to too many he is the Doctor of the Nothing rather than the Doctor of Divine Love. Born Juan de Yepes in the little village of Fontiveros, just thirty miles north of Avila, in 1542, of relatively poor artisans, he was moved at seven years of age, after the death of'his father, to Medina del Campo, where his mother had better pros- . pects of supporting her small family. John early showed such aptitude for study rather than for crafts that he became the prot~g~ of Don Antonio Alvarez de Toledo and, while work-ing in the hospital of his patron, studied till he was nineteen at the Jesuit college in Medina. At twenty, he entered the Order of Carmel, was professed a year later, and studied arts and theology for three yea~s in Salamanca, where one of the four leading universities of the time was located. Ordained in 1567, he met St.'_Teresa_in the same year and was persuaded to abandon his desire to become a Carthusian in favor of help-ing initiate a restoration of the primitive Carmelite rule. Together with the rather impractical but fervent Fra~ Antonio and his five clocks, he planted in a miserable hut in Duruelo the seedling which eventually developed into the Dis-calced Carmelites. Eight happy years of peaceful spiritual and intellectual maturing were followed by a year as professor in the Discalced College of the University of Alcala and by five years in Avila, where as confessor of the hundred nuns of the 193 SISTER MARY ST. ROSE Review for Religious Incarnation, to which St. Teresa had been forced to return as prioress, he wrought a miracle of reformation. But the peaceful years were over; the. Mitigated Carmelites, increasingly embittered by the success of the reform, forcibly seized John on December 3, 1577, and, when their efforts to induce him to abandon the reform were fruitless, flogged and imprisoned him, first at Avila and later--after a confirma-tion of the sentence by the General, Tostado--at Toledo. In a six by ten, windowless cell, during eight and a half months of .bread, water, and fish, with almost daily floggings and no change of clothing, he etched in his own soul the masterpiece of cooperation with God's grace of which we get echoes in his-poems, begun even during his imprisonment, finished and de-veloped later into those unique commentaries which have earned for him the supreme doctorate of the Church itself in the science of mystical theology. Escaping from his prison on August 15, i578, he went south into Andalusia, stopped at Beas, where the lovable Anne of Jesus was prioress, and where he began for 'the devoted nuns his oral commentary on .the "Spiritual Canticle." At Monte Calvario, where he spent eight months recuperating, he began the .4scent o[ Mount Carmel and the Dark Night, finish-ing them, as well as the S/~ir.itual Canticle and the Living Flame o[ Love, during six years as prior in Granada. This was a relatively quiet interlude before the final storm. By a Bull of Gregory XIII in 1580, the Discalced had been separated from the Calced, and the ambitious Doria had been made general of the former. John was' his vicar-general till the chapter of 1591, in which he opposed the revocation of the'Teresian constitutions and other drastic alterations. Sent after the chapter to La Pefiuela as a simple friar and a virtual exile, he experienced the cruel trial of defamation to such an extent that his friends feared that he, even as his old associate. Gracian, would be expelled in disgrace from the order. But the purification was to be of another kind. He fell ill of fever 194 July, 1957 ST. JOHN OF THE CROSS and erysipelas and was sent for medical attention to Ubeda, where the prior had an old score~a pievious reprimand--to settle with him; fobd, medicin.e, visitors, all were denied John or given grudgingly till the intervention of the provincial brought relief--but too late. At midnight on December 14, 1591, John diedl true to his name and like ihe God-man he had so loved~ unknown, suffering, disgraced, abandoned. Guide to the Highest Sanctity To those of us who, inspired at first perhaps by curiosity. about this reputed mystic of mystics, persist in cultivating his friendship, he reveals himself as one of the most human and tender of saints, a corisummate psychologist, a master theo-logian, an uncompromisi.ng guide to the highest sanctity. To prove this assertion from his works would be a relatively easy but decidedly lengthy task. My aim is more modest but still sufficiently ambitious, perhaps even presumptuous: to show from his most logically constructed work, the Ascent of Mount Carmel and its sequel, even its integral part, the D'ark Night, how he responds to the age-old longing of a soul in love with God for a sure road and a swift road to the embrace of the Divine Lover. But first to consult a recent Baedeker for a panoramic view: The end of man is the vision of God-~or, perhaps more ac-curately, to glorify God and enjoy Him forever.~ . . . It is easier to intoxicate people's minds with a desire for contemplation than it is to persuade them of what is required before that gift can be received. ¯ . . Briefly it may be said that the gift of contemplation will always be given to. those who make themselves poor enough in spirit and pure enough in hear~ to receive it. Let me hasten to add, in line with the masteri of the spiritual life, that this poverty of spirit and purity of heart call for detachment but not violent asceticism . But if physical austerities are relativel~ of little importance, what is of fundamental importance is the mortification of self; that is to say, the eli~nination of self-will, self-interest, self-centered think-ing, wishing, and imagining. May I suggest that contemplation-- often conceived of in too intellectualist terms--is nothing else but the realization of God's presence and of our utter dependence on Him. The contemplative is simply one. who sees the divine-human situation as it is. Hence the contemplative state is essentially pas- 195 SISTER MARY ST. ROSE Review for Religious sive; that is, an alert passivity by which we are, in varying degrees of clarity, aware of God--both as transcendent above His creation and immanent within it . The impediments are whatever concentrates our thoughts on the ego--vices, obviously; but also self-centered virtues. Self-for-getting love is of course the key--that agape of the New Testament. This does not mean an anxious striving after God, but letting Him work His wil! in us; imitating God's love for us by a correspondent compassion toward our neighbor, loving the unlovable . When a man can from his heart realize that the only thing that makes sense is that he shall submit to God's invasion of his own little world, on the principle that if God's kingdom is to come then 'my kingdom must go, he will then be as near to the state of contemplation as makes no difference.~ The Nature of Infused Contemplation Now this is the theory, succinctly put by a modern theo-logian. Before we clothe this skeletal outline with living flesh, it may be advisable to take sides in the controversy about the precise nature of infused contemplation, for itis fatally easy to read one's own views into St. John's words. Without at-tempting to justify my choice, I turn. from the position main-tained by Father Reginald Garrigou-LaGrange, O.P., to that of Father Elmer O'Brien, S.J., and Father Gabriel of St. Mary Magdalen, O.C.D. The former puts the matter neatly: I can find no positive reason for asserting that God's sanctify-ing presence must, in the laws of grace, eventually rise above the threshold of spiritual consciousness (except, of course, if one holds for a materialistic concept of grace), and on the other hand the burden of witness in the Christian tradition is against it.'-' The latter, in a passage worth quoting at length for its clarity and charity, has this to say: We have seen how, from the teaching of St. John of the Cross, it follows that the activity of the contemplative gifts of the Holy Ghost may be either hidden or experimental. Both forms are proper actuations of these gifts, which proceed from one and the same principle but are distinct as regards the effect they produce in the subject which receives them. Sometimes they are perceived, some- 1 Graham, Aelred, O.S.B, and others, "Infused Contemplation as the Nor-mal Development of the Life of Grace and the Virtues," Proceedings of the Ninth ~l'nnual Convention (Catholic Theological Society of America, 1954). 203-205. ¯ 2 Ibid., 221. 196 July, 1957 ST. JOHN OF THE CROSS times not, but the soul is always really a~ted upon b~, the gifts and hence there is real infusion. The speculative theologian, who is not directly considering the different form~ which this divine action may take in different souls and at different periods of the spiritual life, will easily give the name of infused contemplation to every form of contemplation in which the action of the gifts intervenes. The Teresian mystical teaching, on the other hand, which distinguishes two modes of divine action, will give the name of acquired to the contemplation resulting from the hidden action which assists the soul's activity, and reserve the name infused for the contemplation in which God makes Himself pei'ceived. Hence the term infused contemplation takes on a different meaning in.the different schools of spirituality.~ With this background and with the prospect of an ex-perienced, intrepid, compassionate guide, we are ready to put on our seven-league boots and take the hand of St. John. He charmingly suggests this procedure in his St~iritua/ Canticle." "And, to the end that this thirsty soul may come to find her Spouse and be united with Him through union of love in this life, so far as she may, and allay her thirst with this drop that can be tasted of Him in this life, it will be well, since the soul asks this of her Spouse, that we should take her hand on His behalf and answer her by showing her the surest place where He is hidden, so that she may surely find Him there with the perfection and pleasure that is possible in this life, and thus may not begin to roam about vainly in the tracks of her companions.''~ With little more than a thread of comments as road signs, I shall let St. John speak for himself. And first, his motive, purpose, and outline of the journey as given in ./lscent o/: Mount Carmel." "It is sad to see many souls to whom God gives both favor and capacity for making progress, remaining in an elementary a Gabriel of St. Mary Magdalen, O.C.D., St. John o/ the Cross (Newman Book-shop, Maryland, 1946). 95. 4 Peers, E. Allison, tVorks of St. John of the Cross (Burns, Oates and Wash-bourne Ltd., 1934). All the quotations throughout the remainder of the article are taken from this two volume work. Because of the extent of the quoted mat-ter, quotation marks rather than reduced type will be used from this point to the end. 197 SISTER MARY ST, ROSZ Review for Religious stage of communion with God, .for want of will, or knowledge, or becatise there is none who will lead them in the right path or teach them how to get away from these beginnings. ",Wherefore, to the end that all, whether beginners or proficients, may know how to commit themselves to God's guid-ance, when His Majesty desires to lead them onward, we shall give instruction and counsel, by His help, so that they may be able to understand His will, or, at the least, allow Him to lead them . "For a soul to attain to the state of perfection, it has ordinarily first to _pass through two principal kinds of night, which spiritual persons call purgations or purifications of the soul; and here we call them nights, for in both of them the soul journeys, as it were, by .night, in darkness. "The first '~ight or purgation is of the sensual part of the soul, which . . . will be treated in the first part of this book. And the second is of the spiritual part; of this . . . we shall treat likewise, in the second and the third part, with respect to the activity of the soul; and in the fourth part, with respect to its passivity. "And this first night pertains to beginners, occurring at the time when God begins to bring them into the state of con-templation; in this night the spirit likewise has a part, as we shall say in due course. And the second night or purification pertains to those Who are already proficient, occurring at the time w'-h~n God desires to set them in the state of union with God. And this latter night is a more obscure and dark ~and terrible purgation, as we shall say afterwards." Night of the Senses Good pedagogue that he is, St. John believes not in goad.s but in stimulants for the arduous uphill climb; speaking of the yearnings of love which' are the effects of generosity, he con-tinues: 198 Ju~, 1957 ST. JOHN OF THE CROSS ~ "In order to conquer all the desires and to deny itself the pleasures which it has in everything, and for v)hich its love and affection are wont to enkindle the will that it may enjoy them, it would be necessary to experience another and a greater enkindling by another and a better love, which is that of its Spouse; to the end that, having its pleasure set upon Him and deriving from Him ~ts strength, it should have courage and constancy to deny itself all other things with ease." In earnest he begins the stripping of all impediments from the sensitive appetites: "He that loves a creature becomes as low as is that ~reature, and, in some ways, lower; for love not only makes the lover equal to the object of his love, but even subjects him to it. Wherefore in the same way it comes to pass that the soul that loves anything else becomes incapable of pure union with God and transformation in him. All the being of Creation, then, compared with the infinite ~Being of God, is nothing. And therefore the soul that sets its affections upon the being of creation is likewise nothing in the eyes of God, and 'less than nothing; for, as we have said, love makes equality and similitude, and even sets the lover below .the object of his love . The soul that. is ravished by the graces and beauties of the creatures has only supreme misery and unattractiveness in the eyes of God. Any soul that makes" account of all its knowledge and ability in order to come to union with the wisdom of God is supremely ignorant in the eyes of God and will remain far removed from that wisdom. [In summary,] as long as the soul rejects not all things, it has no capacity to receive the spirit of God in pure transformation . . . [for the philo-sophical reason that] as in natural generation no. form can be introduced unless the preceding, contrary form is first expelled from the subject, which form, while present, is an impediment to the other by reason of the contrariety which the two have between each other; even so, for as long as the soul is sub- 199 SISTER MARY ST." ROSE Review for Religious jected to the sensual spirit, the spirit which is pure and spiritual cannot enter it." But to prevent the appalling error of Stoicism, he care-fully distinguishes involuntary movements of the appetites from voluntary: "It is true that all the desires are not equally hurtful, nor do they equally embarrass the soul . . . for the natural desires hinder the soul little, or not at' all, from attaining to union, when they are not consented to nor pass beyond the first move-ments-- that is, all those wherein the rational will has had no part, whether at first Or afterward--and to take away these-- that is, to mortify them wholly in this life--is impossible . "The other voluntary desires, whether they be of mortal sin, which are the gravest, or of venial sin, which are less grave, or whether they be only of imperfections, which are the least grave of all, must be driven away every one, and the soul must be fre~ t:rom them all, howsoever small they be, it~ it is to come to this complete union; and the reason is that the state of this. divine union consists in the soul's transformation, accord-ing to the will, in the will of God, so that there may be naught in the soul that is contrary to the will of God, but that, in all and through all, its movement may be that of the will of God alone . "Although a person .who suffers them (natural desires which are not voluntary, and . . . thoughts that go not beyond the first movements, and other temptations to which the soul is not consenting) may believe that the passion and disturbance which they then cause him are defiling and blinding him, it is not so; rather they are bringing him the opposite advantages. For, insofar as he resists them, he gains fortitude, purity, light, and consolation, and many blessings, even as our Lord said to St. Paul that virtue was made perfect in weakness." When our eagerness to start is hardly to be restrained, he gives us the road map at last. How strongly suggestive it is of 200 July, 1957 ST. JOHN OF THE CROSS the tantum quantum "of St. Ignatius; indeed, that simple but infinitely challenging Ignatian norm permeates all the detailed directions by which St. John implements the ltscent's 'famous Chapter Thirteen. "First, let him have an habitual desire to imitate ~hrist in everything that he does, conforming himself to His life; upon which life he must meditate so that he may know how to imitate it, and to behave in all things as Christ would behave. "Secondly, in order that he may' be able to do this well, every pleasure that presents itself to the senses, if it be not ¯ purely for the honor and glory of God, must be renounced and completely rejected for the love of Jesus Christ, who in this lifd had no other pleasure, neither desired such, than to do the will of His Father, which He called His meat and drink . "For the mortifying and calming of the four natural pas-sions, which are joy, hope, fear, and grief, from the concord and pacification of which come these blessings, and others like-wise, the counsels which follow are of'the gr~test help, and of great merit, and' the source of great virtues." .~ Night of the Spirit Then follow the famous counsels for which all the world remembers St. John and which he concludes with the singing words, a refrain to haunt one's soul: "When thou thinkest upon anything, Thou ceasest to cast thyself upon the All. For, in order to pass from the all to the All, Thou has to deny thyself wholly in all. And, when thou comest to possess it wholly, Thou must possess it without desiring anything. For, if thou wilt have anything in all, Thou hast not thy treasure purely in God." Turning now his attention to the spirit of man, St, John shows that the.intellect is purified by faith; the memory, by 201 Si~TER M.~Y ST. ROSE Review for Religious hope; the will, by ~harity. He begins with the definition, the necessity, and the danger of not living by faith; then, be-cause of .the special difficulties of this stage of the venture, he presents a clear view of the goal. "Faith, Say the theologians, is a habit of the soul,, certain and obscure. And the reason for its being an obscure habit is that it makes us believe truths revealed by God Himself, which transcend all natural light, and exceed all human under-standing, beyond all proportion . In the same way [as a partially blind man], a soul may lean upon any knowledge of its own, or any feeling or experience of God; yet, however great this may be, it is very little and far different from what God i.s; and, in going along this road, a soul is easily led astray or forced to halt, because it will not remain in faith like one that is blind, and faith is its true guide . And thus a soul is greatly impeded from reaching this high estate of union with God when it clings to any understanding or feeling or imagina-tion or appearance or will or manner of its own, or to any other act or to anything of its own, and cannot detach and strip itself of these . "Here I treat only of this permanent and total union ac-cording to the substance of the soul and its faculties with re-spect to the obscure habit of union: for with respect to the act, we shall explain later, with the divine favor, how there is no permanent i~nion in the faculties, in this'life, but a transitory union only . When fhe soul rids itself totally of that which is repugnant to the divine will "and conforms not with it, it is transformed in God through love. God cbnlmunicates Himself most'to that soul tliat has progressed farthest in love, namely, that has its will in closest conformity with the ~vill of God. And the soul that has attained~ complete conformity and likeness of will is totally uni~:ed and transf6rmed, in God super-naturally . But the. soul that attains not to such a measure of purity as is in conformity with its capacity never attains 202 July, 1957 ST. JOHN OF THE CROSS true peace and satisfaction, since it has not attained to the possession of that detachment ~and emptiness in its faculties which is required for simple union." Returning. to his concern for the cleansing of the under-standing by faith, he breaks into a cry of anguish over those who will never take seriously our Saviour's counsel to deny themselves utterly and, hence, will never reach the gbal in this life. I quote only the concluding words of a long passage: '~Herein they become spiritually enemies of the cross of Christ; for true spirituality' seeks for~ God's sake that which is distasteful rather than that which is delectable; and inclines itself rather to sufl:ering than to. consolation; and desires to go without all blessings for God'g sake rather th~n to enjoy sweet' communications', knowing that" this is to follow Christ and to deny oneself, and that the other is perchance to seek oneself in. God, which is clean contrary, to lox~e.'~' All kinds of knowledge other than faith are relatively use-~ less: "The farther the soul progresses. !n spirituality,, the .re. ore it ceases from the operation of the faculties in particular acts, for it becomes more and more occupiedin one act. that.is gen-eral and pure;.and thus the faculties that were journeying to a place whither the soul has arri;ced cease to Work, even as the feet stop and cease ~o move when their journey'is over . And, as such so~uls know not the mystery of this new experience, the idea comes to them that they are being idle and doing noth-ing; and thus they allow themselves not to be quiet, but endeavor to meditate and reason. Herice they are filled with aridity and affliction, because they seek ~to~ find sweetness where it is no longer to be found.' . St. John ~hen gi~es the signg by; which We may know whethe~r we have' reached this point in our progress, signs too frequently, reproduced for me to quote them here." Then, after examining one by on'd'the various natural' and supernatural kinds' of kriowl- 203" SISTER MARY ST. ROSE Review for Religious edge which the soul may receive and from which it should detach itself, he comes at last to the intuition of naked truth, aboutJwhich he becomes almost lyrical: "And these lofty manifestations of knowledge can only come to the soul that attains to union with God, for they are themselves that union; and to receive them is equivalent to a certain contact with the Divinity which the soul experiences, and thus it is God Himself who is perceived and tasted therein. And, although He cannot be experienced manifestly and clearly, as in glory, this touch of knowledge and delight is nevertheless so sublime and profound that it penetrates the substance of the soul . . . for such kinds of knowl.edge savor of the Divine Essence and of eternal life . And I say not that the soul should behave in the same negative manner with regard to these apprehensions as with regard to the rest, for . . . they are a part of the union, towards which we are directing the soul; to which end we are teaching it to detach and stril5 itself of all other apprehensions. And the means by which God will do this must be humility and suffering for love of God with resignation as regards all reward; for these favors are not granted to the soul which still cherishes attachments, inas-much as they are granted through a very special love of God toward the soul which loves Him likewise with great detachment." To the purification of the memory, St. John gives detailed attention, concludes with a powerful paragraph, and then focuses the major portion of Book III of the ~sc~'nt on the will. Purgation of Memory and Will "Hence, the more the soul dispossesses the memory of forms and things which may be recalled by it, which are not God,. the more will it set its memory upon God, and the emptier will its memory become, so that i~ may hope for Him who shall fill it. What must be done, the:,, that the soul may live in the perfect and pure hope of God is that, whensoever these distinct images, forms, and notions come to it, it must not re~t in them, but must turn immediately to God, voiding the memory of them entirely, with 2O4 July, 1957 ST. JOHN OF THE CROSS loving-affectioh. It must neither think of these things nor don-sider them beyond the degree which is necessary for the under-standing and performing of its obligations, if they have any con-cern with these. And this it must do without setting any affection or inclination upon them, so that they may produce no effects in the soul . "We should have accomplished nothing by the purgation of the understanding in order to ground it in the virtue of faith, and by the purgation of the memory in order to ground it in hope, if we purged not the will also according to the third virtue, which is charity, whereby the works that are done in faith live and have great merit, and without it are of no worth . The st~:ength of the soul consists in its faculties, passions, and desires, all of which are governed by the will. Now when these faculties, passions, and desires are directed by. the will toward God, and turned away from all .that is not God, then the strength of the soul is kept for God, and thus the soul is able to love God with all its stiength. And, to the end that the soul may do this, we shall here treat of the purgation from the will of all its unruly affections . These affections and passions are four, namely: joy, hope, grief, and fenr." Apparently St. John intended to give instructions concern-ing each of these passions in their impact on the will and every good to which the will of man is attracted. He did not complete the project; yet even the truncated treatise is a masterpiece of analysis of all the subterfuges by which we seek ourselves instead of God.__:_ The general truth W]~l~--which he prefaced his treatment will serve as a summary: "This truth is that the will must never rejoice save only in that which is to the honor and gloi:y of God; and that the greatest honor we can show to Him is that of serving Him according to evangelical perfection; and anything that has naught to do with this is of no value and profit to man." 205 SISTER MARY ST. ROSE Review for Religious The Dark Night St. John abruptly ended the Ascent, having completed only half of what he had promised, the t~o purgations "with respect to the activity of the soul," of the sensual part and of the spiritual part of the "soul. The two purgations "with respect to its passivity" he reserved for treatment in his Dark Night, a work considered his especially original .contribution to~ my~stical theol-ogy. In it he tharks clearly the point of departure, th~ neces-sity, thd general conspectus, and the signs that the soul is ready f6r this'last and most trying part of its ascent tO" perfect uniofi with God. "Into this dark night souls begin to enter when God draws them'forth from the state of beginners--w~hich is the state of those that meditate upon the spiritual roadmand begins to set them in the state of progressives--which is that of,those who are already contemplatives--to the end that, after passing through it, they may arrive at the state of the perfect, which is that of divine union of the soul with God . ¯ "However greatly the soul itself labors, it~ ~annot actively purify itself so as to be in the least degree prepared for the divine union of perfection of love, if God takes not its hand and purges it not in that dark fire, in the way and manner that we have to describe. "The night of senseis common and comes to many; these are the beginners; and of this night we shall first speak. The night of the spirit is the portion of very ~few, and thes~e are they that are already practise.d and profi.cient,~ of whom we shall treat hereafter . "For the making of this distinction ['between aridities from the night of the sensual desires and from sins and imperfec-tions] I find that there are three principal'signs. The first is whether, when 'a soul finds no pleasure or consolation in the things of God, ~it also fails to find it in any thing" created; for, as God sets the soul in this dark night to' the end that He may 206 July, 1957 ST. JOHN OF THE CROSS quench and ~purge its sensual desire, ~He allows it not to find attraction or sweetness in anything whatsoever. . . The sec-ond sign whereby a man may believehimself to be experiencing the said purgation is. that ordinarily the memory is centered upon God, with painful care and solicitude, thinking that it is not serving God, but is backsliding, because it finds itself without sweetness in the. things of God, . . The third sign . . is that the soul can no longer meditat~e or reflect in its sense of the imagination, as it was wont, however much it may endeavor to do so." St. John assures us that if we follow the procedure he suggests in the Dark Night we shall surely receive the prom-ised fruits, which to any one who has not experienced them sound" like cold comfort. "What they must do is merely to leave'the soul free and disencumbered and at rest from all knowledge and thought, troubling not themselves, in that state, about what they shall think or meditate, but Contenting themselves with no more than a peaceful and loving a~tentiveness toward God, and in being without anxiety', without the ability and without desire to .have experience of Him or to perceive Him . "This is the first and principal benefit caused by this arid and dark night of contemplation: the knowledge of oneself and of one's misery . And the smallness of this self-satis-faction, together with the soul's affliction at not serving God, is considered and esteemed by God as greater than all the con-solations which the soul formerly experienced and the works which it wrought, however great they were, inasmuch as they were the occasion of many imperfections and ignorances." For fear we should consider ourselves aimost at our jour-ney's end, St. John disillusions us gently but firmly, tells the nature of the dark night of the spirit through ~ which we must grope, its effects, and its distinctive characteristic, and at last reveals to us th~ consummation of our~ quest. 2O7 SISTER MARY ST. ROSE Review for Religious "These proficients have two kinds of imperfection: the one kind is habitual; the other actual. The habitual imperfec-tions are the imperfect habits and affections which tfave re-mained all the time in the spirit, and are like roots, to which the purgation of sense has been unable to penetrate. The dif-ference between the purgation of these and that of this other kind is the difference between the root and the branch, or be-tween the removing of a stain which is fresh and one which is old and of long standing. For, as we said, the purgation of sense is only the entrance and beginning of contemplation leading to the purgation of the spirit, which, as we have like-wise said, serves rather to accommodate sense to spirit than to unite spirit with God. But there still remain in the spirit the stains of the old man, although the. spirit thinks not that this is so, neither can it perceive them; if these stains be iaot re-moved with the soap and strong lye of the purgation of this night, the spirit will be unable to come to the purity of divine union . "This dark night is an inflowing of God into the soul, which purges it from its ignorances and imperfections, habitual, natural, and spiritual, and which is called by contemplatives in-fused contemplation, or mystical theology. Herein God secretly teaches the soul and instructs it in perfection of love, Without its doing anything, or understanding of what manner .is this infused contemplation . "And when the "soul is indeed assailed by this divine light, its pain, which results from its impurity, is immense; because, when this pur~ light assails' the soul, in order to expel its im-purity, the soul feels itself to be so impure and miserable that it believes God to be against it, and thinks that it has set itself up against God . The second Way in which the soul suffers pain is by reason of its weakness . . . for sense and spirit,-as if beneath some immense and dark load, are in such great .pain and agony th. at the soul would find advantage and relief in 208 July, 1957 ST. JOHN OF THE CROSS death . The third kind of suffering .~. results from the fact that two other extremes meet here in one, namely, the Divine and the human . As a ~result of this, the soul feels itself to be perishing and melting away, in the presence and sight of its miseries, by a cruel spiritual death . The fourth kind of pain is caused in the soul by another excellence of this dark contemplation, which .is its majesty and greatness, from which arises in the soul a consciousness of the other extreme which is in itself, namely, that of the deepest poverty and wretchedness: this is one of the "chiefest pains that it suffers in this purgation . "For spiritual things in the soul have this characteristic, when they are most purely spirit.ual, that, when they are trials, the soul believes that it will never escape from them, ~and that all ~its blessings are ndw over, as has been seen in the passages quoted; and when they are spiritual blessings, the soul believes in the same way that its troubles are now ove.r, and that bless-ings will never fail it . "In the midst of these dark afflictions, the soul feels itself to be keenly and acutdy wounded in strong divine love, and to havea certain realization and foretaste of God . It some-times comes to pass that this mystical and loving theology, as well as enkindling the will, strikes and illumines the other faculty also--that of the understanding--with a certain divine light and k-fiowledge, so delectably and delicately that it aids the will to conceive a marvelous fervor, and, without any action of its own, there burns in it this divine fire of love, in living flames, so that it now appears to the soul a living fire by reason of the living understanding which is given to it . Thus the pres-ence of God is felt, now after one manner, now after another. ¯ . . That dark love cleaves to the soul, causing it a most watch-ful care and an inward solicitude concerning that which it must do, or must not do, for His sake, in order to please Him. It will consider and ask itself a thousand times if it has given Him 209 SISTER MARY ST. ROSE cause to be offended; and all this it will do with much greater care and solicitude than before . For here all the desires and energies and faculties of the soul are recollected from all things else, and its effort and strength are employed in pleasing God alone . After this manner, b'y this mystical theology and secret love, the soul continues to rise above all things .and above itself, and to mount upward to God. For love is like fire, which ever rises upward with the desire to be absorbed in the center of its sphere." But prose is a poor vehicle now. Even St. John stops trying to finish the Dark Niyht. To the Spiritual Canticle or the Living Flame of Love we must turn for the epitha-lamium of God. and the soul: "My love is as the hills, The lonely valleys clad with forest trees, The rushing, sounding rills, Strange isles in distant seas, Lover-like whisperings, murmurs of the breeze. "My love is hush-of-night, Is dawn's first breathings in the heaven above, Still music veiled from sight, Calm that can echoes move, The feast that brings new strdngthmthe feast of love." and "O living flame of love That, burning, dost assail My inmost soul with tenderness untold, Since thou dost freely move Deign to consume the veil Which sunders this sweet converse that we hold." Revit:alizing Our Spiri!:ual Lit:e I-larold I::. Cohen, S.J. WE MUST be struck, at least occasionally, by the difference between ourselves and what our religious institutes would have us be, and by the difference between ourselves and those of our brothers in Christ whom the Church holds up as models of sanctity, and finally, by the difference in the fruit produced by our saints and that produced by ourselves. Per-haps in our more serious moments we ask ourselves the reason for this. We may answer that God gives more grace to some than to others and let it go at that. But then we are not being honest with ourselves, for whatever the measure of God's grace, our own correspondence to that grace can give us serious concern. The answer is not difficult to state--it is difficult to admit. The reason we lack sanctity and fruitfulness in the apostolate is that we are not united with God. We are not the men of prayer, recollection, and study,that God wants us to be. We try to ser~,e two masters, God and the world. We turn, as if mag-netized, to the distraction of-TV, radio, sports, movies, and magazines--and we have to admit that these things withdraw us from silence and recollection in God. We all know, of course, that these things are not only not sinful, but a moderate use of them is helpful to us. But in seeking a solution to our own-lack of high spirituality and consequent weak apostolate, we certainly should give serious consideration to just how moderately we use them. For if we find that instead of being men of faith who have cut ourselves away from creatures by poverty and. self-denial, exuding the fragrance of Christ to all we come in contact with, we are men given over to our own ease and comfort, with more interest in picture magazines than hungry, poorly housed human beings; that we who profess as our purpos~ in life the salvation of souls are more interested in watching a 211 HAROLD F. COHEN Review for Religious game on TV than hearing confessions, more interested in cock-tail parties than visiting the sick~if we find these thi,ngs, we must admit that we lack .moderation in our use of legitimate diversions, and that now, no longer, a means, they have become an end in themselves. Once we realize that we are not united with Goc~, and that at least one of the causes is our effusio ad exteriora, we might again ask ourselves, "Why?" Have we lost the secret of sanc-tity of the saints? Or are we living in an age that necessar!ly precludes doing great things for Christ? Certainly we started off seeking union with God in the beginning of our religious life--the trouble is that having learned our lessons in the noviti-ate, we have let our vivid ideals grow dull with the passage of time. A new set of ideals has replaced them subconsciously, the ideal of the "good" priest or religious: faithful (more or less) to spiritual exercises, at least in the beginriing of his change-over, he none the less .frequently enjoys himself at the entertainments of externs; and he over-emphasizes the "breaks" affor_ded by his institute, freely partaking of '~the good things of this world," push-ing far to the back of his mind the crucified Christ. " Of course he loves Christ; he can even tolerate the idea of a crucified Master, but His cross is fast becoming to him, as to the world of which he is a part, something hard to understand. Nights are not a time of prayer, study, and apostolic labo~, but for "neces~'ary" relaxation. The hungry souls waiting for the bread he alone can give them are still waiting. _ How can we get back to our novitiate ideals of prayer, self-sacrifice, and' hard work for God? How can we get back to them in a practical way? Here a litany of meang opens before us. I will suggest only one, but one that'is the means of re-vitalizing our spiritual life. It is a return to serious prayer. "He who abides in Me and I in him, he it is that b:ears much fruit. For without Me you can do nothing" (John 15:4). If we daily share the intimacy of our divine Friend, His pres-ence can't help but have its effect on us. But if we are to 212 July, 1957 REVITALIZING OUR SPIRITUAL LIFE share this,intimacy, our prayer must be serious¯ We often-- or perhaps less--put in our daily time of prayer; yet few would dare call themselves men of prayer. We are not making con-tact. The vitalizing grace of the Vine is not flowing into the ¯ branches, and consequently we bear little fruit. The juncture, the point of union, is closed up. To establish the contact with Christ. our thirsting souls need, we have to make prayer our primary interest. Once we truly are making a serious effort in prayer, God will show us what changes have to be made in our lives, and He will give us the grace to make them. When we respond to these graces, our prayer takes on its deepest meaning: "Thy will be done," His will for our own shedding of self to put on the generosity of Christ, to put afide comforts to dedicate ourselves to the salvation of the souls He died for. Once. we are in this state of self-dedication, God usually eases with His consolations the difficulties of prayer. For after all, as Father Boylan s6 well points out in his Difficulties in Mental Prayer, our main difficulty in prayer is that we are afraid to come face to face with God because we are not doing His will in some way or another. For our prayer to reach this full flowering, we have to do the spade work of daily effort. And here is the crisis, for our wills are weak. It is.a decision we must all make--to give up the pleasures of long nights to get up in the morning and down on our knees--or to live in a lethargy that can look only with concern to the day of accounting before the divine Shepherd, who sees His sheep dying of hunger because we would not feed them. Once the decision to pray seriously is made, we have to take the means to make our decision effec-tive: the preparation of points the night before, and hardest of all, the excluding of all the distracting thoughts that crowd into our minds at night and in the morning. (With regard to points, choosing a good book is a problem; the Gospels; the Psalms, and the Imitation are good stand-bys. New matter 213 HAROLD F., COHEN isn't necessary every day, for the same over a period of time often supplies all the spiritual food we need. Sometimes a book isn't at all necessary for determining the actual matter of the meditation, "for we simply can jot down a few thoughts that occur to us and fill in the remaining time by reading.) " In the moining we have to have the grim determination to stick at it despite the difficulty and not to consent to any dis-tractions. The final point is a check-up afterwards to see how it has gone, why thdse points helped, why I did or didn't do well, etc. We often neglect this; so it is good to recall that those wiser than we have suggested--or prescribed--it and that it is the means to progress in prayer. Before concluding, I would like to make three pertinent remarks. (1) A daily reading from the Gospels, if only one or two incidents, at the beginning of spiritual reading or points will be helpful in bringing about contact in prayer, bringing before us as it does Jesus in all His attractiveness. (2) There is no subject like the Passion of Christ to stir up our love and gratitude and zeal. (3) Some make no progress in prayer be-cause they have gotten all they can out of meditation and affective prayer. They need that simpler form of prayer, called by spiritual writers the prayer of simplicity. This prayer is described by Tanquerey in The Spiritual Life, and more at length by Lehodey, o.C.S.O., in Tke I~ays of Prayer and Pou-lain, s.J., in Tke Graces of Interior Prayer. The time has come" for the~e souls to slow down their rowing and start letting out their sails. To conclude, then, our weak interior life and poor apos-tolate are~ due mainly to a lack of serious prayer. Once we begin to pray in earnest and grow in friendship with Christ, He will give us the graces to lead a life united to Him and to pass on our love and enthusiasm to others. It is one of the promises of His Heart to make tepid souls fervent. What better time to remind Him of His promise than in our daily prayer? 214 Depart:ure From Religion on t:he I::xpira!:ion ot: a Temporary Prot:esslon ,Joseph F. Galleh, S.,J. 1. Definition. On the expiration of any temporary profession, e. g., of one, two, or three years, a religious is free to leave his institute; and the institute, for just and reasonable causes, may exclude the religious from making any further profession, i. e., a renewal of temporary vows or perpetual profession. An exclu-sion is not a dismissal. Dismissal in canon law is verified only by an expulsion during the. time of the vows. An exclusion is an expulsion at the expiration of the vows. Therefore, the canoni-ca~ norms on dismissal do not apply to an exclusion. In its nature, an exclusion is not so much an expulsion of a member but rather a refusal to admit to further profession and a judgment and decision that a subject in a probationary period of the reli-gious life does not possess a vocation at least for the particular institute) 2. Leaving. The religious has no canonical or moral obligation to remain. The code explicitly asserts his canonical freedom to leave (cc. 575, § I; 637). He is also morally free to leave, since no law of God commands him to remain in a life of counsel on the expiration of his vows. A moral obligation would arise only accidentally and in cases that are not very practical, i. e., if one had vowed to remain in religion or intended to leave because of a sinful motive.: Furthermore, in practically all these cases there would be a sufficient reason for a dispe~nsation or commutation of the private vow; find in the instance of the 1Cl¢. Bastien, Directoire Canonique, n. 607, 1-2; Goyeneche, De Religiosis, 194, note 10; D'Arnbrosio, /ll~ollinaris, 4-1931-124. zCf. Goyeneche, Commentarium Pro Religiosis, 5-1924-86-93; Schaefer, De Religidsis, n. 1519; Geser, Canon Law Governing Communities o/ Sisters, n. 1072. 215 JOSEPH F. GALLEN Review for Religion, s sinful motive, there would rarely be lacking also morally good and, at least in some cases, even compelling motives for such a religious to leave. The religious is not obliged to obt~iin the consent or approval of his superior of his intention to leave, but prudence would practically always demand that he consult his superiors or a prudent confessor concerning so important a decision. 3. Exclusion. (a) Competent superior. Canon 637 leaves to the constitutions the determination of the superior competent for exclusion. The constitutions of lay congregations .usually assign this right to the superior general with the consultive vote of his council, but a few demand the deliberative vote. A small number of constitutions give this power to the provincial or higher superiors either alone or with the consultive or, less fresluently, the deliberative vote of the council. If the consti-tutions contain no determination, the competent higher superior is the one who has the right to admit to the profession from which the religious is excluded. Since exclusion is merely the denial or correlative of admission to profession and admission require~ at least a consultive vote (c. 575, ~ 2), it would be more in conformity with the code for this higher superior to consult his council. Such consultation is not strictly obligatory, since canon 637 treats exclusion separately from admission and does not .impose any vote of a council. The same principle applies in a monastery of nuns to the superioress and the vote of her council or chapter when the matter of exclusion is not determined in the constitutions. No particular process is prescribed by the code for the decision oi~ exclusion. Since exclusion is merely the .negation of admission to profession, it is part .of the delibera-tions or decision on admissibn to the profession in question. A few authors state the eviden~ fact that canon 637 does not reserve exclusion to a higher superior and conclude that the constitu-tions may.assign this right to a local superior. Howev.er, this is not the practice of constitutions nor does it seem to be in con-formity with the evident nature of an exclusion, which is a re- 216 July, 1957 DEPARTURE AFTER TEMPORARY PROFESSION fusal of admission. Canon law reserves admission to profession to higher superiors (c. 543). (b) Sufficient reasons for exclusion. Evidently the sufficient reasons are those that render the, subject either certainly finsuited or only dubiously suited for admission to the profession in. ques-tion. It is permissible but not obligatory to grant a renewal or prolongation of. temporary vows in the latter case provided there is solid hope that certain suitability will be attained by the renewal or prolongation. The doctrine of many authors that the judg-ment of the sufficiency of the reasons for exclusibn is left to the conscience of the competent higher supe. rior is evident from the fact and law that the judgment of the suitability for a profession appertains to the competent higher superior (c. 543). The code expresses this principle of suitability in canon 637 by demanding merely just and reasonable, not serious'or grave, reasons for an exclfision. In judging the sufficieficy of the ~easons, the general good of the institute is to be considered above" that of" ~he indi-vidual. The following are the particular sufficient reasons usually listed by authors by way of example: the lack of a religious vocation or of a firm and constant vocation; serious doubts as to the general suitability of the subjecf for the religious life; inepti-tui: ie for the work of the institute, even if fully known to ~uperiors before profession, whether the ineptitude arises from~ a lack of general ability, intelligence, ol appl;c.ation, from ~i defect of pru-dent jtidgment, laziness, negligerice; or from culpable or inculp-able causes; if it is. foreseen'that th~ subject will be only a' very mediocre religious, will be tepid, careless in the spiritual life, or worldly; those who are habitually negligenh careless, or tepid in religious observance, even though not in gerious matters, and wh6 have refused to correct their conduct; those who cause serious discord in the community; those who will find community life very. difficult and will make it difficult for others; and when it-is foreseen that the subject will be rather harmful than ~usefu! to the institute. An exclusion without a just and reasonable motive 2~17 JOSEPH F. GALLEN Review for Religious is a sin against charity and the law of the Church but it is not unjust nor invalid. In the very few institutes that have only temporary vows or in which the prescribed temporary profession is longer than six years, it is the more probable and common opinion that after more than six years in temporary vows merely just and reason-able causes do not suffice for exclusion but serious and' culpable reasons joined with incorrigibility are necessary. The argu. ments for this opinion are that canon 642, § 2, appears to liken a tem-~ porary profession beyond six years to perpetual vows and that it seems inequitable to exclude one who has been so long in religion for merely just and reasonable causes.3 (c) Ill Health. Ill health is a sufficient motive for exclusion only if it is proved with certainty that it had been contracted and fraudulently concealed or dissimulated before the first profession of temporary vows (c. 637). The same principle is true of dismissal (c. 647, § 2, 2°). Ill health is therefore not a sufficient motive for exclusion if it was contracted after the first profes-' sion or if it was contracted before this profession but was then known to the superior or, if unknown, was not fraudulently con-cealed or dissimulated before the first profession. The fraud must be proved with certainty. It is sufficient that the fraud have been committed by anyone who had the obligation of mani-esting th~ illness, i. e., the religious, his parents, or guardians.4 Lack of ability for the duties of the institute is not a suffi-cient reason for exclusion if it is the result of an infirmity that was not fraudulently concealed or dissimulated before first profes-sion, since What is true of sickness is also to be affirmed o.f the consequences of sickness. Such a religious may be counselled and 3D'Ambrosio, 05. cit., "4-1931-124-28; Vermeersch-Creusen, l!l~itome luri~ Canonici, I, n. 795; Creusen, Religious Men and IVomen in the Code n. 331, 2; Jombart, Tra",t "e de Dro"*t Canot*'*que, I, n. 903, 6; Jone,. Commenta"'r m" m *n C'od*- cem luris Canonici, I~ n. 560; Schaefer, 01b. cit., n. 1523; Sipos, En~t~iridion luris Canonici, 333. 4 Goyeneche, De Religiosis, 194. 218 ~ July, 1957 DEPARTURE AFTER TEMPORARY PROFESSION persuaded to leave religibr[ ~oluntarily 0~'~o transfer to the class of lay brother or sister. The principle with regard to ill health is true also of ail-ments such as hysteria and neurasthenia. Superiors, without using constraint, may counsel and persuade all such persons t6 leave religion voluntarily) If they will not leave, their ailment and conduct can constitute a serious problem. If their improper or strange conduct certainly or probably has its source in the ail-ment, they may not be excluded; if the malady is certainly only a pretext for such conduct, they may be excluded. Frequently at least, they should be taken to a specialist and may be sent to an institution for the care of such patients. The case may be presented with all its circumstances to the Sacred Congregation of Religious.6 These difficult cases make evident the care and decisiveness superiors should exercise in admission to the pos-tulanc); and noviceship and in dismissing unsuitable subjects dur-ing these periods of probation. The master of novices should promptly consult higher superiors concerning even probable man-ifestations of such conc~mons. Since canon 637 permits an exclusion for ill health only if it was fraudulently concealed before first profession, a novice may not be admitted to temporary profession as an experiment and on the condition that he will be excluded at the end of tem-porary vows if his health does not improve.6 (d) Insanity. The Sacred Congregation of Religious replied on February 5, 1925, that a religious could not be excluded from an institute because of habitual and complete insanity (total lack of use of reason), whether temporary (curable) or perpetual 5 Cf. Berutti, De Religiosis, 325. o Cf. Jombart, Revue des Communaute's Reli#ieuses, 5-1929-200-201; Bastien, o1~. cit., n. 631, 6. ~ Cf. Bastien, 0~. cir., 450, note ~. SCreusen, 0p. cir., n. 331, 1; Jombart, Trait[de Droit Canonique, I, n. 903, 5; Coronata, lnstitutiones luris Canonici, I, 838, note 5; Palombo, De Dimissione Religiosorum, 202, Bastien, o~. cir., n. 607, 5; Jone, olb. cir., I, 561; Goyeneche, Quaestiones Canonicae, II, 123-24. 219 JOSEPH F, GALLEN Review for Religious (incurable), contracted after first temporary profession.:' Evi-dently such a religious may not be admitted to a renewal of tem-porary vows or to perpetual p'rofession during the tim~ of his insanity, since he is incapable of a human act. He must be re-tained by the institute and therefore may not be sent away either by exclusion or dismissal. He remains in the same juridical con-dition as at the time he lost his mind; and consequently he has the same rights and the instiLute has the same obligations to him as to any professed of temporary vows. He may be sent to an institution and even to his own family, if the family freely asks or accepts his care. He is still a member of the institute, and the expenses of his support and care are to be borne by the institute unless the family freely accepts them. An absence of more than six months outside any house of the institute do~s not demand the permission of the Holy See in such a case J" If he recovers and is found suitable, he is to be admitted to further profession. Prudence would, practically always demand a pro-longation of temporary vows, and ordinarily such a person is to be advised to leave the institute for his own goodJ~ It is more probable that the time of the temporary profession continues to run during the insanity. From the reply of the Sacred Congre-gation, however, it is also probable that the time of such profes-sion is suspend.ed during the insanity. Even in the former opin-ion, the subject is still a member of the institute and must be retained when the time of the vows has expired. 4. Manifestation of reasons. The religious is to be informed ot~ his exclusion in due time, orally or in writing, by the com-petent higher superior, either personally or through another. The latter should be at least a local superior. Kindness is to be shown to the excluded religious. The code does not oblige the compe- '~ B.ouscaren, Canon La~" Digest, I, 309-10. ¯ ~o gEVtEW FOg gEt.tGIOUS, November, 1956, 290-91. ~ Cf. Maroto, Commentarium Pro Religiosis, 6-1925-177-79; Goyeneche, Quaes-tiones Canonicae, I, 430-31; Coronata, op. cit., I, n. 639; Regatillo-Zalba, De Statibus Particularibus, n. 25 I. 220 July, 1957 DEPARTURE AFTER TEMPORARY PROFESSION tent supdrior to manifdst "tl~e.reasons for ~the exclusion to the religious. This may be done, and some authors counsel it that the religious may institute a recourse to a higher superior or the Holy See if he chooses to do so. The reasons should always be drawn up completely and accurately and retained in the files of the institute so that a replK may be given in the event of a recourse, .par'ticularly of one to the Holy See. 5. Recourse. The code says nothing about a recourse against an exclusion. The religious may institute a recourse to a higher superior or the Sacred Congregation of Religious simply because a religious may always do this against an action of a lower author-ity that he believes to be unreasonable or unjustified. There is no special right either from canon law or the nature of the matter of making a recourse against an exclusion. A recourse to the Sacred Congregation has very little hope.of, success except in the case of a clearly illeg'al exclusion,r' The Holy See evidently knows that by canon law (c. 54J) the competent superior is the judge of the suitabiliW of a subject for profession and conse- .quently of.the sufficiency of the motives for exclusion from pro-fession. It" is equally clear that motives that may not appear sufficient in. themselves are often such when viewed as a whole and joined with observation of the .subje~t. A recourse does not suspend ttie effect of the exclusion. The religious should leave the institfite and put ~ff the religious habit. He may be per-mitted to r~main in a: house of the institute and to wear the habit until i~he recourse is definitively settled. 6. Effects of a voluntary departure and of exclusion. If a re-ligious voluntarily leaves or is excluded at the expiration of a temporary profession, the vows cease. There is no need of a dis-pensation from the vows. The other effects in either case are the same as in secularization, which were explained in the RE'CIF~W FOR RELIGIOUS, September, 1956, 233-36. r2Bastien, op. tit., n. 607, 3; Jombart, Re¢aur des Communaute's Reliyieuses, 5-1929-164. 221 JOSEPH F, GALLEN Review for Religious 7. Moment at which the religious fully departs. The i,mportance of the answer to .this question is that it determines the exact mo-ment in which the religious is freed of his vows, ceases to be a religious, is bound by the diriment impediment of a previous religious profession, and rendered incapable of valid admission to the noviceship of any institute without a dispensation from the Holy See (c. 542, 1°). After such an admission, a noviceship and temporary profession must be made for the full time pre-scribed by the constitutions of the particular institute. The religious fully departs at the moment in which his external and absolute declaration of not making a further profession or the external and absolute declaration of the competent superior of not admitting him to a further profession is joined with the expiration of temporary vows.~3 There are two probable opinions on the moment of the expiration of temporary vows, caused by conflicting interpreta-tions of canon 34, § 3, 5; but either of these opinions may be followed. In the first opinion, the vows expire at any moment on the anniversary day when such a declaration is made or, if made .previously, has not been retracted: Therefore,. if the vows were made for a year, Augut 15, 1956-August 15, 1957, and such a declaration was previously made, the vows expire at midnight of August 14-15, 1957. In this opinion, the sub-ject may depart from the institute at any hour on the anniversary day, i. e., August 15, 1957. If no such declaration has been made, the vows expire at midnight of August 15-16, 1957.14 A second opinion maintains that the vows, when they are not renewed or perpetual profession is not made, never expire before midnight of the anniversary day, i. e., August 15-16, 1957. In this opinion, the subject may depart from the institute at any hour on the day after the anniversary day, i. e., August 16, 1957.1'~ la Cf. Abbo-Hannan, The Sacred Canons, I; 656; Beste, lntroductio in Codicem, 431; Cervia, De Proiessione Religiosa, 110; Coronata, op, cir., I, r~. 639; Goy-eneche, De Reli#iosis, 193; Jone, o,~. cir., I, 562; Schaefer, o,~. clt., nn. 1519-20; Regatillo-Zalba, o/~. cit., n. 250. 14 Cf. Vermeersch-Creusen. o~0. cir., I, n. 728, and the authors there cited. ~sCf. Michiels, Normae Generales Juris Canonici, II, 269, and the authors 222 July, 1957 DEPARTURE AFTER TEMPORARY PROFESSION Neither opinion demands tha't the religiotis have actually departed from the institute. In the rare absence of an explicit declaration, a departure from the institute would constitute an implicit declara-tion not to make a further profession. An external and absolute declaration is necessary. If the religious does not renew his vows or make perpetual profession for some time after the expiration, e. g., because of doubts about his vocation or illness, and later wishes to make profession, he may be admitted to the profession. A merely interior, doubtful, or hesitant declaration of not making or excluding from profession does not suffice. The absolute declaration of not making or of excluding from profession may be revoked before the vows have cergainly expired, i. e., at midnight of the anniversary day, August 15-16 in the example given ,above. Neither declaration may be revoked after the ~iows have certainly expired, even if the religious has not as yet left the institute. 8. Departure before expiration. If serious reasons so demand, superiors may permit a religious to leave a day or two before the. expiration of his vows ~rovided he puts off the religious habit and intends to observe his vows until the anni,~ersary day. Such a reason is the difficulty or embarrassment his .presence would cause as profession proximately approaches or on the profession day.~ If so required by urgent reasons, superiors, in virtue of canon 606, § 2, may permit an earlier departure, e. g., two or three weeks. If a much earlier departure is judged necessary, application should be made for an indult of secularization. FONTI VIVE In March, 1957, Fonti Vive, a quarterly Review of Passion Spir-ituality, began its third year of publication in Caravate (Varese), Italy. The varied articles on theological, liturgical, biblical, and mystical sub-jects seek to promote the understanding, contemplation, and the living out in our lives of Christ's Passion. Those readers of gEVIEW FOR RELIGIOUS who are able to read Italian will be interested in this new publication devoted to Passion spirituality. The editor is Reverend Costante Brovetto, C.P., S.T.D. .there cited. ~6 Creusen, op. cir., n. 331, 3. 223 Survey ot: Roman Document:s R. F. SmiEh, S.J. IN THIS article a survey will be given of those docu-ments which appeared in the Acta Al~Ostolicae ,Sedis (AAS) from January 1, 1957, to March 31, 1957. It should be noted that all page references in the present article are to the 1957 AAS (volume 49}, even when th~o document discussed may bear a date from 1956. Christmas Message of 1956 The Holy Father's Christmas message of 1956 (AAS, pp. 5-22) was easily the outstanding doclament published, in AAS during the period surveyed. The document is a long one of some seven thousand words; it is interesting to note that a large part of the message was not actually spoken b~; the Holy Fafher on Christmas Eve, but was merely published in the official text of the message. In the introduction to his message the Holy Father empha-sizes the contradictidn to be found in the twentieth century: On the one hand there is the confident hope, of modern man that he, as author of the second technical revolution~ c~n bring a life of fullness and plenty to all; and on the other hand there is the bitter fact of the long, long years of grief, ruiri, and fear that the modern world has just endured. His Holiness then begins the first of the three parts into which his message 'is divided by remarking't~hat' the above, con-tradiction can be resolved only by a knowledge and acceptance of human reality in all its completeness. From the crib of Bethlehem man can learn the origins/1 goodness and power given to him in paradise; but he also learns the weakness of human nature that was first manifested in the sin of Adam and Eve and that then became the heritage of all later generations. 22_4 ROMAN DOCUMENTS We know, continues the Vicar of Christ, that man's co.ntrol over nature was given him for the benefit, not the endangering, of human society; original sin has not removed man's dominion 6ver the world, but only security in the exercise of that domin-ion. Neither has original sin destroyed man's capacity to shape history, though it is no less c.ertain that after original sin human life is a mixture of confidence and misery, of security and un-certainty, of life and death. At the crib, however, we also learn that Christ is our Redeemer, come to restore man to his divine sonship and to bestow the grace whereby the disorder produced by original sin and by later personal sins can be overcome at least in the interior of man, if not always exteriorly. The Christian then possesses all the elements necessary to overcome the contra-diction of the twentieth cent~ury in his interior life; this, how-ever, gives him no right to excuse himself from contributing to the external solution of .that contradiction. To make such a contribution, the Pontiff adds, the Chris-tian must have a Clear idea of what modern man thinks of sin. Because modern man does not ddmit sin, he attributes the per-verse inclinations of man to a kind of sickness and functional weakness which of themselves are curable. Modern man~the~ awaits the day when a perfecting of human knowledge will allow him to heal all such moral sicknesses. This technological solution to the problem of moral evil completely overlooks the truth that man is a subject of free action--good or bad--and leads to innumerable evil results: softness in education; indul-gence to crime; aversion to even just punishment; the a~tempt to solve social problems not through the consciende and respon-sibility of individuals, but by the' attainment of a greater knowl-edge of the mechanics of social structures. In the second part of his message Piu~ XII says that one of. the bases of the twentiet,h-century[ contradiction onsists in the hope to create a completely_ new society without reference to 225 R. F. SMITH Review for Religious the history that has shaped man. This attitude is the 'result of that technological realism which admits no limits to human power, subjects every reality to a method of technique, and places unlimited confidence in technological know-how. For technological man, the entire world is but a laboratory wherein he treats social life like a machine which he dismantles and then attempts to reconstruct according to his own pre-conceived pattern. It is here that technological man encounters the insur-mountable obstacle of history. For social life has been created slowly through the contributions of many generations; and it is only upon those contributions that new progress can be built. The dynamics of reform must always respect the traditions of society which safeguard human security without destroying the free and personal action of any part of society. The third part of the Christmas message is the one that most drew the world's attention to the Pope's speech. Thd Holy .Father begins this part by noting that while liberty, per-sonal responsibility, social order, and genuine progress are truly human values, they are in their origin religious and divine values. This religious foundation, however, is today being replaced by economic and political explanations which deny all absolute values. The Holy Father then turns to consider l~ractical ways by which world peace can be achieved. First of all, he says, it is necessary that all men of good will unite together against their common enemy who seeks to impose on all peoples an intolerable form of life. Today's situation, says the Vicar of Christ, is clear to all. There can no longer be any doubts about the purposes and methods that lie behind armed tanks, when.these crash through border frontiers and force a people into a life they abhor. No doubt of purposes, or methods can remain, when possibilities of mediation and negotiation a~e dis-regarded and threats are made to use atomic power for the gaining of specific demands, whether or not these demands are justified. 226- July, 1957 ROMAN DOCUMENTS In the present circumstances it is ~ossible to have the case where, after all efforts to avoid it have been useless, war for the purpose of effective self-defense and with the hope of favorable results cannot be considered as illicit. Hence, if in a case of extreme need a. government chosen by free elections decides on defensive precautions and puts into execution the means necessary for. this, such an action is not immoral; and a Catholic citizen cannot appeal to his own conscience to refuse his services or to fail in the duties assigned by law. The Pontiff then considers the United Nations, the first time that he has spoken of this organization at great length. The United Nations, he remarks, intends to secure absolute values in the co-existence of peoples. Still, the recent past has shown that the false realism of self-interest and power has influ-enced not a few of the members of the United Nations, so that cases of destroying the peace have been treated quite differ-ently. It is reasonable to expect that the authority of the United Nations should be felt, at least through its observers, in all those places where"the essential values of man are in extreme danger. It is desirable that nations who refuse the admission of observers and thereby show that their. concept of national sovereignty threatens the very foundations of the United Na-tions should not be permitted the exercise of their rights as members of that organization. Moreover, the United Nations should have the right and the power to prevent every military intervention of one nation into another and to assume through a sufficient police force the safeguarding of order in a nation so threatened. The Holy Father adds that he refers to these defects only because he wishes to strengthen the authority of the United Nations, for i,t is only through such an organization' that the promise to reduce armaments and to renounce the production and use of certain kinds of weapons can be exchanged between nations ~lnder a strict obligation of international law. Like- 227 R. F. SMITH Review for Religion,s wise, only the United Nations can demand the observance of this obligation by hssuming effective control of the armaments of all nations through a systematic and permanent p'rogram of aerial observation. The Holy Father then adds that the acceptance of such armament control is the crucial point of today; in accepting such control, each nation of the world will manifest the sincerity of its will for peace. Pain, Anesthesia, and the Christian On February 24, 1957 (AAS, pp. 129-47), the Holy Father delivered a long allocution in reply to three questions concerning anesthesia which had been submitted td him by the ninth National Congress of the Italian Society of Anesthesi-ology. After an introduction in which the Holy Father gives an appreciative statement of the importance of the anesthetist in modern surgery and describes the history of anesthesia in ¯ modern times, the Pontiff takes up the first question asked of him: Is there a general moral obligation to refuse anesthetics and to accept physical pain in the spirit of faith? Putting aside the case where a Christian must endure pain rather than offend God, Pius XII points out that there is no obligation to accept all suffering and to refuse the use of anesthesia; for man, even after the fall, has the right to dominate the forces of nature and to use all its resources to avoid or. suppress physical pain. On the other hand, for the Christian, suffering is not some-thing merely negative but is associated with the highest religious and moral values; hence, suffering can be willed and sought for even when there is no moral obligation to do so. Moreover, a Christian is bound to mortify his body and to purify himself interiorly; to the extent that this cannot be achieved without physical pain, to that extent the Christian must accept such pain. Outside of that case, hbwever, it cannot .be said that a Christian has a strict obligation to accept pain. The Vicar of Christ then takes up the question from the viewpoint of Christian perfection: Should a Christian accept 228 ROMAN DOCUMENTS physical pain in order that h~ may not put himself in contradic-tion to the ideal proposed to him by his faith? While it is true, the Holy Father replies, that a Christian experiences the desire to accept and even to seek physical' pain in order to participate the more closely in the Passion of Christ, still it is necessary to interpret this tendency in a correct way. When a Christian, day after day, from mo.rning till night, fulfills the duties of his state in life and of his profession, when he keeps the commandments of God and of men, when he prays, loves his neighbor, accepts without murmuring what God sends him, then his life is surely under the sign of the cross, whether physical suffering be present or not, and whether he endures such suf-fering or avoids it by licit means. The acceptance of physical suffering is only one way, among many, of manifesting what is essential: the will to love and serve God in all things. His Holiness then considers the reasons which permit the avoidance of physical pain. All these reasons, he says, can be reduced to a single general principle: pain prevents the attain-ment of higher goods and interests. Pain may be better for a given person in a given set of circumstances; but, generally speaking, the losses which pain provokes force men to defend themselves against it. A Christian will use pain as a stimulant in his ascent towards God, but the application of this principle will always be a personal matter to be decided by the rules of Christian prudence and with the help of an experienced director of souls. In conclusion~ the Holy Father sums up his. answer to the first question under three headings: (1) Anesthesiology in its fundamental principles is not morally wrong, for it seeks to combat forces which from many points of view produce evil effects and prevent greater goods. (2) The physician who accepts anesthesiology is in contradiction neither with the nat-ural moral order nor with the specifically Christian ideal, for hd is seeking, as God Himself orders in Genesis 1:28, to submit 229 R. F. SMITH Review for Religious pain to the power of man. (3) The patient who wishes to avoid or lessen pain can, without disquiet to his conscience, use the means found by this science. Particular circumstances may im-pose another line of conduct; but the Christian ideal of renuncia-tion does not constitute an obstacle to the use of anesthesia, for that ideal can be fulfilled in other ways. The second question submitted to the Holy Father was this: Is the privation or diminution of consciousness and of the use of mail's higher faculties that is induced by narcotics com-patible with the spirit of the Gospel? In other words, does the example of Christ in abstaining from the wine offered Him before the crucifixion mean that a Christian may not accept total or partial loss of consciousness? The Pope begins by reflecting that a human being is bound to conform his actions to the requirements of the moral order; this, however, can be done only by the use of his higher faculties. This is the reason why there is a moral obli-gation not to deprive oneself of consciousness unless there is a true necessity for such deprivation. Hence, one cannot inter-fere with or suppress consciousness merely for the sake of obtaining pleasant sensations and a certain kind of euphoria. In the case of surgery, the Pontiff points out, what the surgeon primarily wishes to secure is the suppression of painful sensation, not of consciousness. Violent pain can easily provoke involuntary and reflex actions which are capable of producing undesirable complications and even fatal cardiac difficulties. The preservation then of psychic and organic equilibrium constitutes for the surgeon and the patient an important objective which only narcosis can effect. In concluding his reflections on the second question asked him, the Holy Father says that from the action of Christ on Calvary it follows that a 'man ought to accept and drink the chalice of pain whenever God desires it. But it doeg not follow that God desires this whenever and wherever suffering presents 230 July, 1957 ROMAN DOCUMENTS itself to a man. Often the acceptance of guffering is not obliga-tory nor a matter of, perfection. Regularly enough there exist serious motives for easing pain and suffering. J~n such cases one can avoid pain without in any way compromising the doctrine of the Gospel. The third question proposed .to the Vicar of Christ was' composed of two parts: (1) Is the use of narcotics licit in the case of .the dying, supposing that such use is medically indi-cated? . (2) May narcotics be used in cases where the' lessening of pain will probably be accompanied by a shortening of life? In reply the Holy Father asserts fhat neither reason nor rdvelation teaches that the dying, more than others, have a moral obligation to accept pain or to refuse to avoid it. Since, how'ever, pain contributes to the expiation of personal sin and to the acquisition of greater merit, the dying have special motives for accepting pain, because their time of merit is draw-ing to a close. These motives, however, must be understood correctly. Growth in.the lo~¢e of God and abandonment to His will do not proceed from the sufferings which a person accepts, but from the intention of the will supported by grace. In the case of many dying persons this intention can be strengthened if their suffering is lessened, for pain aggravates their physical weakness and hence diminishes their moral strength, while the suppression of pain secures organic and psychic relaxation, facilitates prayer, and makes possible a more generous gift of self. If the dying consent to suffering as a means of expiation and a source of merit, then one should not force anesthesia on them. Nor is it always opportune to suggest to the dying the ascetical considerations of expiation and merit mentiQned above, and it should .always be remembered that pain may even be the occasion of new faults. With regard to depriving a dying person of consciousness, one should recall that Christ died in full consciousndss and that the Church's prayers for the dying presuppose that the dying 231 R. F. SMITH Review for Religious person is conscious. Hence, men should not of their own initiative deprive a dying person of consciousness, unless serious motives for such action are present. A dying person, continues the P~ntiff, may not permit or demand anesthesia if thereby he puts himself in a state where he cannot fulfill g~ave obligations which are incumbent on him, such as the making of a will or of going to confession. If in such cases the dying person dema~ads narcosis for which sound medical reasons are present, a physician should not administer it without first inviting the patient to fulfill his duties. If the sick person refuses to do so and continues to demand narcosis, the physician may administer it without being guilty of formal collaboration in the fault committed by the dying man. But if the dying person has performed all his duties and has received the last sacraments, if there are medical reasons for anesthesia, if the correct doses are given., if the intensity and duration of the anesthesia is carefully watched, and if the patient consents, then anesthesia is morally permissible. As to the licitness of using narcotics which will probably shorten life, the Pope warns that in such cases all direct euthan-asia, that is, the administration of narcotics to provoke or hasten death, is illicit, for such action directly disposes of human life. Bt~t when narcotic.s are administered only to avoid intolerable pain for the patient, th~ administration of narcosis is licit if it produces two distinct effects: the cessation of pain on the one hand and on the other the shortening of life. However, there must also be a reasonable proportion between the two effects and it should be ascertained if means other than the depriving of consciousness could achieve the desired result. The Holy Father concludes his allocution by recalling to the minds of his" listeners the infinitely higher and more beau-tiful life to which man is called and which i~ perceptible even here below in those into whom Christ pours His" redemptive 232 Jldy, 1957 ROMAN. DOCUMENTS love, which alone definitively triumphs over both suffering and death. Miscellaneous Matters On February 1, 1957 (AAS," pp. 91-95), the Sacred Con-gregation of Rites issued a decree introducing a number of modifications into the rites of Holy Week as. set forth in a pre-ceding decree of November 16, 1955. Several documents of early 1957 dealt with saints or with processes of canonization. By an apostolic letter (AAS, pp. 61-62) the Roman Pontiff designated the sainted martyrs Clau-dius, Nicostratus, Symphorianus, Castorius, and Simplicius the special patrons of all stone and marble workers. On January 22, 1957 (AAS, pp. 169-71), the Sacred Congregation of Rites approved the two miracles necessary for the beatification of the Venerable Servant of God Mire Marie de la Providence, foundress of the Helpersof the Holy Souls (1825-71). The same congregation (AAS, pp. 40-42; 82-85; 85-87; 88-90) also approved the introduction of the causes of the following servants of God: Mary Lichtenegger (1906-23); Stephen of Adoain, priest and professed Capuchin (1808-80); Sister Frances of the Wounds of Jesus (1860-99); and Joseph Mafianet y Vires, priest and founder of the Sons of the Holy Family and of the Daughters of the Holy Family of Nazareth (1833-1901). On January 13, 1957 (AAS, pp. 43-44) the Sacred Peni-tentiary attached an indulgence of a thousand days to a prayer for C.hristian families composed by the Holy Father on the feast of Christ the King, October 31, 1954. On February 9, 1957 (AAS, pp. 100-101), an indulgence was attached to the recita-tion of the prayer of the Holy Father for religious vocations; the text of the prayer and the details of the indulgence were given in the May, 1957, issue of REVIE~V FOR RELIGIOUS (p. 165). Several shorter addresses of the Holy Father were published in AAS during the first three months .of 1957. Speaking on 233 R. F. SMITH Review for Religious December 16, 1956 (AAS, pp. 68-72), to the second Eucha-ristic Congress of Bolivia, Plus XII said that the Eucharist is the principal means of knowing Jesus Christ, of penetrating oneself with the greatness of His mission, and of feeling the impulse to continue that mission through the priesthood. In a written message to the third general assembly of the Internal tional Federation of Catholic Youth the Pope urged the group to grow in love and' respect for the Church and to deepen their spiritual lives as the necesshry condition for any fruitful apostolate. When he spoke to the council of the International Federation of Catholic Men, the Vicar of Christ pointed out to them that the visible unity of Christians intensely living their faith is in itself a massive apostolate and a vast testimony that obliges all men of good will to salutary reflection. The Holy Father took the occasion of the Italian Mother's Day (AAS, pp. 72-76) to speak on the duty of all adults to secure for all children the possibility of a full physical and moral development. The Association of Catholic Teachers of Bavaria was told by the Pope (AAS, pp. 63-65) that it is against one of the fundamental human rights to force parents to confide their children to a school whose ~eachers are indifferent or even hostile to the religious convictions of the home. In an address to a group of teachers and students from the newly formed Catholic University in Mexico, the Holy Father remarked that their institution was to be a true Catholic University, dedicated to the training of well-educated and outstanding sons of the Church who can constitute the leaders of their country. Five documents issuing from the Sacred Congregation of Seminaries and Universities (AAS, pp. 95-96; 97; 97-98; 172- 73; 173-74) give continued evidence of the growth of intel-lectual activity in the Church. The documents provided for the canonical establishment of the following: a higher institute of pedagogy in the faculty of philosophy of the Pontifical Salesian Athenaeum; a philosophical institute in the faculty of 234 July, 1957 ROMAN DOCUMENTS theology of Angers; a faculty of philosophy in the Pontifical University of Salamanca; a second Catholic University in Brazil; and a faculty of medicine in the Catholic University of Peru. o A set of questions was published (AAS, pp. 150~63) for the use of military vicars in making their triennial reports to the Sacred Congregation of the Consistory. A decree and a set of norms were issued (AAS, pp. 163-69) for the establish-ingo of ecclesiastical tribunals in the Philippine Islands to deal with matrimonial cases of nullity. On January 21, 1957 (AAS, p. 77), the Holy Office answered in the affirmative the ques-tion whether affinity, contracted before baptism, is an impedi-ment for marriages entered upon after the baptism of only one of the parties. The Holy Office (AAS, p. 34) also warned ordinaries and clergy that the Institute of the Apostles of the Infinite Love and the institute Magnificat are not recognized by the Church and are forbidden to the faithful. Norms for the abso-lution of secular "and regular priests in Hungary whose nom-inations to ecclesiastical offices and benefices were not in accord-ance with canon law were published by the Sacred Congregation of the Council (AAS, pp. 38-39). Finally, .the Holy Office by a decree of January 30, 1957 (AAS, pp. 77-78), placed on the Index of Forbidden Books the two following works of Miguel de Unamuno: Del senti~niento trelgico de la vida and La agonia del Cristianisrno, at the same time warning the faithful that other books of the same author contain a a number of matters contrary to faith and morals. (Both of the books mentioned above have been translated into English under the following titles: The Tragic Sense of Life [New York: Dover, 1954]; and The Agony of Christianity [New York: Brewer, 1928]). With this the survey of AAS for January through March of 1957 is concluded; succeeding articles will continue the survey with later issues of AAS. 235 AIIocufion Concerning TerfiansFfip Pope Pius XII Introductory Note According to the the plan of St. Ignatius .Loyola for the training of his sons for the priesthood, there is a short introductory stage called the first probation in which the candidate becomes acquainted with the religious life and superiors with him. Following this intro-duction is the regular novitiate which, together with the first proba-tion, is to l~ist at least two full years and which is also called the second probation. Next come the long years of study and work in the juniorate, philosophy, regency or teaching, aad theology. St. Ignatius realized that such a course could and often would cool the fervor of the novitiate and dim the-spiritual vision of his sons. Consequently, he piescribed at the end of the whole course of forma-tion another period of spiritual discipline which was to last a tea-month year and is called the third probation or, more commonly, the tertianship. During this year the fervor of the earlier years is rekindled and the appreciation of and-attachment to the Society olc Jesus deepened by an intense study of the constitutions. In rather recent years a number of other religious communi-ties have introduced a tertianship period of varying lengths of time. Some other communities are considering whether to require a tertianship of their members. Fr., Larraona of the Sacred Con-gregation for Religious has said that "Rome views with favor the so-called 'third year of probation' " because it "has incalculabl~ advantages" but it "is not in any way imposed by the Sacred Con-gregation" (gEvIEw FOP. RELIGIOUS, November, 1954, 302). In an allocution to the Jesuit instructors (masters) of tertians, March 25, 1956 (AAS) 48(1956)269-72), Pope Pius XII dwells on the purpose and program of a tertianship and the importance and in-fluence of the instructor on his tertians. Moreover, he ~rges the preservation of the tertianship against those who propose arguments against it which reflect a spirit which on at least two other occasions he has labelled the "heresy of action" (cf. apostolic letter on the centenary of the Apostleship of Prayer, June 16, 1944~English ver- 236 AL.LOCUTION ~ONCERNING TERTIANSHIP sion in the Messenger o/ the Sacred Heart, 79(Dec.,1944) 13; exhorta-tion on the priesthood, Menti Nostrae, Sept. 23, 1950, paragraph 60). Because it was thought that the Holy Father's allocution on the ter-tianship would be ot: interest to those already requiring a tertianship as well as to those considering whether to have one, the following translation is given.--James I. O'Connor, s.J. The Allocution Beloved sons now present before Us, members of the curia of the Society of Jesus, and you, especially, instructors of the third probation, summoned to Rome by the very wise zeal of your Father General, who is very dear to Us, We know that your request is so reasonable and restrained that it would suffice for you to receive from Us the apostolic blessing in a public audience. And yet, although pressed at the present time with so great a host of occupations and cares, We still wish to go aside for a little while with you so that opening Our paternal heart, We may give testimony of Our singular good will to your whole illustrious order and especially to you, instructors, to whom has been committed an office requiring great understand-ing and' prudence. You certainly are a most select section of tl~e Society of Jesus, especially since you have been chosen and numbered among those of your members having special authority: "those who possess authority" (cf. Epit. Inst., S.J., p. V, cap. II, n. 340). For you discharge an office of the greatest importance since it pertains to that class of matters which your institute lists as "substantials of the second order" (Ibid., Proem., tit. V, n. 22). That it should be so is very easy~to understand. For this is the highest and final touch to the work and labor extended over a long period of time in forming souls in the ways of religion and piety. If We may so speak, this is another way whereby the spear is returned to the forge before it is used in apostolic warfare. It is during this interval that the young person is exercised in the "school of affection" to develop thor-oughly the special gifts of his soul. Finally, then, he is urged 237 Pxus XII Review for Religious on to very arduous undertakings, namely, to "a greater abne-gation of himself and, as 'far as possible, to continual mortifica-tion in all things" (Exam., cap. IV, n. [1031, p. 59), so that "when they have advanced in these, they mhy the better help on other souls to perfection to the glory of God and our Lord" (Const. cure Dec/ar., p. V, cap. II, n. I). I. This was your 'founder's ingenious and sagacious pur-pose which has been continuously reduced to practice with great progress in the religious life and which was later more and more accepted and imitated by other institutes.as well. Nevertheless, because four centuries have elapsed since this plan dawned upon his mind and was brought into effect, it can happen that to some people of our time it appears less fitting for various rea-sons, e.g., because people of today are prone to act more promptly and hastily or because the needs of the 'apostolate are more demanding than in times past. Ours is the completely opposite opinion, for the great need of our time is an interior religious life distinguished by constancy, soundness, and strength, most especially because the service and good of souls demand better-trained apostles. As a result, the period of tertianship should be considered really sacred, divinely inspired, and fully and justly worthy of every effort to preserve it. For this reason We exhort you to see to it that, when the course of studies has been completed, each and every one without any exception be given this whole year devoted to intense meditation in houses set aside for this purpose, in which, as far as possible, the tests and probations of the novitiate be again undergone and the prescriptions and rules observed to the letter. II. Nevertheless, in the whole ascetical training of the ter-tianship We desire that you direct singular care to the matter of special importance, namely, that you devote mind and effort to obtaining a thorough kr~owledge of your institute and to im-bibing the spirit with which it is imbued (Epit., p. V, c. III, n. 435). Moreover, the very resplendent character of this form 238 July, 1957 ALLOCUTION CONCERNING TERTIANSHIP of religious life is manifest in the golden book of the Spiritual Exercises which time and again We have highly praised. See to it that. your tertians more and more understand, search into, relish, esteem, and love everything contained in those pages: the notes, additional directions, meditations, contemplations, rules. In each matter let them carefully discern what is the underlying reason, its aim, and why it is found in this or that place. Exercise vigilant care that, when the tertianship is com-pleted, they are thoroughly convinced that the Ignatian way and plan must be fully preserved and that nothing which clearly per-tains to its nature is ever to be removed from it. This observ-ance and reverence Will have this special effect, that such prudent safeguards will continue their effectiveness in accomplishing won-ders as they have done in the past, provided, of course, there is no let-up by an inconstant will or a breakdown of moral fibre. III. Finally, dearly beloved instructors,.spare no labor, spare no effort, strive earnestly and pour out prayers to God that what is especially sought in this important period may have a most favorable outcome. For young religious, after they have been set free from. so many years of study, easily fall into the danger of neglecting spiritual matters or of holding them in little esteem because the fires enkindled earlier die down. But if they betake themselves again into the solitude of this retreat and give them-selves over to voluntary bodily chastisement, they not only will regain their early moral strength but will also acquire new strength, increased and steadfast, which will serve them profitably ~ven in the subsequent years of their life. Great will be their incen-tive to the study of devout prayer, to the austerity of life and the restraint of the senses which, with eyes full of wonderment, they behold in you. Your. words, at once a source of light and of fire, will illumine their minds and impart to their souls the sparks of divine flame. For their journey along safe paths you will be guides, clearly and conspicuously prudent, safe and trustworthy, keeping them by warning and exhortation from running after 239 P~us XII doctrines which pertain to Catholic dogma, morality, asceticism, and sociology but which by their alluring novel ideas show a certain false and insidious nature. By means of your characteristic active charity and your lov-able zeal you will discover how to ward off tedium, if it should arise, from your fellow-members, returned from a freer form of life, and how to curb what may be immoderate apostolic ardor in those who now experience in caring for the salvation of souls the sweet consolations of heavenly grace. It seemed to Us fitting to address to you in this audience these words, few and hasty because of the limitations of time. From all parts of the world you have assembled here and soon, when your meetings have come to an end, you will return, .each to his own province. Take with you the special apostolic bless-ing We lovingly impart to you in the present auspicious year in which with public joy you observe the solemn celebration of the glorious passing of your lawgiver and father. 'And let this be the outstanding fruit of this celebration that the spirit by which you are called by God fo lay hold on the religious life may more and more breathe upon you in greater intensity and ardor. How-ever, these desirable and magnificent gains will deriye their most providential increase from you especially, instructors, and your activity. Finally, may God, the bestower of gifts, bless all of you and each of your tertians. May He bless and bestow plenteous heavenly solace on your most praiseworthy Father General; on the members associated with him in the curia as well as on the whole Society of Jesus to which We are bound by ever sweeter and closer bonds of paternal charity and high esteem. OUR CONTRIBUTORS SfSTER MARY ST. ROSE teaches at Summit Country Day School, 2161 Grandin Road, Cincinnati 8, Ohio. HAROLD F. COHEN is studying at the Colegio Maximo de San Francisco Javier, Ofia (Burgos), Spain. JOSEPH F. GALLEN is profes~sor of canon law at Woodstock College, Woodstock, Maryland. R. F. SMITH is a member of the faculty of St; Mary's College, St. Marys, Kansas. JAMES I. O'CON-NOR is professor of .canon law at West Baden College,. West Baden Springs, Indiana. 240 t oo1 Reviews [Material for this department should be sent to Book Review Editor, REVIEW FOR RELIGIOUS, West Baden College, West Baden Springs, Indiana.] FAITH AND PREJUDICE AND OTHER UNPUBLISHED SER-MONS OF CARDINAL NEWMAN. Edited by the Birmingham Oratory. Pp. 128. Sheed and Ward, New York 3, New ~York. 1956. $2.50. Faith and Prejudice is a short book containing some hitherto unpublished sermons of Cardinal Newman. It is only the third volume to be published of the sermons Newman preached as a Catholic, and it follows the first two after a gap of seventy~ years. The first seven sermons of the book were preached in the year 1848, three years after Newman joined the Catholic Church. Their style has much of the beautiful simplicity noted ia Newman's youth. The Sunday gospel is the subject matter of these sermons. They are addressed to the congregations of an ordiaary city parish. New-man is especially adept at taking a single thought and dwelling on it with warmth and unction. In the first sermon, for example, his thought could 13e crystallized into the sentence: The omnipotence of God is the reason for our faith and hope. Yet Newman takes this somewhat'cold statement ot: fact, so clothes it in familiar examples from the life of Christ, that it becomes no longer a mere theological thesis but rather a living person asking, "Why, then, are you fearful?" For a man of such tremendous learning Newman shows a remark-able ability to understand the circumstances of everyday life in which his hearers had to live out their Catholicism. His application of theory is both concrete and practical. Thus, in a sermon preached on tl~e first Sunday ofLent, 1848, he points out the need for. the modern age to find its penance in a mortification of the reason and the will. His application of this idea to curiosity is perhaps even more perti-nent to our own day, one hundred years and more after Newman spoke these words: "What a deal of time is lost, to say nothing else, in this day by curiosity, about things which in no ways concern us. I am not speaking' against interest in the news of the day altogether, for' the course of the world must ever be interesting to a Christian from its bearing upon the fortunes of the Church, but I speak of vain curios- 241 BOOK REVIEWS Review for Religious ity, love of sc~indal,, love of idle tales, curious prying into the private histo# of people, curibsity about trials and offences, and personal matters, nay often what is much worse than this, curiosity into sin. What strange diseased curiosity is sometimes felt about the history of murders and the malefactors themselves! Worse still, it is shock-ing to say, but there is so much evil curiosity to know about deeds of darkness, of which the Apostle' says that it is shameful to speak. ¯ . . Hen'ce this is the way in which we are called upon, with this Lent we now begin, to mortify ourselves[ Let u's mortify our curiosity" (p. 71). Perhaps the most interesting sermon is that preached in 1873 at the opening of a diocesan seminary. The growth of unbelief is the subject, and it must have had a powerful impact on Newman. With a keen eye for what the future would bring, he shows the difficulties which the weakening of Protestantism entails for the Catholic Church. It weakens or removes a common ally in the battle against those God-less men who would destroy Christianity. The preacher also recog-nizes what problems would arise from the growing strength of the Catholic Church in a Protestant country, problems of suspicion, fear, and prejudice. He exhorts the semin'arians to the practice of the presence of God as a powerful means of overcoming an age of un-belief. To this they must add a sound, accurate, complete knowledge of Catholic theology; with these weapons the future priests will be strong for the combat. As a whole; these sermons reflect Newman's confidence in prayer and faith and obedience more than do his university sermons which are pitched on a higher intellectual plane~ The present volume is. a welcome addition to Newman's published works. It is a book whose true worth will only be fully appreciated after repeated thoughtful reading. --J. DOtC~,LD" H,~YES,. S.J. PRINCIPLES OF SACRAMENTAL THEOLOGY. By Bernard Leeming~ S.J. Pp, 690. The Newman Press, Westminster, Mary-land. 1956. $6.75. Father Leeming's book, a treatise on the sacraments in ~general, is written for everyone~whether expert theologian, teacher of religion, or competent layman--who is interested in theology for its own. sake. The author, a vetera'n professor of dogmatic theology /it Heythrop College,. England, has made every effort to be scientific ~iithout being 242 July, 1957 BOOK REVIEWS too technical for the non-theologian. He has spared no pains to facilitate the work of the reader. A detailed table of contents is presented at the outset; the volume is equipped with an impressive index in which each entry carries a symbol to signify the type of reference made; there is a thirty-page bibliography of general titles and of titles, pertinent .to each of the six general sections of the book. These general sections are entitled: The Sacraments and Grace; The Sacraments and the Character; Sacramental Causality; The Institution of the Sacraments; The Sacramental Economy. The sections are further divided into chapters, and the substance of most chapters is presented in a ~oncise "Principle" which summarizes the doctrine defended. These principles are stated and 'defended as regards the sacraments in general, Above all, Father Leeming's treatment is distinguished by its clarity; that is, matters of faith upon.which there can be no possibility of debate are cldarly stated and clearly differentiated from matters in which free discussion is allowed, and the vie.wpoints which Father Leeming defends as more p_robable are presented with notification of the precise value of the opinion proposed. Father Leeming's method is traditional, yet modern. He at-tempts to combine the scholastic method (sketching the whole history of thd question and the various opinions proposed, presenting the declarations of the .Church, stating a thesis and advancing reasons for it, and answering objections) with a modern, critico-historical ap-proach. The treatment is therefore complete; that is~ the author attempts to treat all pertinent questions, and to present all pertinent evidence --from scriptural and patristic sources, from the councils of the Church, and from the writings of orthodox and" heterodox scholars, andient and modern--in full translation, critically presented and care-fully annotated. The exhaustive historical analyses do not leave the impression that the book ig merely reportorial. Though the research is encyclo-pedic and ~scholarly; the author's oi'iginal handling of the anaterial is equally appealing. Father Leeming is of. the opinion that the key to the meaning of the sacraments is found in their connection with the Mystical Body of Christ; and in the section dealing with sacra-mental causality, he develops the :notion that "the effect of the sacraments . . . is to make those, who through them communicate 243 BOOK REVIEWS Review for Religious with Christ, special cells in the organism of His body." In developing this statement, he suggests a reformulation of the definition of a sacra-ment: "an effective sign of a particular form of union ~vith the Mystical Body, the Church, instituted by Jesus Chiist, which gives grace t'o those who receive it rightly." This viewpoint is also the key to the unity of the book itself, for it is applied to each of the sacraments, it is developed in the areas in which theological discussion is permitted, and it pervades the interpretation of the official sacramental doctrines of the Church. --JAMES J. DAGENAIs,°S.J. THE MASS IN TRANSITION. By Gerald Ellard, S.J. Pp. 387. The Bruce Publishing Company, Milwaukee 1, Wisconsin. 1956. $6.00. The value of this book is that it is not limited to a presentation of the author's personal views on liturgical reform. Because of its liberal use of official and semi-official documents bearing on liturgical modifications, Father Ellard's present contribution is dispassionfite and to a high degree objective. As a result, one reads with a sense of security that more rhetorical but less solid works on the subject fail to convey. This is not to say that Father Ellard frowns on liturgical reform or that he is indifferent to it. His stated purpos~e in taking what must have been considerable pains to assemble selections from the two hundred or so documents upon which his observations are based is to advance "toward maturity and toward clarity" current ideas on the modification of the Mass. The theme that runs through mist of the book is taken from the ll.ledialor Dei of Pope Pius XII: that the worship of the Eucharist should be the fountain-head of genuine Christian devotion. The various chapters are concerned with the aspects of liturgical modifica-tion that tend to promote this goal. With a short history of de-velopment in the Mass from apostolic times as a background, the succeeding chapters discuss the efforts made, the results achieved, and the difficulties encountered by the Holy See and by lesser interested groups in promoting lay participation in the Eucharistic Sacrifice. chapter each is devoted to the reform of the Breviary and to the recent tendency of many non-Catholic sects to ~lpproach closer to the Catholic form of worship. 244 July, 1957 BOOK REVIEWS While the extensive use 0f documents does not always make for easy .reading, their very bulk and wide range produce an effect that more than justifies the reader's efforts. Through them one experi-ences the tremendous energy which in the past fifty years has set the liturgical reform in motion; and he is assured that this energy and determination, especially as found in the Holy See and the hierarchy, will succeed in fully restoring the Mass to the people in spite of all the difficulties involved. For the reader with a more professional interest in the liturgy Father Ellard's book gathers into one place a rich collection of up-to-date source material. --PAUL F. CONEY, THE SALVATION OF THE UNBELIEVER." By Riccardo Lombardi, S.J. Translated by Dorothy M. White. Pp. 376. The Newman Press, Westminster, Maryland. 1956. $5.00. Father Lombardi's crusading zeal for "a better world" in accord-ance with the social teachings of the papal encyclicals has occasioned much favorable comment in the Catholic press as well as in non- Catholic news journals like Time magazine. His work as professor of ~heology deserves equally favorable comment, and the proof of this is this volume. The book ig written' for all who are Catholic eno~agh to realize that being Catholic means being apostolic and who are educated enough to follow a skillful teacher through 362 pages of reasoning that is pleasingly adorned with quotations from Scrip-ture, St. Thomas Aquinas, Dante, and papal encyclicals. Specifically, this important volume is for high school or higher units of the Catho-lic Students' Mission Crusade, missionary congregations of religious, and for all Catholics who work or pray especially for our non-Catholic contemporaries, the seventeen million Jews, three hundred and twenty million heretics and schismatics, eleven hundred millior~ heathen or unbelievers in the Judaeo-Christian revelation. Father Lombardi studies honestfy and feelingly and with great charity the chances for salvation for this vast multitude as well for the about fifty billion (Ct6ca~/o Tribune, Nov. 25, 1955) human beings who have so far been inhabitants of this earth. On the one hand, by far the majority of this enormous number are not counted in the "little flock" of Christ. On the other hand are the clear words of Holy Scripture, "God our Savior . . . wishes all men to be saved" (I Tim. 2:3, 4). "But my just one lives by faith" (Heb. 10:38). "Without faith it is. impossible to please God. For. he who comes to God must believe thht God exists and is rewarder to those who 245 BOOK ANNOUNCEMENTS Review for Religio'us seek him" (Heb. 11:6). Father Lombardi's study of the problem presented to us by these words and by the all but infinite multitude of unbelievers is consoling to our hope, convincing to our reason, arousing to our zeal. The volume would have profitted by a study of Hinduism in at least as much detail as the author gives to the three other very widespread but very much less intellectually organi~zed non-Christian religions which he studies specifically, Confucianism, BuddhiSm,' Islam~ Hinduism's pre-Homeric Vedas and pre-Socratic Upanishads are re-markable (and vastly voluminousI records of the anitna humana naturaliter Ghristiana.in its quest for God.' The prayer of the: Brihad Aranyaka Upanishad (1, 3, 28), '.'From untruth lead me to truth, from darkness lead me'to light, from death lead me to immortali:y!" is perhaps the greatest prayer outside.the sacred world of the Judaeo- Christian revelation, yet so "naturally Christian" is~ the prayer that it might well have been written by Cardinal Newman in his Anglican d.ays as a note to his Anglican hymn "Le.ad, Kindly Light!" If Father Lombardi issues a ndw edition of his volume, the writings which B.dlgi~n Jesuit scholar missioharies Johanns a~nd Dandoy have published on Hinduism can help l~im show his readers still more reason for l~ope .and for zeal than even this admirable edition does. ---' PAUL DENT, S.J. BOOK ANNOUNCE~AENTS THE BRUCE PUBLISHING CO., 400 N. Broadway, Milwaukee 1, Wiscoiisin. Mother of Fair Love. By Augustine Schroe~ler. Translated by Veronica Kir~land. The medium that the author of this latest life of the Blessed Virgin has chosen ~is the psychological novel. It is a happy choice for it enables her to paint a very vivid picture of our Lady. The book is carefully written anduses tO the full all that scholarship' in various fields has to offer one who would .paint a true-to-life poi'trait of God's most favored creature. Pp. 195. $3.50. An Introduction to' Philosophy. By Daniel J. Suliivan.To master the fundamentals of any subject is usually quite difficult. This is especially true of philosophy and particularly so for those who 246 July, 1957 "~OOK ANNOUNCEMENTS have no scientific background. This book was written with such im dividuals in mind. You will find in it a history of philosophy and a clear exposition of the problems that philosophy labors to solve. The book was the March selection of the Thomas More Book Club. Pp. 288. $3.75. The Catholic Priest in the Modern World, by James A. M~gner, is a very careful analysis of the many problems which 'the priest, and particularly the pastor of a parish, must solve. Pastors, ctirates, and seminarians who read the book will find th;~ time spent on it well spent. There is an adequate index. Pp. 286~ $4.75. Ho!y Week Manual for Servers. By Revo Waiter J. Schmitz, S,S. A copy of this book in the hands of each server should do much to add to the dignity and smooth performance of the compli, cared Holy Week services. Pp. 60. $0.50. Fundamental Marriage Counseling. A Catholic Viewpoint. By John R. Cavanagh, M.D. This is a very complete book on all aspects of marriage counseling and the many problems the counselor has to solve. There are 531 'pages of text, a bibliography of 31 pages, an 8 page glossaryl and a 25 page index. $&00. FIDES PUBLISHERS, 7~44 E. 79th St., Chicago 19, ~llinois. In Father of the Family, by Eugene S. Geissler, we have a con-tribution to sociology. The author, himself the father of ten, writes about the family from the father's point of view interestingly and seriously. The book is recommended ~eading for fathers and mothers of families both actual and prospective. Pp. 157. $2.95. FORDHAM UNIVERSITY PRESS, New York 58, New York. ; Spiritual and Intellectual Elements in the Formation of Sistei~s. Edited by Sister Ritamary, C.H.M. This is the second volume which has grown out of the six regional meetings of the Sister Formation Conference, 1955-56, The first volume bore the" title-The Mind of the Church in the Formation of Sisters and was reviewed in these pages in September, 1956 (pp. 273-74). Part I of the present volume deals with the viewpoin~ of keynote speakers and priest panelists 6n tl'ie spiritual and intellectual elements in the formationof sisters; Part II considers the viewpoint of religious sisters themselves; Part III summarizes replies and comments to questionnaires, while Part.IV deals with communications and commentaries. The reader is im-pressed by the energy and zeal with which the sisters themselves have 247 BOOK ANNOUNCEMENTS Review for Religious attacked their problems¯ Such zeal and energy cannot but lead to a happy solution. Pp. 261. $3.00. GRAIL PUBLICATIONS, St. Meinrad, Indiana. Pope Pius XII and Theological Studies. Edited by A. Yzermans. In addition to the encyclical letter //umani Generis, there are five addresses of the reigning Holy Father and an introductory essay on "Pius XII and TheologiCal Novelty" by the editor. Pp. 100. $0.50. THE NEWMAN PRESS, Westminister, Maryland. Methods of Mental Prayer. By Cardinal Lercaro. Translated by T. F. Lindsay. As the title indicates, this book is concerned exclusively with methods of mental prayer. It presents all of the better-known methods and does so objectively. The important thing in mental prayer is, of course, prayer; the method is secondary, yet still important. For if a method does not help you to pray, that method is not for you. You should choose another. With the aid of this .book the choice of a different method becomes easy since so many are listed and described in detail. The book, however, is not recommended for indiscriminate reading by novices, who might easily become confused and overwhelmed by the wealth of material offered. It should prove very helpful to the mature religious and to priests. Pp. 308. $5.75. The Gospel to Every Creature. By Bishop Leon-Joseph Suenens. Translated by' Louise Gavan Duffy. Catholics admire the missionary spirit which sends individuals to the ends of the earth to save souls. Many of them, however, do not realize that they too must be mis-sionaries even though they cannot travel to fields afar;~ tha't they too must labor to bring others to their true home in the Catholic Church. You will find a complete discussion of the missionary vocation as it applies to every individual in the pages of this book. Pp. 163. $3.00. The Angels and Their Mission According to the Fathers of tl~e Church. By Jean Danielou, S.J. Translated by. David Heimann. Devotion to the angels is traditional for Catholics, and for the ma-jority a reality, at least so we hope. It would help if Catholics were reminded more frequently of the role angels play in their lives. They are not so reminded by the books in English that they read. I know oi: only one, and that one was published more than thirty years ago. So the present volume is surely timely and will help to fill a great need. Pp, 118. $2.75. 248 July, 1957 BOOK ANNOUI~CEMENTS Christ, Our Lady and the Church. A Study in Eirenic Theology. By Yves M-J. Congar, O.P. Translated by Henry St. John, O.P. Eirenic theology may be described as that branch of. theology which endeavors to bring back to the unity of one faith our Protestant neighbors. It does so by finding the common ground we share with them, ana!ysing the divergences, and pointing out errors and mis-placed emphasis wherever it may exist. Since the greatest divergence between our Protestant brethren and the Church concerns precisely the Catholic doctrine on the nature of the Church and the place of our Lady in it, this book deals with these topics. Pp. 103. $2.75. Problems in Theology. Vol. I. The Sacraments. By John McCarthy, D.D., D.C.L. This book is a compilation of material that appeared in the section "Notes and Queries" of The Irish Ecclesiastical Record during the past fifteen years. The author and publishers promise a second volume to deal with principles and precepts. There is no index. Pp. 433. $6.75. Problems in Canon Law. By William Conway, D.D., D.C.L. In this volume Father Conway, who has long answered the canonical difficulties of the readers of 7'he Irish Ecclesiastical Record, has col-lected and classified a great many of the practical problems he has received. The publishers announce that this is the first volume of a new series on practical problems in theology and canon law. There is an eight page index. Pp. 345. $5.50. REVIEWOF CATHOLIC CHURCH MUSIC The appearance of a new Catholic periodical is always noteworthy, especially of one devoted to music. The Caecilia appearing in Feb-ruary, 1957, is marked "Volume 85, Number 1"; 13ut it is the first issue of the venerable magazine under the new management of the Society of St. Caecilia, recently revitalized through the efforts of Reverend Francis Schmitt. Father Schmitt has achieved a noteworthy place in the ranks of American Catholic church musicians through his inspiring work with the Boystown choir, with his annual choirmasters' workshop, and now, with the restoration of the Caecilian Society. The "new" Caecilia appears as a quartqrly review devoted to the liturgical music apostolate. Besides editor Schmitt and "editor emeri-tus" Dom Ermin Vitry, O.S.B., the con.tr~butmg editors include: Theodore Marier, Reverend Richard Schule~, James Welch, Reverend Francis Brunner, C.Ss.R., Paul Koch, and R~verend Francis Guentner, S.J. Under such management the journal gives promise of outspoken but scholarly criticism as well as appreciation of current efforts in liturgical music. The address is: Box 1012, Omaha I, Nebraska. 249 Ques!:ions and Answers [The following answers are given by Father Joseph F. Gallen, S.J., professor of canon law. at Woodstock College, Woodstock, Maryland.] --19-- What bows does the priest make at Benediction of the Moit Blessed Sacrament? The priest makes a moderate.bow of the body before rising to put in incense(S. R. C., 4179, 6) and at Veneremur cern'ui and a pro-found bow of the head immediately before and after incensing (S. R. C., 3086, 3) and at Oremus. A moderate bow of the body is a bow of the head accompanied by a slight inclination of the shoulders (S. R. C., 4179, 1). A profound bow of the body is never made while kneel-ing. Cf. J. O'Connell, Benedictionale, 4-5; The Celebration' of Ma~s, 298; De Amicis, Caeremoniale Parochorum, 79-80. 20 Has a religious who has been excluded from renovation of tem-porary vows or from making perpetual profession the right of sus-pensive recourse to the Holy See against the exclusion? No. The contrary impression arises from a confusion of exclia-sion with dismissal. The two are not the same. A dismissal in canon law is verified only by an expulsion during the time of the vows; an exclusion is an expulsion at the expiration of the vows. It is also merely the refusal of admission to a further profession. Therefore, the canonical prescriptions on dismissal do n
Issue 25.2 of the Review for Religious, 1966. ; Sanctification through Obedience by Charles A. Scldeck, C.S.C. 161 Decree on the Eastern Catholic Church~ by Vatican Council II 235 The Church's Holiness and Religious Life by Gustave Martelet, ~q.J. 246 Division of a Province by Albert A, Reed, C.PP.S. 269 The Young Religious and His Poverty by William M. Barbieri, S.J. 288 Religious Rule and Psychological Development by John W. Stafford, G.S.V. 294 Obedience and Subsidiarity by Kevin D. O'Rourke, O.P. 305 Religious Censorship of Private Communications by James Gaffney, S.J. 314 Survey of Roman Documents 320 Views, News, Previews 324 Questions and Answers 330 o Book Reviews 335 CHARLES A. SCHLECK, C.S.C. Sanctification through bedi en ce In the mind of the early Christians the practice of obedience was always considered as somehow or other essential, as necessarily included in their response to God's prevenient redeeming love. A study of the New Testament would reveal that obedience was seen as col-lective; it was an obedience that centered around the submission of the Ghurch to Christ. The members' of the Church, the earthly body of the glorified Christ, were on a voyage during which they were called upon to obey their guide, Christ speaking to them especially through the authorities he had established in the Church.x They considered themselves to be under the authority of the new commandment of charity, such that the accomplish-ment of this commandment included the accomplish-ment of all the others.~ They saw the primary exemplar of their life of Christian obedience in the person of Christ Himself. Every work of His life, all His life, is an ¯ act of obedience to the will of His Father.8 Since they considered that all authority came from God4 they were to obey not merely out of fear but from conscience or for the Lord,~ unless this authority attempted to abuse the power that had been given it. Slaves were to obey their masters,~ wives their husbands,7 children their parentsS; yet all were to love Christ even more. In short, according to the New Testament, any life that was truly Christian had to be filled and impreg-nated with obedience of one sort or another, obedience to God, to Christ, to the Church, to the state, to parents, 1 Heb 13:7. ~ Gal 5:14. SLk 22:42; Jn 17:4; Phil 2:8; Rom 5:19; Mt 9:13; 26:52. '.Mr 22:15 ft.; Rom 13:5. Sl Pt 2:13 ft. e Eph 6:5; Col 8:22. ~ 1 Cot 11:3 ft. SEph 6:1; Col 3:20. Father Charles A. Schleck, C.S.C., is a faculty member of Holy Cross Col-lege; 4001 Hare-wood Road N.E.; Washington,. D.C. 10017. VOLUME 25, 1966 161 + + + c. A. $chleck, C.S.C. REVIEW FOR RELIGIOUS to a husband, and so forth. Its characteristic mark was that it be shown to any.of these as to the Lord. It was this which g.ave concrete expressions of obedience their unity. From this it would seem that the entire Christian life in its ensemble was considered to be obedience. For everything in it was thought of as an implicit or formal accomplishment of the divine authoritative will speak-ing through the various organs capable of its revela-tion. The application of obedience for the early Chris-tians, if we are to judge from New Testament writings, was as vast as was the field of charity. In fact any and all obedience was considered as being the fulfillment o? charity in its diverse forms. Once an action was seen as necessary for the life of charity and recognized as such by the moral conscience, it became an obligation in virtue of the obligatory character of the precept of charity.9 It was seen not merely in the light of what we would call the virtue of justice but rather in the light of charity, and as such entered into the theologal life o( the Christian. It was a vital human activity of which God Himself was the object and the motive, and in the perfecting of which God was coactive. It was the life of grace in faith, hope, and love, and as such brought about a personal relationship with God.1° On the other side of the coin, those who were called to exercise authority in the Church were to do so as a service to the community, and this in imitation of the Lord who came not to be served but rather to serve,xl The disciples were chosen by Christ and sent to the children of Israel first and then to all the nations12 so that as sharers in His power they might make all peoples His members by sanctifying them and governing themAz They were given the task of ministering to it always under the guidance of the Lord and of guiding it or di-recting it all days even to the consummation of the world.~4 They were called upon to take up the service of the community, presiding in place of God over the community as shepherds of the flock of Christ; whoever listened to them listened to Christ; and whoever re-jected them, rejected Christ and Him who sent Christ, the FatherJ5 The ministry which these men were to exercise was threefold: the ministry of teaching sound 9See K. Truhlar, s.J., "L'ob6issance des la'ics," in La[cs et vie chrdtienne parfaite (Rome: Herder, 1963), p. 245. tOE. Schillebeeckx, O.P., Christ the Sacrament of the Encounter with God (New York: Sheed and Ward, 1963), p. 16, nQte 14. u Mk 10:45; see also Y. Congar, O.P, Power and Poverty in the Church (Baltimore: Helicon, 1964), pp. 98-9. tO Rom 1:16. tO Mt 28:16-20; Mk 16:15; Lk 24:45-8; Jn 20:21-3. 1~ Mt 28:20. ~Lk 10:16. doctrinele; the ministry o[ sancti[ying17; and the ministry of. governing.~8 It is clear from this that authority is not used correctly whenever it turns into despotism or domi-nation, ae It is meant to be a service of love and in love (agap6) to the community, or a prelacy in the sense of supervision and surveillance for the unification of the community,s0 When we shift our gaze to the "first religious," the fathers of the desert (I think that we can trace the com-munal practice of obedience to this era), we see that for them obedience was one piece in a multitude of things which the ascetic had to be ready to assume in "leaving the world" to test his courage and strength against the temptations of the desert. The reason why this was de-manded was that the heart of an individual was so con-taminated by concupiscences of various kinds that he wo.uld be considered rash if in attempting to reach the perfection of the following of Christ he did not rely on or seek the direction of others in a spirit of humility. Obedience was considered as merely a kind of corollary of a frank soul testifying to its confidence in a spiritual master from whom advice was sought. It was an element of interior perfection and could almost have been re-duced to the practice of humility as a means of putting to death whatever was inordinate in the self-will of an individual. This desire to "follow Christ radically" was not what we often imz'gine it to be--a purely personal and inti-mate relationship with Christ. In the spirituality of the father of the monks, Antony, the "following of Christ" embraced a form that we would find extremely inter-esting today, Despite the apparent paradox, the imitation of Christ by the first hermits was essentially social. The first goal of those who gave themselves to this way of life was fraternal charity. And they were always pre-pared to see to its observance whenever khis was neces-sary. z~ Those who quickly gathered around Antony did so in an attempt to find the life of the primitive Church, a perfect fraternity, totally subject to the will of the as 2 Tim 4: I ft. 1~ Mt 28:19; 2 Cor 3:8--9. as I Pt 5:2 ft.; Acts 20:28. as Mk 10:42; Lk 22:25. ~o For all his insistence on the role of authority as ministry or service, Paul also referred to it as having power to make decisions; it is not simply a tool of the governed; see, for example, 1 Cor 7:10, 12,17; 2 Cor 10:8; 2 Th 3:9; Phm 8. The hierarchy has been es-tablished for service which includes teaching, ministry, and govern-ment. This service is in view of the community, in view of building up the Church to the glory of the Father. See P. Anciaux, L'dpiscopat darts l'Eglise (Bruges: Descl~e de Brouwer, 1963), pp. 56-7. a Antony returned to Alexandria to serve the Christians perse-cuted for their faith and serving in the mines. 4. + + Obedience VOLUME 25, 1966 163: ÷ ÷ C. A. Sehleek, C.$.C. REVIEW FOR RELIGIOUS 164 Lord, moving in perfect unity and harmony towards the second coming. This trend was merely more fully in-tensified the more cenobitical these groups became. In the beginning when men came together to live in common, and to follow the teaching of a master and to incorporate themselves more completely into a com-munity of worship and love, the practice of obedience was not regulated by any positive or organic legislation 'as it is today. In fact from the juridical and moral view-point it is difficult to sa~ whether or not the first cenobites were even considered to have vowed obedience to a spiritual father. From all the documentary evidence we have at our disposal it would seem as though the prac-tice of vowed obedience came in with the advent of St. Benedict upon the monastic scene. Yet the practice of obedience for all, hermits and cenobites, appears to have always remained fundamentally the same in its ends or goals. It was always regarded as an instrument for achieving Christian perfection (1) by imitating the ex-ample of the Divine Redeemer and His sacrifice, and (2) by bringing all into unity to constitute a community of worship and love.22 These basic eler~en~s and motives which marked the obedience of the first "religious" should also mark the contemporary practice in religious communities of to-day. The love of Christ, the following of His obedience to the Father, the practice of faith and humility, the desire for ecclesial unity, all of these form the very heart and core of all religious obedience regardless of epoch, place or form, or embodiment. There is, however, one difference that seems to stand out rather clearly in comparing the practice of obedience of modern com-munities with that of their earlier counterparts. And tfiat is~ the functional character of the obedience of the former in contrast with the domestic character of the latter.2n There should be no astonishment at this difference once we consider the environment in which the Bene-dictine life was established. It was set up within the framework of the notion of the Roman paterfamilias who had a rather complete control over those subject to himself, not only the slaves and workers but even over the members of his own immediate family, his wife and his children. For Benedict there was first of all in the monastic ideal, obedience; in fact, we might say there was nothing but obedience. As the Prologu~ of' m R. Carpentier, S.J., "Vers une th~ologie de la vie religieuse," in La vie religieuse darts l'Eglise du Christ (Bruges: Descl~e de Brouwer, 1964), pp. 65-71. m For these expressions, domestic and ]unctional, see J. Leclercq, The Religious Vocation (New York: Kenedy, 1955), pp. 134-5. the Rule states: "Hearken O my son, to the precept of your master, and incline the ear of your heart; willingly receive and faithfully fulfill the admonition of your loving Father, that you may return by the labor of obedience to Him from whom you had departed through the sloth of disobedience., so that renouncing your own will you will take Up the strong and bright weapons of obedience."~4 And again in Chapter 5 the Rule states: "Those who are impelled by the ardent desire of ascending to eternal life for that reason take the nar-row .way.n6t living by their own will or obeying their own desires and pleasures, they walk in accordance with the judgment and command of another; living in communities they desire to be ruled by an abbot." ~5 From the very beginning the Rule of St. Benedict speaks of the abbot who stands in the place of God. And after this it speaks of obedience, the first among the virtues, and of humility which begets obedience. Yet for all this emphasis on obedience, the Rule also indicates quite clearly its norm: the Rule itself. A very definite limitation was placed on the powers of the abbot, which is often forgotten. There was a sense in which the abbot had all the power, and there was another sense in which he had only that power given to him by the Rule. His mission was to make sure that the Rule was observed. But hd had no power to oblige any service not in accordance with the Rule. Moreover, Benedictine obedience was lived within the framework of the monastery. It was a kind of do-mestic obedience, to use an expression. It was obedience within the life of the family and was given to a superior who was always present. It was a hearkening to the voice of him who gave orders. It was an obedience that left what one was doing unfinished as soon as the voice made itself heard. Because it was domestic, Benedictine obedience was very profoundly human. In the monastery the relationship was that of person to person with the flexibility that is to be found in human relations. It did not have the more or less abstract character and regimentary appearance which it took on in later times due to its change in operation. This same interpersonal dimension of monastic or domestic obedience can be seen throughout Benedict's legislation as is evident from the following excerpts: Whenever any weighty matters are to be transacted in the monastery, let the abbot call together the whole community and make known the matter which is to be considered. Hav-ing heard the brethren's views let him weigh the matter with himself and do what he thinks best. It is for this reason that Prologue, Rule oI St. Benedict, § 1. Rule o] St. Benedict, Chapter 5. - 4. 4. ObedienCe VOLUME 25, 1966 165 REV1EWFOR RELigIOUS 166" we said that all should be called for counsel, because the Lord often reveals to the younger what is best. Let the brethren, however, give their advice with humble submission and let them not presume stubbornly to defend what seems right to them, for it must depend rather on the abbot's will so that all obey him in what he considers best. Bu~ as it becomes disciples to obey their master, so also it becomes the master' to dispose all things with prudence and justice. Therefore let all follow the Rule as their guide in everything, and let no one rashly depart from it . Let no one in the monastery follow the bent of his own heart, and let no one dare to dispute insolently with his abbot, either inside or outside the monastery. If any one dare do so, let" him be placed under the correction of the Rule . Let the abbot himself, however, do everything in the fear of the Lord, and out of reverence for the .Rule, knowing that beyond doubt he will have to give an account to God the most just Judge for all his rulings. If however, matters of'less importance having to do with the welfare of the monastery are to be treated of, let him use the counsel of the seniors only, as it is written: Do ~ill things with counsel, and thou shalt not. repent when thou hast done.~ From the moment when congregations or groups of men and women began to exercise apostolates and chari-table works that took them away from the immediacy of the monastery and the contemplative life, obedience began to. assume a different appearance. It became what we might call more functional in operation than do-mestic.: It began to center more and more around the beginnin~ of an action or task than around the actual manner in which it 'was to be carried out. We can say that it came into action when the course or activity was undertaken, leaving to the subject the manner in which it was to be carried out. The superior was free to fix the limits of the task but once the work was started, the religious was left free, at least to some extent, to follow his own initiative. Yet for all this personal initiative on the part of the subject, the entire work and not merely the task assigned was said to come under obedi-ence. I suppose that we find this practice of obedience rather clearly crystallized in the Jesuit approach to this element of religious life. Wishing to form men for service to the Church in all and every circumstance of its life and needs, Ignatius abandoned many forms and observances which were characteristic up to that time. In regard to obedience he attempted to give his fol-lowers a personal formation that would enable them to preserve their religious character and ideals without many of the external supports that were found in the monastic version of the religious life. His religious were to have such a strong character formation that they would be able to manage without any support, would undertake any responsibility, and would remain faithful ~ Rule of St. Benedict, Chapte~ 5 and 3. to their vocation under any and all circumstances by reason of the depth of their interior life. Yet they would be so trained in obedience that they could be en-trusted with or relieved of any function or activity at any given moment or sent to the ends of the earth with-out previous warning or explanation. As we can see, such obedience might seem to be less human to a certain extent, less interpersonal than that of the monastic version.2~ Yet it is not less radically detached. In fact, it is even more detached than that of the monastic type. For a Jesuit, ideally, can have no other attachment .than to the will of God and to His glory which is represented by an obedience the object of which is frequently that of undertaking rather serious responsibilities. He must be ready for every responsibility and yet at the same time be ready to give up without delay or discussion work to which he may have devoted, himself unreservedly for years. And quite recently Pope Pius XII asked them to continue to form their men in this same spirit of obedi-ence. 2s This form of functional obedience has been the state-ment of this practice of the religious life for most reli-gious communities since the arrival of the Jesuits. The only other development that has come on the scene in recent years is its statement or expression within the framework of secular institutes. Here a more free type of obedience is exercised, but basically it would seem to be merely an extension of the functional obedience which we have just described, From this it should be clear that evangelical obedience or religious obedience as well can be and has been em-bodied in different expressions or statements. These are or have been brought on by the demands of the Church peculiar to different epochs. Yet as we shall see later on in ~ Ignatius was quite understanding of his religious. When Father Nadal entered the Society at about the age of thirty-five Ignatius gave him a particularly pleasant room, had him dine with himself frequently, took him out walking, and chatted with him quite fre-quently. When. asked why, he answered that a temperament like Nadal's had to be treated with a soft touchl It is also recorded of him that he said on one occasion: "I have a great desire for a general indifference in all; and so presupposing obedience and ab-negation on the part o[ the subject, I find it very good to ]ollow his inclinations." When he wished to send one out to study or to a distant assignment or give him some rather heavy task he examined the person to find out what he was most inclined to; and then, if he found an obedient man, accommodated himself to his inclina-tions. See E. Polit, S.J., Per[ect Obedience (Westminster: Newman, 1947), p. 160. ~ Address to the General Congregation, 1957: "The form of gov-ernment in the Society is monarchical and is embodied in the de-cisions of a single superior" (The States oI PerIection, ed. G. Courtois [Westminster: Newman, 1962], p. 300). ÷ ÷ ÷ Obedience VOLUME 25, 1966 167 REVIEW FOR RELIGIOUS the article, for all these different expressions, in essence. and in its fundamental .outlines the practice of obedi-ence in all institutes of perfection remains the same. Its theology has in no wise changed.29 For all the cornerstone force, for all the excellence ~which the practice of. obedience has in the long tradition of the life of the counsels, there is no problem which present~ so many and so varied difficulties in our con-temporary religious life. I believe that if we were .to analyze the problem, trying to get at its roots or sources whence these difficulties come, we would find them to be several: the spirit of our times; certain trends in spiritu-ality, certain embodiments of authority and obedience,. and a misunderstanding of the theology of obedience. Each of these demands something of an explanation. Firstof all there is the "spirit of our times," or the civilization and historical epoch in which we live. This is characterized by an ever growing democratization of men and institutions. In such an environment the ideal that seems to be uppermost for many is that of "team. Work" or fraternal collaboration or a "democratic obedi-ence," in which if there is any authority whatsoever, this authority comes from the group in such a way that the leader more or less merely interpre~ or reflects the consensus or the mind of the group 'and acts as their spokesman .and is responsible before them. In fact, the idea that there can be an authority that comes from God rather than from the g~oup, an authority which-is superior to a group even though serving it and ordered to the common good, an authority that is not merely a servile instrument but the sign of ruling that is the power of the kingdom of God, an authority that is a service responsible primarily to God, all this is rather difficult for the youth coming to us today to under-stand. So Moreover, the spirituality of our day with its marvel-ous possession of a deeper psychological understanding of the workings of men and women, its recognition of ~Much of the current agitation regarding obedience and au-thority--- often generating more heat than light in our era of "stress writing"--is really an attempt to recover various aspects of this institution already found in previous embodiments; for exam, ple, (1) the dialogue" and communication ideal of Benedictine monasticism; (2) the functional ideal of the Society of Jesus; (3) the authority-service ideal of the New Testament. Bu( when any ~f these aspects is stressed (and the same is true of abnegation) so that it is seen outside of the total context of obedience-authority, it can cause a myopia which is disastrous to the overall picture. It is this exaggerated preoccupation with one or other element of obedience-authority out of due proportion that-is causing many of our problems today. .~Paul'VI, Address to the General Audience, July 14, 1965, NCWC Documentary News Service. man's intelligence, its cult of the dignity of the human person, its insistence on man's initiative and free re-sponse to God ir; facing the tasks of life, all this has set of[ without intending to, of course, a reaction against obedience and authority, at least for the moment, rather than a perfecting and balancing of it as originally in-tended. Again, a study of history shows quite clearly that down through the centuries there have been dit~erent .embodiments or statements of authority even within the Church. And this same study will show that some of the images of authority in history are not always faithful to its God-intended purpose and, therefore, not very felici-tous and certainly not to be clung to or defended,sl As a result of thes~facts and trends, the charge has been resounding for over ten years that obedience, espe-cially religious obedience, imperils the human dignity of the person, that it hampers or even goes counter to the development of human personality, that it stands be-tween him and God or interferes with his immediate and direct~relationship with God, that it creates weak and passive spirits not capable of meeting the chal-lenges of our times, that it affords a haven where persons afraid to face the world or assume responsibility can come to anchor. It is also argued that corpse-like obedi-ence is not even human, let alone religious. For human obedience should place all the capacities of man at the service of obedience. Consequently, it must be active and intelligent. While passive obedience (the kind so often reflected in the older ascetical writings usually intended for novices and contemplative religious) might be fitting for a very young child (although even this is questioned) since it is not yet capable of using its reason fully, the case of the adult is quite different. The latter's obedience must be mature, therefore, active and intelligent; otherwise it goes counter to the very nature of the human person. And so the plea has been raised again and again: more independence, initiative, and responsibility must be given to subjects. Efficiency can be achieved only when as much discretion and liberty as possible is left to sub-ordinate members. Professionals within the Church will do their best work in a situation where they have as much freedom and self-respect as possible. Thus, au-thority today must be exercised in a much more "fra- ~ Ibid.: "Experience and history offer us a unique picture of the images of authority which are not always faithful and not always happy ones. It is necessary to deepen the idea of the authority of the Church, to purify it of forms which are not essential to it (even if in given circumstances they we're legitimate, for example, temporal power) and to return to its original and Christian prin-ciple." Obedience VOLUME 25, 1966 169 + 4. 4. C. A. Schleck, REVIEW FOR RELIGIOUS 170 ternal,' sort of way, that is, in a way that is characterized by stable and purposeful involvement at.each level.32 It is because this has not been true enough in past years that we face a "crisis," not so much in regard to obedi-ence as rather in regard to authority today.3~ This is obviously only a very brief amalgam of the various ideas being circulated today. And what lends color and force to them is the fact that some of these things can and do happen and certainly have happened both in the Church and in religious communities even though they perhaps have happened elsewhere and are happening elsewhere in greater proportion. "Experience and history offer us images of authority which are not always faithful and are not always happy ones." a4 These gources of difficulty have given rise to still another, one more basic and fundamental and more crucial---the theological principles involved in the prac-tice of obedience. These are sometimes rather poorly misunderstood or distorted, not willingly or intentionally to be sure, but simply by over-preoccupation or concen-tration on some elements to the neglect of others. And one thing is certain--we are not allowed to exaggerate one element of a rather complex reality out of due proportion. If we do, we simply shift our error to an-other side. To avoid tilting at windmills we would do well to go back to the basic principles involved in the practice of obedience. This is necessary for both su-periors and subjects. On the one hand, religious obedi- =A. Greeley, "Fraternal Authority in the Church," Homiletic and Poztoral Review, v. 64 (1963-4), pp. 563-5. Some would go so far as to suggest a liberation from every form of juridical prescrip-tion by substituting the simple law of charity and reducing rules to an indispensable minimum. The problem is a minimum for what vocation and function in the Church? =As Father Gambari remarked: "Some think religious are less inclined to obey today. I do not think that this can be said without any qualification. There is a great generosity and spirit of sacrifice among them, and a deep desire to work for the good of their neighbor. But they do wish to obey with greater liberty, spon-taneity and intelligence. They are anxious to base their obedience on reason, not in the sense that they will obey only if the motives and scope of the command are reasonable but rather in the sense that the problem of obedience is seen in a little different light. In the past obedience was presented and practised with insistence on the negative aspect of self-renunciation or death to one's own will. Today we speak of obedience as perfecting the religious. Thus youth wish to seek in obedience the means of becoming associated to the action of God . Again it is true that religious wish Su-periors who do not only hold authority from God, but who know how to use it as God Himself does. It is this which lies at the basis of so much discussion of the following topics: obedience and formalism; obedience and liberty; authority and liberty; obedience and peisonality development; obedience and personal initiative and responsibility" (Proceedings o] 1958 Sisters" Institute o] Spirituality [Notre Dame: University of Notre Dame, 1959], pp. 137, 150-1). ~ Paul VI, Address to the General Audience, July 14, 1965. ence will be retarded in its spiritual effects to the degree that its theology is not known or is neglected. A superior cannot govern properly unless she understands why obedience confirmed by v6w enjoys the place it always has had in religious life. On the other~ hand, a religious subject will obey .constantly with spiritual profit to herself, the commufiity, and the Church and in an adult manner to the extent that she is convince~n all levels of her personality, intellectual, emotional, social and spiritualZ-of the reasons for the existence, practice, and importance of obedience in her state of life. The real question will then be seen to be not whether there is to be authority and obedience, but whether the cur-rent ways of exercising it are suited to the present condi-tion of the Church. As Pope Paul mentioned: "It is necessary to deepen the idea of authority in the Church, to purify it of forms which are not essential to it (even if in given circumstances they were legitimate, such as, for example temporal power) and to return it to its original and Christian principles." 35 ~ The danger in periods like our own where there is much questioning even to the point of a liberating disobedience is that the very foundations of an institu-tion will be weakened. Yet 'I believe that if we know how to read the designs of providence correctly, we can ~?egard this questioning as an invitation to advance and to grasp more firmly the foundations which might seem to be threatened and to use the very difficulties them-selves as an occasion to commit ourselves all the more profoundly to our own religious dedication. In this way both superiors and subjects will come out of these diffi-culties more deeply rooted and more fully developed. To live in the light it is usually necessary to pass through dark nights136 The treatment that I will follow in ,. approaching this problem or topic will be quite similar to that which was followed in regard to poverty and virginity: (1) obedi-ence in general; (2) what religious obedience adds to the practice of obedience in general; (3) the aims of religious obedience; (4) the qualities of religious obedience; (5) the fruits of religious obedience; and (6) some practical suggestions. The Virtue of Obedience in General The nature of obedience as a virtue might well be defined as follows: a natural or supernatural (dependi-ng upon its source and objective) disposition or bent or ~ Ibid, ~See J. Laplace, S.J., "Education to Obedience," in Religious Obedience ,and the Exercise o! Authority, "Donum Dei," v. 3 (Ottawa, Canada: Canadian Religious Conference, 1961), p. 68. (Hereafter this work will be cited as "Donum Dei" 3.) Obedience VOLUME'25, 1966 . 171. C. A. Schleck, REVIEW FOR RELIGIOUS inclination or, better still, per[ectant of the faculty of the will which disposes a person to habitually submit himseff or herself to another's decision in reference to ¯ those things or areas in which this other has authority or decision-making power over one.~7 For example, in civil or domestic matters, a mayor or a governor or a president or a father or a mother has authority and ~The idea of virtue occupies a central position in moral and spiritual theology. A virtue is a dynamism or perfectant which does not create some automatic reflex type of reaction in situations. This would diminish the moral tonality of the action. No, a virtue is a good perfectant or dynamism that is operalive. It gives" the capacity for a power of action to accomplish the maximum of what it can accomplish. It is an active quality or perfectant that disposes one to produce the maximum of what he can on the moral and spiritual level. A natural virtue is acquired by the repetition of interior acts of the intellect and the will and therefore demands human effort. It is marked by the following qualities: (1) It is a constant disposi-tion of person. The repetition of victory over the passional dynam-ism or the other faculties, the will for example, on the part of the intelligence and reason engenders in the person a certain mastery which nothing can destroy save a change in the will of the individ-ual. (2) It gives promptitude and facility in action. This is the effect of the perfect ordination and unification of the interior principles of action of man where each elemeut enjoys its proper role. The reason and the will command and direct, and the sensibility obeys their impulse making its own contribution. It does away with the internal dissension that could so"easily destroy its function. (3) It gives joy in action, a triumphant joy that issues from the creation of a personal perfection. (4) It is acquired by education, respecting the personality of the persoia concerned. (5) It very often requires thee help o[ another and of discipline. We must insist more on the necessity of education to natural virtue, for it is only the intense presence o~: these ~perfectants and dynamisms in our human per-sonality that will make possible and facilitate the exercise of the so-called infused virtues given with grace. Today there is an excess of personal[sin rather current. Under the pretext of respecting the personality o17 another one does not dare intervene in his moral formation, for to do so would be to impose constraints on him; there is rejected any and all discipline which would impose itself on him, this being prompted by the apparently liberal project of leaving free play to the spontaneity of the individual, of placing entire confidence in the personality of each one. What happens is that'one often abandons others, especially the young, to themselves and their inexperience. One leaves them to the winds of moral mal-formation, to a spiritual life that is rather superficial, subjected to incessant agitation and changes of sentiments that are without much real depth. So many of those advocating this type ol: new formation were just a few years back the most rigid of personalities. This in itself should make us a little cautiotis in regard to any wholesale adoption of this thinking. Education to virtue is a difficult task and a complex one. It exacts the employment of authority and a pro-found respect for those one is educating, much understanding and finesse, and a firm will. One must beware of abusing authority and ofa liberalism which neglects its use: Only intelligent and prudent love for the one being educated will permit the discovery of this formula. See S. Pinckaers, O.P., "La vertu est tout autre chose qu'uhe habitude," Nouvelle revue thdologique, v. 82 (1960), pp. 387- 403. decision-making power over those under him or her in relation to certain actions. Obedience, therefore, is a natural or supernatural perfectant of the will which makes a person prompt in fulfilling the decisions of the one entrusted with this duty and service. By its very ¯ nature, negatively speaking, it involves a surrender of one's will, in a sense, in a given area of action. It means submission to another and implies a risk. For it means the channeling of efforts and energies in the direction marked out by the one charged with the de-cision- making, and this could go contrary to one's per-sonal tastes.and inclinations. As a result the practice of obedience requires submission to the command of another, inability to exercise, independent choice con-trary to the command given; therefore, it implies an evident restriction of freedom in action. If we concentrate only on these negative implications (and necessary ones to be sure)of obedience, it would be easy for us to conclude that some of the objections mentioned above are correct. Obedience could be seen merely as an obstacle to .self-fulfillment, to personal de-velopment; it could be viewed as a violation of personal dignity, even perhaps a kind of profanation of the charismatic spirit which is in each one to lead him to his or her perfection. For this reason, it is all the more necessary to see the positive side of the virtue of obedi-ence, and that is that it is a free and voluntary giving or snrrender or submission of one's person (will) to the decision-making duty and service (command) of a.: su-perior or one charged with the common good. As such, it is an action very much in conformity with our human dignity and self-mastery and quite capable of leading to our self-fulfillment, especially when it is motivated cor-rectly by the spirit of love. The basis of obedience is the very structure of society which requires authority at the service of the com-munity or the common good. This is God-willed and God-intended. There exists no authority except from God.as As John Chrysostom explains this: "Does this mean that every ruler is appointed by God? I do not say that, for I am not dealing now with individual rulers but with authority itself. What I say is that it is the divine wisdom and not mere chance that has or-dained that there should be government, that some should command and others obey." 29 God has willed that in the plan of leading men back ,to Himself ulti-mately, some should be subject to others, not because of any superiority of talent necessarily, whether this be intellectual or spiritual or social or administrative, but ~ Rom 13:1. ~In Epist. ad Rom., c. 13, hom. 23, P.G., v. 60, col. 615. Obedience VOLUME 25, 1966 . A. SchlCec.$k.,~. REVIEW FOR RELIGIOUS merely because God has given one person authority or decision-making power over others, even though He may .have done 'this using very human means and per-sons and even political maneuvering to designate this person. Authority is not to be thought a~ lacking all control. Since it is the power to decide or command according to right reason, it must derive its obligatory force from the moral order which has God for its firgt source and final end. If it can oblige men in conscience it is only because it is intrinsically related with the authority of God and shares in it. By this principle the dignity of men is protected. "As men they are equal (and as Christians also, if they are such), but as superior and inferior they are not equal, they are not on the same plane. To one God has given the service of commanding in the realization of His will and to others He has given the service of obeying. When in fact men obey their lawfully constituted rulers when "they rightfully exercise their authority, it is not at all men they obey. "It is God," as Pope John pointed out, "the provident Creator of all things whom they rever-ence. through their obedience, since He has decreed that men's dealings with one another should be regu-lated, by an order which He Himsdf has established. And in showing this due reverence to God, we do not debase ourselves, but rather perfect and ennoble our-selves. For to serve God is to rule." 40 Since the right to command is required by the moral order and has its source in God, it follows that if au-thority (eVen civil) legislates for or allows anything that is contrar)~ to that order and therefore contrary to th~ will of God, neither the laws made nor the authoriza-tions granted can be binding on the consciences of the citizens, since we must obey God 'rather than men. If this were not so, then autho~:ity would break down com-pletely and would result in or be open to shameful abuse. The net result of this would be the degradation of the human person.41 Obedience, then, does not regard so much the persoh in authority as rather the authority of the person in charge. For obedience is given not so much to a per-son as rather to a norm or set of societal laws or rules or norms or constitutions which this authority is called upon to safeguard. Yet to a certain extent obedience is given also to a person, that is, to God who incarnates Himself in this' set, of expressions when they fulfill the definition of law: an ordinance of reason established for ~o Pacem in terris, America Press edition, § 50, p. 18; also, §§ 46-9, pp. 17-8. ~a Ibid., § 51, p. 18. the common good, promulgated by one who has rightful authority.42 From what we have seen, it. should be evident that the purpose of authority is the common good; in fact, this comes from the very etymology of the word. It is derived from the Latin word "augere" which means to increase or foster or enlarge. It is. of the very nature of anyone in authority to make decisions and move people about or command their wills but only in the interest of the common good. Thus, the motivating force behind one in authority cannot be merely the good of the individual member but rather the overall common good of the group or society over which he or she has charge. This end, of course, does not exclude the good of the individual either. Rather it includes it, since the indi-vidual pertains to the group as a part pertains to the whole. Authority exists for the sake of those over whom it is set. It is a service to God and to th~ community and to the individual member of this community. As Pope John mentioned: Indeed since the whole reason for the existence of civil authorities is the realization of the common good, it is clearly necessary that in pursuing this objective, they should respect its essential elements, and at the same time conform their laws to the needs of a given historical situation . For the common good is intimately bound up with human nature. It can never exist fully and completely unless its intimate nature and realization being what they are, the human person is taken into account.~ Authority is established to develop and lead to per-fection and fulfillment the self-respect of the group and of each individual member of the group, to impress upon the group as well as each individual member the per-sonality which is proper to it and to them, a personality which is determined by the end or purpose for which the society exists. It is not set up to be an opportunity to exercise a lordship or dominion, or to receive respect or reverence or service. It is a ministry unto unity, even while it fosters diversity. It can readily be seen that excessive severity or ri-gidity on the part of authority originates from a false idea. It comes most often from an over-estimation of oneself on the part of the one in authority, or from pedagogical incompetence, or from the inability to han-dle individual persons, or perhaps even from some sense of inferiority in the face of the subordinates one has ' to command. It is for one or more of these reasons that ~ This point would seem to have some relevance for women since modern psychology reveals that often they find it somewhat more difficult to abstract from the concrete person involved in superior-subject relationships. ~ Pacem in terris, §§ 54-5, pp. 19-20. ÷ ÷ ÷ Obedience VOLUME 25, 1966 175 ÷ ÷ ÷ C. A. SchCle.Sc.kC,. REVIEW FOR RELIGIOUS authority often ends up?by having to work at a distance from its subjects rather than in close collaboration with them and leadership of them; and in so doing it fails to accomplish the full perfection df the task that is assigned to it--the bringing out in the society and the individual members¯ of it the personality or the personalities that are proper to it.44 While ,the initial success of obedience rests on the wise and efficient Use of authority---on government ac-cording to reason rather than merely by will--still it can also be said that the ultimate success of this institu-tion and the realization of the common good rests upon the harmonious cooperation and collaboration of those who are subject to this authority. Individuals and inter-mediate groups are obliged to make their specific contri-butions to the common welfare. Thus, one of the chief consequences of this is that these individuals or groups must bring their own interests into harmony with the needs o] the community, and they must dispose of their goods and of their services as the legitimate authorities prescribe in.accord with the norms of justice and within the limits or, their competence.4~ It is on!y in that society or community in which each member consents to do his part, and all his part, and nothing but his part (that is, not interfering with others) that everything will be correctly done. Such is true of the workings of the human body, and.~such, is true of the' working of an orchestra. For only when each one executes faithfully what is on the sheet of music before him will the entire piece be a perfect success. If one of the members of the orchestra departs from the score, not harmony but cacophony and discord will result. While it is true that not all the parts o(the orchestra have equally exciting or exhilarating functions to play, .still each of them has to be performed correctly it the end ot the orchestra is going to be achieved. There are some per-sons who play a.ll the time, and there are 'others who play only an occasional note here and there throughout the entire piece. Yet it this occasional note, small as it is in comparison with the whole, is not played exactly when and where it is to be played, the overall beauty of the music would be marred. Granted it is not very enticing or alluring to have to count out measure after meas6re without doing anything active, still each mere-a By "personality" I mean the'harmonious development of all the human and supernatural qualities of a person in subordination to the common good, to God, the lesser good being subordinated to the greater good. So understood, there is no conflict between the personality and obedience. There will at times be need for re-nunciation by an individual or small group, but this will be asked for the common good. See "Donum Dei" 3, pp. 194-5. ~ Pacem in teriis, § 53, p. 19. ber of the orchestra knows that this inconvenience must be endured, since the concert is not merely for th~ players but for the audience listening to it. A similar thing is true in the case of any society. F6r the good of the society is attained only when those under authority perfectly fulfill the tasks and offices and duties to which they are assigned--and as human beings---and when authority learns to utilize the experience and training and talents of those it commands in reference to the community endeavor. Thus, the power of au-thority can be defined as a power of cooi:dination guaranteeing the unity of a communitary plurality;, but. only in proportion to the consciousness with which each member of the community lives his function will the unity actually be achieved.46 From this it should be clear that a true concept of obedience and its correlative authority is far from the limited distortion so often emphasized in "stress writ-ing" today. It is a positive force for the fulfillment of men and women, of persons, but within the sphere of community as well as within the sphere of their, private world. A community in which the members have the proper respect for those in authority and willingly and intelligently carry out their specific functions and roles must necessarily be one in which tranquility reigns.4~ Authentic obedience liberates a person once and for all from his personal instability, sentimentality, and blind passions. It is a free and voluntary option which leaves the spirit open and receptive to many values which pre-sent themselves. The person who never makes such a choice and who never commits himself is less open, less broad-minded than one who has anchored his life to an obedience, seeing his life in and through it as a building directed by God. Yet for all this, such a relationship~ obedience-authority---does involve a struggle, one that includes very painful aspects because it disturbs very deep desires in men who are not as yet totally harmonized and humanized by the power of Christ's redeeming grace. Religious Obedience: What It Adds to Obedience in General Today it is most important that we show that obedi-ence is universal in character and belongs to the very life of the Church. It is, therefore, not entirely correct to call it the virtue of the monk "or of the religious. For obedience in a sense is just as absolute and obligatory for the layman as for the monk or religious even though ~A. Paoli, "Obedience," Cross Currents, v. 15 (1965), pp. 284-5. ~J. Aumann, "Current Trends," Cross and Crown, v. 17 (1965), pp. 347-8. Obedience " VOLUME 25, '1966 177 4. C. A. Schleck, C.S.C. REVIEW FOR RELIGIOUS 178 there¯ are differences. This absoluteness of obedience even for the layman stems from the universal vocation of all who are baptized to holiness of life.48 Yet for all this we do find differences, in fact differences which serve to establish one in a different way of life within the Church. As Pope Paul mentioned in a recent allocution: It has seemed good to Us to recall here the priceless im-portance and necessary function of religious life; for this state of life which receives its distinctive character from profession of the evangelical counsels is a perfect way of life according to the example and teaching of Jesus Christ, especially since it is a state of life which keeps in view the constant growth of charity leading to final perfection. In other ways of life the specific ends, advantages, and functions, though legitimate in them- ¯ selves, are of a temporal character . Hence it follows that the profession of the evangelical vows is an augmentation of that consecration which is proper to baptism. It is a kind of special consecration which perfects the former one inasmuch as by it the follower of Christ totally commits and dedicates himself to God, thereby making his entire life a service to God alone.'~ When we come to determine these differences more precisely we would find them to be especially three: (1) it extends the practice of obedience; (2) it changes the end or, perhaps better, affects the end for which one obeys; and (3) it places us in a more direct contact with the will of God, than does life outside religion (this has to be understood cautiously). First, religious obedience extends the control of Church authority over the person who freely and voluntarily enters a religious society. For by entering, a woman freely, and let us hope joyfully, gives to the persons of her superiors and their decision-making power even that legitimate freedom of action and movement with regard to time and exterior lif~ which she enjoyed in the world. Consequently, the obligation or the moral imperative of the virtue of obedience is extended also ,s Paul VII Magno gaudio affecti, May 23, 1964; English trans-lation, REVIEW FOR RELIGIOUS, V. 23 (1964), p. 699. But especially see the Constitution on the Church of Vatican Council II, Chapter 5 (English translation, REVIEW FO~ RELIGIOUS, V. 24 [1965], pp. 707-- ~ Paul VI, Magno gaudio affecti, as cited in the preceding foot-note. This difference is also indicated in the Constitution on the Church: "Since it is necessary thfft His followers should always imi-tate and give testimony to this charity and humility of Christ, the Church rejoices that there are to be found within her many men and women who closely follow and clearly show forth the self-emptying of the Savior, doing this by assuming poverty in the spirit of the freedom of the children of God and by renouncing their own wills. For the sake o[ God and with respect to what pertains to per-fection they make themselves subject to a man, going beyond the measure o[ what is commanded in order to be more lully con]ormed to the obedient Christ" (Chapter 5; REVIEW FOR RELIGIOUS. v. 24 [1965], pp. 712-3). to meet these new acts which religious authority can now command according to the norms of the particular society or community involved. For as we mentioned above, a religious vows or promises obedience primarily to God within the framework of a society and its particu-lar or peculiar norm of life rather than to a person, even though the two ~ire in a sense identified whenever the person in authority commands according to the norm. In fact, it is this very extension of obedience which makes religious commitment today the difficult thing that it is for so many young girls. As Pius XII remarked in an address to the International Congress for the States of Perfection in 1950: If the number of candidates wishing to enter the enclosed gardens of the religious life is diminishing, especially among young women, the reason very frequently is that they find it difficult to divest themselves of their own judgment and sur-render their [reedom o[ action, as the very nature of the vow of obedience demands. Indeed some praise as the real peak of moral perfection, not the surrender of liberty for the sake of the love of Christ, but the curbing of such surrender. The norm to be preferred in the formation of a just and holy person would seem to be this: restrict liberty only where necessary; otherwise, give liberty free rein as far as possible. We by-pass the question whether this new foundation on which some are trying to build the edifice of sanctity will be as effective and as solid in supporting and augmenting the apostolic work of the Church as was the one which through fifteen hundred years has been provided by that ancient rule of obedience undertaken for the love of Christ. What is now of supreme importance is to examine this proposal thoroughly to disclose what lies concealed beneath the surface. This opinion, if care-fully considered not only fails to appreciate the nature of the evangelical counsel but it somehow twists it to a meaning in accord with its theory. No one is obliged to choose for himself the counsel of perfect obedience, which essentially is a rule of life whereby one surrenders the control of his own will. No one, we repeat, be it an individual or a group. They can if they wish conform to this new rule. But words must be under-stood and accepted according to .their obvious meaning, and if this norm is compared with the vow of obedience it surely does not possess the same supreme value, nor is it an adequate expression of the wonderful example recorded in Holy Scrip-ture: "He humbled Himself becoming obedient unto death." ~0 He therefore is himself deceived and deceives others who forgetting the propensities of the soul and the inspiration of divine grace, offers as a guide to one seeking advice about en-tering the religious state only that new norm. Hence if it is clear that the voice of God is calling someone to the heights of evangelical perfection without any hesitation he should be invited for the attainment of this lofty purpose to offer freely the sacrifice of his liberty as the vow of obedience demands, that vow, We proclaim, which the Church has through so many centuries weighed, has put to the test, has properly delineated and has approved. Let no one against his will be compelled to Phil 2:8. ÷ ÷ ÷ ObedienCe VOLUME 25, 1966 1'/9 ÷ ÷ C. A. $chleck, C.$.C. REVIEW,FOR REL]G|OU$ 180 this self-consecration; but if he does will it, let no one counsel him against it; above all let no one hold him bacL= Moreover, the end to Which the superiors of a re-ligious community are to lead the one presenting her-self to it is not merely a natural end, such as is true at least proximately of a natural society. The first or pri-mary role and duty of religious superiors is to lead their members or subordinates to intimate communion and union wiih God through the perfection of love or charity by way o~ personal assimilation and expression. No human society has this as its direct and primary end, whereas a religious society does not exist and can-not exist except ~or this purpose.~2 Thus the primary end of religious communities is to lead their members to "seek God solely and before anything else," 53 and this by the profession of the vows, especially that of obedience which is the most important and which in a sense in-cludes the others since we vow obedience to the consti-tutions which include the practice of the other two vows. And finally, religious obedience puts a subject into more direct and immediate contact with the will of God than any other framework of life. This was certainly the thought of Benedictine monasticism which regarded the abbot as the one who took the place of God ~or the monk so long as the abbot commanded according to the norms of the monastic community. And it also seems to be the normally accepted thinking of the magister-ium. In speaking to major superiors in 1958, Plus XII pointed out the place which religious superiors have in regard to the government of the Church: Beloved sons who by the suave designs of God's providence have been placed in .command of your members engaged in the quest of perfection, gathered as you are in Our presence, it is with uncommon joy that We salute you in the name of the Lord, as men chosen to be associated with Us--and in no mean capacity--in Our apostolic office. For as We said a few years ago in speaking to your members at the first General Congress of the States of Perfection, the religious state "has its existence and strength from its intimate connection with the end of the Church herself, which is to lead men to the attainment of holiness." And the Church, the Spouse of Christ, would not fully correspond to His will, nor would the eyes of men be raised to her in hope as to a "standard set up unto the nations" if there were not found in her some who, more by example than by word, are especially resplendent with the beauty of the Gospel. In this department of Our work, therefore, beloved Sons, We have taken you as associates of Our supreme o~ce, either directly by delegating to you through the Code of Canon ~ Canon Law Digest for Religious, v. 1 (Milwaukee: Bruce, 1964), pp. 91-2. ~ See footnote 49. The specific end of marriage is not.perfection or charity, at least so it would seem from this statement. ~ See Vatican Council II, Decree on Adaptation and Renewal of the Religious Lile, nos. 5--6; NCWC Documentary Service. Law some share of Our supreme jurisdiction, or by laying the foundations of your so-called "dominative power" by Our ap-proval of your rules and Constitutions. And so We have it very much at heart that you should exercise this authority of yours according to Our mind and that of the Church. It is with clear vision and turning neither to right nor to the left that Superiors should lead their subjects securely to eternal life by the safe way of truth, with firm leadership and if necessary with a strong hand. To quote the patriarch of those who, in the Western world, str~ve for evangehcal perfectmn: The A hot should neither teach nor establish nor command anything that is outside the teaching of the Lord.''~ It is because religious superiors in some way share in ecclesiastical authority that when they command in keeping with the norms of this authority they place us in contact with the will of God. This is why Pius had also a year previously rejected the argument against re-ligious obedience drawn from the alleged fact that the dependence of a religious upon his superior was con-trary to the supreme and direct dominion of God over conscience: To insist that a man depend on another even as to his personal life and activity--is not this to confer on the superior prerogatives which belong onl)~ to God? The Church has never defended nor approved such a contention. She regards obedi-ence as a means of leading man to God. Since the motive which inspires it is union with God and since the final aim of obedi-ence is growth in charity, the superior is by no means an obstacle standing between God and the subject and arrogating to himself the homage which is directed only to God. The superior can command only in the name of God and in virtue of the powers entrusted to him, and the subject is bound to obey only for the love of Christ, not for any motives of human advantage or convenience--and much less by mere constraint. Thus he will preserve even in the most complete submission the eager joy of renewing each day concretely his total consecration to the one supreme Master . Let us first recall the words of our Savior: "Come to me all you who labor and are burdened, and I will refresh you . Learn of me because I am meek and humble of heart, and you shall find rest for your souls." ~ If our Lord thus invites men to take up His yoke, it is to teach them that beyond mere legal observance, which easily be-comes burdensome and hard to bear, they are to discover the meaning of true submission and Christian humility. Far [rom offending the dignity of one who submits, this will give him in-terior liberty and show him how to accept his state of subjec-tion, not as a constraint from without, but as a surrender of himself into the hands of God, whose will is expressed through the visible authority of those whose mission it is to command. The Superior for his part will use his powers in the same evangelical spirit: "He that is the greater among you, let him become the younger; and he that is leader as he that serves." ~ From this it should be clear that the superior has as ~ Allocution to Major Superiors, February 11, 1958; Canon Law Digest ]or Religious, v. 1, pp. 194-5. ~ Mt 11:28-9. ~Lk 22:26. See also the Address to the States o] Per]ection, December 9, 1957; Canon Law Digest for Religious, v. 1, pp. 132, 130. 4" 4" 4" Obedience VOLUME 25, 1"966' ' 181 REVIEW FOR RELIGIOUS her function the apostolic duty of mediating God's will to human minds. It is because she is the instrument whom God uses to make known His will to the sub-ject that she has the duty to listen to God herself, to seek the will of God and the directives of the Spirit in regard to the subject, even using the subject's communi-cation to her in seeking this out. If the subject is ex-pected to see Christ in her superior, then the superior also is expected to see Christ in the subject, for she is a member of the Body of Christ. As Christians they are equal, and it is possible for the subject to receive cer-tain lights and directives from the Holy Spirit.5~ Yet even these are subject to the final decision of those in authority when authority acts within its powers. Con-sequently, it is the duty of the subject to accept the fact that when authority has issued a command, it has also been listening to God's word and is not merely issuing a command for the exercise of power. With all this in mind it should be quite easy to grasp the statement that in a way the problem of obedience is simpler for the subject than for the superior. As far as the subject is concerned, obedience enjoys a kind of infallibility, such that the subject is never wrong in obeying when the superior operates within the limits of her powers. This, of course, has to be understood cor-rectly. A distinction must be made between the proxi-mate end and the remote end of a law. It is quite possible that in reference to the proximate end, the de-cision of the superior is not always the best. Yet with regard to the remote or ultimate end, this decision trans-mits infalliblY the will of God and the subject cannot make any mistake in obeying it. In giving a command or making a decision it is the general policy of superiors to be pursuing a proximate end or an immediate and definite purpose. A superior for example may give a, sub-ject a directive aimed at helping the subject improve in some area of her teaching or nursing. In such matters it is quite possible for the superior to make a mistake. ¯ She can tell the subject to take a certain kind of exercise and the subject incapacitates herself from doing ttiis. In regard to this, then, the immediate or proximate end, the superior can be quite fallible. But we can also con-sider the superior's decision in relation to its remote li:'l; end: to reveal to the subject the will of God in her re-gard, And this particular will of God is merely a part o[ the total plan of divine providence and government of mankind. ~We have a rather darkened and limited intellect and our range of vision is quite small. Thus we could very mVatican Council II, Constitution on the Church, Chapter 2, n. 12; R~vmw FOR RELmIOUS, V. 24 (1965), pp. 677-8. easily be mistaken when we pass judgment on some event or other. We can look at it as a failure when in reality it has many further nuances. We must remember that the total plan of God is a supremely harmonious one in which every detail is wisely provided for, willed or permitted by God. We see only a part of the overall plan and may easily think that talents and so on are quite wasted. Yet from God's viewpoint everything is quite clear and well ordered, and every detail is ac-cording to His plan. Thus an action decided on by a superior may very well result in failure on the human plane. In relation to its ultimate end, however,, it is willed or permitted, by God. Thus what seems a failure to our human shortsightedness is really a part of the great harmonious plan of God. And in this long-range view the apparent failure which contributes to the har-mony of the overall design is really a success. Thus the subject, failing according to our human approach and view through her obedience, is always fulfilling the authentic will of God. She contributes to the realization of the total divine plan and therefore cannot make a mistake. Her union with the divine will is infallible, in this sense. This does not mean that the superior cannot make a mistake in commanding or deciding. Far from it. It is possible in commanding or deciding that the stiperior gives evidence of incompetence, or ignorance, or pre-cipitation, or anger, even of malice. And we cannot pos-sibly consider any of these virtuous actions. It can be from the superior's point of view a mistake and even a sin, even a grave sin. But unless the superior commands a sinful action, the duty of the subject is to obey.as Thus the principle that we have been attempting to show still holds. The subject enjoys a kind of infallibility in the practice of obedience, which the superior does not necessarily enjoy. It is the great St. Teresa who was so convinced of this that she wrote: "Suppose the confes-sor makes a mistake, the safest way for a religious is to follow his direction exactly, even .though an angel of the Lord may have spoken to her (indicating a different direction). For our Lord will either enlighten his min, ister or arrange matters in such a way that this soul will not fail in obeying." 59 It is precisely the role of the vow of obedience to permit us to conform our will to God's in our least actions and at every moment of our ~sI shall clarify this at greater length when speaking .of the qualities of obedience. ~ Book o] Foundations in The Complete Works of St. Teresa of Avila, ed. E. Allison: Peers, vo 3 (New York: Sheed and Ward, 1951), p. 42. For a more complete treatment of this note of infallibility in obedience, see R. Morency, S.J., "The Ex~rcise of Authority in the Light of Present-Day Problems," "Donum Dei" 3, pp. 172-4. ÷ + ÷ VOLUME 25,. 1956 ]83 4. 4. + REV[EW FOR REL]G]OU5 life. In obeying, in fulfilling what is demanded by rule and constitutions and by superiors, the religious has the certainty (in faith, of course, as we shall see) of dbing exactly what God wants her to do at each moment of her life. By obedience she conforms her will to God's. What we have been discussing is based on the fol-lowing considerations. Christian thought has always recognized in ecclesiastical leaders the representatives of Christ. Yet we are not to .feel that the decisions of those in authority on any particular point are identical with the direct revelation of God's designs. Nor are we to conclude that the dedisions of those in authority are identical with those which Christ Himself. would make in simil~tr circumstances. (This would be to push the "mystique" of obedience beyond its limits.) The mem-bers of communities who are in authority are secondary causes and remain so.'Zhey act with such intelligence and competence and skill as God has given them or as they may have acquired with His talents and grace. He does not transform their imperfections and weaknesses into ggod qualities. It is true of course that He does compensate~ for them, but this is different. Yet it is in spite of these insufficiencies whether hidden or obvious that Christ continues to govern His Church through such agents. It is through them that He works out His plan of redemption. The true concept of obedience does not consist in believing that every decision imposed by those in au-thority is the only possible one in the circumstances, or the best in the absolute sense. The Church's infallibility is involved only in the order of the magisterium and not at all in the purely jurisdictional order. No doubt, of course, the Holy Spirit assists those in authority to pre-ser~, e them from making blunders in the exercise of their power. But the Holy Spirit has never promised to guaran-tee them against every blunder in the sphere of govern-ment. The possibility of erroneous decisions will always be with the Church (like certain of its other marksl). But one thing remains certain; nothing can shake it, not even the possibility of error: God wants us to obey His delegates when they give legitimate orders. The Son of God made the Church His Body; and He decreed that the obedience which began in the Head should con-tinue in the Body, such that obedience is integrated with the Church's very existence. It is a vital law in the Body of Christ. Yet for all-this our Lord did not prom-ise His ministers, governing or teaching, all the human talents that might be necessary for a task which is ut-terly beyond, them. He sought the leaders and' teachers of His early Church on the Lake of Gennesaret not in the schools or in the council chambers of kings. And the same is true today. Not all the popes are the most wise and clever or learned, or even saints. Thus the real is-sue in religious obedience will always be in the spiritual order. The point at issue is simply this, that we must re-member in our own lives the words of the Lord: He who hears you hears me. And when He uttered these words, He knew what sort of men His own disciples were; he knew the level of their training and of their intelligence; even the limits of their generosity. Yet He still said:~ "He who hears you hears me and Him who sent me,. my Father," s0 From all this it follows that until the subject comes to.see in her superior the authority of the Master, there can be no real living religious obedience that is truly supernatural. 'For the subject is asked to see the presence of Christ and His directive providence whenever the su-perior commands her to fulfill the constitutions or rules or the laws which she has voluntarily and freely taken upon herself. We can go so far as to say that if Christ Himself. were to appear at the moment a. religious su-perior is giving us a command, He Himself would either give this same command or permit it to be given for some greater good He has in mind. By entering a reli-gious community one voluntarily enters upon a training program by which she is enabled to tend to the perfec-tion of cha~:ity. She enters what Benedict called the school of the Lord's service. And like a,ny0ne in any school, she has to be taught and instructed and exer-cised to attain the end for which she entered. And that demands being placed under a master or leader, at le'ast as far as those things which pertain to the religious life. are concerned. And while this process of learning may one day be terminated, such fhat the le~ider can no longer teach the religious who may be older and moie experienced than she in religion, still the exercising of one in obedience will always be necessary so that the habitual inclination to obey will not become rusty for want of practice and exercise. The ,dims of "Religious Obedience Proceeding to the aims of religious obedience we find them to be four: (1) it cuts away solicitude; (2) it di-rects us to the fullness of charity; (3) it enables us" to ful~ fill a sacramental mission in the Church; and (4) it effects a community of service for the Body of Christ. The first aim of religious obedience is somewhat .nega-tive in tone. You are all familiar with it. It attempts to cut away the constant solicitude as to .what we should do, where we should live, and how we should direct our ® See A. de Bovis, S.J., The Church:" Christ's Mystery and Sa~ra. rnent (New York: Hawthorn, 1961), pp. 123-4. Obed~,nce VOLUME 25, 1966 + + + C. A. SchCle.Sc.kC,. REVIEW:FOR RELIGIOUS 186 lives. This we do by placing our lives in the hands of another or others who represent for us God. The ab-negation of self which is involved in 0bedi~nce is quite well defined in such a practice. As the recent decree on adaptation and renewal in the religious life has it: In professing obedience religious offer the full surrender of their own will as a sacrifice of themselves to God and so are united permanently and securely to God's salvific will. After the example of Jesus Cliristwho came to do the will of the Father, an d "assumi-ng the nature of a slave" learned obedience in the school of suffering, religious under the motion of the Holy Spirit subject themselves in faith to their superiors who hold the place of God.°1 While abnegation is involved in all obedience, in reli-gious obedience it becomes a constant and permanent dynamic and not something that is exercised only from time to time.Indeed, from a negative viewpoint, it is this constant and complete renunciation of our own will in preference to that of another wherein we find. our sanctity and wherein we find a holocaustal offering of our wills to God rather than a mere sacrificial offering of them to Him. That is why Christ in laying down the injunction for tile highest sanctity and perfection very frankly and openly said "He who would be my disciple must deny himself." 62 Without this personal abnega-tion there can be no sanctity which patterns itself after that of our Lord, that is, there is no sanctity which can call itself fully Christian. If we are to derive from reli- . gious obedience all of its fruit in the way of renuncia-tion of our own .wills, then we must subject them to the concrete will or wills of those superiors who are placed over us to mediate to us the will of God in our regard. From this it should be clear that religious obedience is established on the obedience of Christ, the following of Christ, which attained its full measure in the sacrifice of the Cross. If the religious consecration is derived from the consecration of Christ to the work of redemption, the vow of obedience has its source in the redemptive obedience of Christ. Therefore it is entirely insufficient to justify the vow of obedience by making exclusive ap-peal to the need for one authority for the organization of a life in community or for the carrying out of an ~postolate. This would be to make the mistake of con-side. ring religious obedience as merely a vehicle for apostolic activity. This notion of obedience as ordering us for community action is indeed a necessary part of religious obedience, especially in an active community, but the vow does not have for its exclusive object or Vatican II, Decree on Adaptation. Lk 9:23. end the development of obedience under the title of a purely social virtue such as is true of Marxist com-munism. It has for one of its properly religious values the task and aim of assimilating the life of the religious to that of Christ, to make pass into the person the fundamental attitude of the Redeemer. And as such it is meant to lead to the personal sanctification of the one who enters upon this way of life.°8 A second aim of religious obedience and one much more positive than the preceding is its close connection with the religious' growth in charity. We mentioned above that the practice of religious obedience differs from that of obedience practiced in a civil or natural society in that it puts us into more immediate contact with the will of God than does the latter. It is meant to bring about the perfect "unum velle" and the perfect "unum nolle" of our wills with that of Christ. For to love God is not merely to surrender or give up some-thing of our own will. It is to adhere positively and firmly to the will of the one we love~ It is to transform the willing of ourselves into that of the person we love. The more constant and actual this union of wills be-comes~: the more actual and constant does our love for this person become. And to love God means to do what He desires; it is to obey. The gospel makes this quite clear.64 That is why obedience in a religious commu-nity, which reaches to every action of a person's life, contributes so efficaciously to bring about the perfect union of wills which is the goal of the Christian life and in which Christian perfection consists. This is, as we know, Christian perfection, a union of Jove or charity or agapd, or a union in love, charity, and agapd. It is quite important that your religious understand this connection. As we have seen above, often in the order transmitted to us by superiors there'is an apparent lack of logic which at times might even seem to contradict a profound personal obedience (it goes against my con-science!). This difficulty can only be solved with love, a love that transmits and a love that accepts. The problem of obedience cannot ever be resolved in exact terms; it is more an intuition than the result of a logical proc-ess. We must frequently offer ourselves without seeing the result of our actions. This we can do only if we discover the relationship of love in obedience. It is love which provides the special intuition which makes it pos-sible [or both the one who obeys and the one who com-mands to arrive at the conclusion: I know that I can ~ See J. Galot, S.J., "R~demption et vie religieuse," in La vie re-ligieuse dans l'Eglise du Christ, p. 109. ~ Paoli, "Obedience," p. 278; Mt 22:37--40; Rom 13:I0; Gal 5:14; Jn 14:21; 15:10; 1 Jn 2:5; 3:24; 5:3. + + + Obedience VOLUME'25, 1~66 187 ÷ ÷ C. A. SchCle.Sc.kC,. REVIEW FOR RELIGIOUS 188 trust myself to her or, more exactly, to Him, We will abandon ourselves entirely to a person and to his will once we feel that his will needs no justification because we love the person. We do what he wishes because it pleases him, and all that pleases him gives us joy because we love him.65 If this is ever true, it is certainly true when the other person involved is God. Obedience when understood in this light is the supreme instrument o[ charity; and once this is truly accepted by a religious, then her obedience is not going to be merely something that pertains to one of the virtues connected with jus-tice, or'a rendering of what she owes to someone or to a community because of her having surrendered herself to it. No, her obedience will go and was meant to go beyond this. It was intended to allow her to submit her-self to the direction of another, God, not merely because she considers Him to be the commander of her life but because He is one whom she has chosen as her Spouse,. because He is one whom she loves, because He is one With whom she has entered into a marital relationship of the spirit. Thus obedience, especially in the case of the religious sister should become an occasion for her pure love for Christ her Spouse and, as such, should realize the most perfect submission possible to another, one that ends in the ecstasy of one will in that of an-other, or of the person loving in the person of the be-loved." It is only when and where a religious sister has made this her idea and ideal of obedience that it be-comes not just a means of arriving at the perfection of charity but also a concrete way in which she can show or express, sacramentalize the love of charity or agapd which, she has toward Christ. Obedience becomes a sign of charity, an act by which she adheres to the will of one whom she loves, as a bride adheres to the will and the desires and good pleasure of her husband. Unless this love enters into her practice of obediehce it can easily remain sterile or, if having sprung up, die or wither. And the grain of wheat which fell into the ground at the time of profession never really does die, as Christ uses this figure. Rather, it remains alone and never does produce the fruit which it should and which it was meant to produce by the sower who placed the seed of vocation in her heart rather than in that of someone else. Still a third aim of religious obedience is that it be sacramental, that is, that it propose to us in visible form some extremely important truth of salvation. This was true in the case of Christ who is the sacrament of God's encounter with man and man's encounter with Paoli, "Obedience," pp. 287-8. k God. In Christ not only were God and His love for man revealed, but God also showed us in Him what it is for man to commit himself unconditionally to God the invisible Father. It was only upon His rising from the dead, because of the love and obedience of His life, that the Father established Him in power, or absolutely as Christ, the sender of the Spirit. In the Church also, the extension of Christ on earth, or the earthly body of Christ, it is in the word of obedience that God's will becomes manifest to us. This is why to a certain extent in the case of religious obedience, the word of.obedience is sacramental. It is not so much a word about some-thing as rather the sign under which God's saving will in Christ makes itself present for us here and now within our history. It is in and through obedience, through the word of authority that God's saving reality can address itself to spiritual persons, calling on them for the free obedience of faith and trusting surrender of love. Sal-vation becomes present to religious in the word of obedi-ence, a word which calls for a free personal assent. 'Christ's going out from the Father into the world, a world at enmity with God because of its sins, receives a commission to bear witness to mankind's dependence and need for even more dependence upon God. Only when He had lived His Sonship through to the very end in total obedience to the Father even to the death of the Cross was His divine Sonship fully revealed. Thus it was through His human life that the abiding expression of the Son's obedience to the Father became visibly ex-pressed, and it was His death itself that was the supreme expression or epiphany of His religious surrender to the Father. This self-giving in the way of obedience through self-dispossession is the very essence of the religious com-mitment in the service of God.6~ Thus the practice of obedience as a community affair and as a personal affair is intended to be a constant and visible reminder to all who see religious that all men, all creatures will have true joy only by remaining in a continuous and permanent state of complete and entire dependence on God, a state in which the love of a creature is constantly responding to the love of the Creator, or in the case of religious women a state of de-pendence in which the love of a bride is constantly re-sponding to the love and entreaties of her husband. Man has need of this image since the relationship of man-kind with God is feminine as Scripture so often points out. This sacramentalism of obedience has been very clearly shown by St. Paul in referring to Christian mar-riage: "You married women must subordinate your- ~ Schillebeeckx, Christ the Sacrament, pp. 18--9, 28. ÷ ÷ ÷ Obedience VOLUME 25, 1966 189 4. 4. C,. A. $chleck, ~.$.C. REVIEW,'FOR RELIGIOUS 190 selves to your husbands as to the Lord. For a husband is the head of his wife just as Christ is the head of :the Church which :is his Body and is saved by Him. Just as the Church is in subjection to Christ, so married women must be in everything subject to their hus-bands." a~ As we mentioned when speaking of virginity, the marriage of the virgin.with Christ is the prototype or the model or exemplar of that existing between husband and wife. Thus the submission and obedience of the virgin of Christ to her Lord is to be the model or sacra-ment for all Christian men and women and also for the whole body of redeemed and unredeemed mankind, since this is called to relationship with Christ as His body-person, as His immaculate spouse, wedded to Him 'forever in undying love and submission or surrender, as He is to His Father, Thus there is a sacramental reality attached to the religious obedience of the woman that is not present in the case of the man. And it is this very ¯ modification which can make the practice of obedience something powerful and attractive. And it is this sacra-mental purpose of obedience that meets the need of the Church today. For it is more important than ever to show that obedience is universal in character ~and be-longs to the very, life of the Church. Religious life is not just an "extra, with regard to the Christian life; it is its mOSt~ striking .visible manifestation. Obedience brings to it the completion of our baptismal faith or perfects the consecration proper-to baptism,as If religious life and particularly obedience are to be truly a manifestation of the Christian. life in its perfection, then they must be truly radiant, .truly perfect. Only then~ will they serve their purpose for .existence in the Church; only then wil! they be 'truly alive and dynamic in the Church.a9 It is because of this sacramental aspect of obedience in ~ Eph 5:22 ft. ~ "Thus the profession of the evangelical counsels is a super-addition to that consecration which is proper to baptism. It is in-deed a special consecration which perfects the former oue,.iuasmuch as by it the follower ~f Christ totally commits himself and dedi-cates himself to God; thereby making his entire life a service to God alone" (Paul VI, Magno gaudio a~ecti; REVIEW VOR RI~LXGIOUS, V. 25 [1964], pp. 699-700). See also the Constitution on the Church, Chap-ter 6, n. 44; REVIEW VOR R~LIclous, v. 24 (1965), pp. 714-5; and J. Laplace, ':Education to Obedience," pp. 68-9. ~.This note of "sacramentality" should be seriously considered in all changes and adaptations. It is said that regularity weighs much less on young religious today than ever before. Remarks about re-ligious exercises are rather disparaging. They are considered quite out-of-date or naive~most probably because the values of these things have not been clearly presented. As one author remarks: "It is quite evident that we are suffering from a very evident lack of clear principles presenting valueJ behind certain religious exercises and regularity." We know that when values are not seen neither are the exercises. See M. Belanger, O.M.L, "Donum Dei" 3, pp: 106-7. religion that those who obey should obey as though they were obeying Christ or as the New Testament has it, "as to the Lord." 70 Those who are obeyed shot~ld find the pattern of their conduct in the love and care of Christ, and they must also remember that they in tLirn owe obedience to Christ also. It is in this way that subordination will be met by love and concern. To un-derstand the aims of obedience thus far discussed in this light would seem tocorrectly place obedience in our striving after the perfection of charity. It would give to both superiors and to subjects their respective roles and attitudes and mentalities towards this practice: It points out that the first and chief concern of all superiors, es-pecially major, is the. leading of their subjects to inti-mate union with God. Their primary duty is not the un-raveling of the material and °temporal and financial difficulties of their office nor the successful carrying out of the external apostolates and activities entrusted to the congregation or order. It is to "lead their subjects to God. It is only to the extent that they fulfill this duty that they are making their greatest contribution and gift to God, to the Church, and to their own religious family. To destroy or forget this role of the superior in a religious community is to destroy the [amily atmos-phere that God intended to characterize every religious society. For a superior can too easily become a purely juridical figure or image, one who gives out permis-sions of one kind or another or one who is merely an ad-ministrator, one who organizes the community's work and policies. And then she very quickly loses her primary role, that of being a mother to those of her daughters whom God's providence has placed under her direction so that they might be helped to the perfection of char-ity by reason of her having been in labor until Ghrist was formed in them. It is only when authority is sus-tained by love that it becomes authority in the real and true sense of the word. For only then can it look to God and to the love of God as its real foundation. For His authority is always ultimately a loving authority,~ even when it punishes or corrects.71 It is true that you can say that your religious when taking vows knew that a great sacrifice would be expected of them, the re-nunciation of their wills, their families, the happiness of marriage, and the intimacy of a family and horiae. But all this is a sacrifice, and your own religious because they are usually among the most high-souled and gen-erous women in the Church feel it most keenly. It is most impo.rtant that this element of love be inserted into Eph 5:22. The States o] Per[ection, p. 324. + + + Obedience VOLUME 25, 1966 ]91 th~ exercise of authority in your-case; for as Pius XII re-marked once in speaking to superiors of religious com-munities of~women: It is no doubt true as psychology affirms that the woman in-vested with authority does not succeed as easily as a man in finding the exact formula for combining strictness with kindness and establishing the balance between them. That is an added reason for cultivating your .motherly sentiments.7' Where this spirit is present, you can be assured that the overall characteristic note of religious discipline and" obedience will be found both in the individual houses as well as in the community at large filial confidence and family warmth. It is this :spirit which includes com-plete embracing of rules and customs that lessens your own burdens and is so, conducive both to your own most ardent desires as well as those of your ~eligious the personal and corporate sanctification of all the members. You will always find that where there is mu-tu~ il conviction of'good will, a true family spirit in which.the authority of those in charge is respected and the needs and the different temperaments of those working with those in charge are taken into considera-tion is always present. And it is only this presence that can make of an individual house or an entire com-munity what it was meant to be in the sight of the en-tire Church and world: a training ground and a proving C. A. Schleck, REVIEW FOR RELIGIOUS ra Address to Mothers General, 1952; The States of Perfection, p. 217. When I speak of a mother-daughter relationship, I am not advocating a type of relationship that begets or retains an emo-tional infantilism. This has been defined as "a persistence of re-sponses in an adult that indicates a manner of coping with needs and reacting in a way that corresponds to the psychological attitude or modality of childhood" (M. Oraison, Illusion and Anxiety [New York: Macmillan, 1963], p. 133). There is an exaggerated dependence with fear of responsibility and an unreasonable need of affection and approval. It is often this last need for affection and approval ~hat has given rise to much criticism from subjects who feel mature and yet are the most insecure members of the communityl This in-fantilism comes most often from inadequate home training. And how is religion to cope. with this? It can be done, but it is not easy. God did not allow religious institutes to come into being for the specific purpose of training emotional infants. The family is th~ unit established for thisI As Pius says: "A religious house differs ~rom the family home; it is not the same and does not try to be, because within its walls zeal for dedication and self-denial for the love ~of Christ, and the austere penitential practices [I think he would say possible todayl] involve some measure of discomfort and pain, N~vertheless, as far as possible the religious house shall en-deavor to become a loved family home for each one of the com-munity. And undoubtedly this will be' achieved more easily if all alike respect the foundation structure of the natural virtues which ~requently are the proof of abundant supernatural vigor and splendor" (Address to Discalced Carmelites, 1951; The States oI Perfection, p. 204). ground for sanctity, a kind of an ante-chamber to the beatific vision. Still a fourth aim of religious obedience is the effec-tive building of a community of service for the needs of the Body of Christ. While we cannot and must not make the efficiency of the external .apostolate or the creation of a well-ordered community the exclusive end of the prac-tice of religious obedience, it is nonetheless an end and an important one. This results from what we saw above of the very nature and purpose of authority-itself---the creation of the common good or the good of the com-munity. The Church exists as a mystery of communion, of the many in the one Body of Christ. In the building up of Christ's Body the different members have different functions to fulfill, functions which are meant to build up and unify the whole human race which is called to be part of the catholic unity of the People of God. It is especially through the practice of obedience that reli-gious are brought into community both to be a sigh'of the perfect community of love, the community of the earthly Church and that of the pa.rousia, and also to be at the service of the Church. All the energies and tal-ents and training of the various members are ordered and dovetailed tO be put at the service of Christ and His Church. In fact it is quite true to say that the theol-ogy of obedience and authority is in a special way a theology of unity~and communion. Such a spirit is so welcome in an age when we.are trying to correct some of the deviations which may have unintentionally crept into religious obedience b~ a heavy concentration on its legal aspects. While it is and will always remain very necessary for both superiors and subjects to know exactly and precisely what is involved in the canonical prescriptions of obedience or that amount of obedience without which the community or society could not possibly hope to achieve its objectives, it still remains the function of superiors to urge and of subjects to strive to attain the perIection of obedience or the spirit of obedience. Whereas canonical obedience prescribes and .correcdy sets very ~definite limits to the minimum practice required of the members of a reli-gious society, perfect obedience ,inclines one to look upon everything contained in the religious life as an op-portunity by means of which the members can bring their 'wills and their persons, their whole persons, into perfect accord with the will and the heart of Christ and His Church. It will tend to make them attain the ulti-mate end for which they enter religion--to suppress all selfishness of their special points of view and rejoice to be hsed for the one great work of the redemption of the human race. While it is true that in the last analysis + 4. + Obedience VOLUME 25, 1966 + + ÷ C. A. SchCle.Sc.kC,. REVIEW FOR RELIGIOUS 194 it is the individual religious who will ultimately choose which of the two extensions of obedience she 4s going to take as her rule or norm--minimal obedience or per-fect-- authority does have much to do in shaping or forming a religious to one or other point of view. If authority continues to build up during the years of formation and also afterwards a greater awareness of the aims which we have just presented, it is much more likely that each religious would realize more and more as the years of her life pass by the promise of our Lord Himself to those who consent to follow Him closely: "My ~oke is sweet and my burden is ligh_ t." 7s How simply has all this been stated in the decrees of the Vatican Council: ¯. in order that he might derive greater fruit from his bap-tismal grace, he decides to free himself by his profession in the Church of the evangelical counsels from the impediments which might keep him from the fervor of charity and from giving God a perfect worship . Since the evangelical counsels by reason of the charity to which they lead, unite those who take them to the Church and her mystery in a special way, the spiritual life of those taking them should be consecrated also to the good of the entire Church. in accord with their capacities and the nature of their vocation . " In professing obedience, religious offer the full surrender of their own will as a sacrifice of themselves to God and so are united permanently and securely to God's salvific will. After the example of Jesus Christ who came to do the will of the Father and "assuming the nature of a slave" learned obedience in the school of suffering, religious under the motion of the Holy Spirit, subject themselve~in faith to their superiors who hold the place of God. Under their guidance, they are led to serve all their brothers in Christ, just as Christ Himself in obedience to the Father served His brethren and laid down His life as a ransom for many. So they are closely bound to the service of the Church and strive to attain the measure of the full manhood of Christ. Religious, therefore, in the spirit of faith and love for the divine will should humbly obey their superiors according to their rules and constitutions. Realizing that they are con-tributing to building up the Body of Christ according to God's plan, they should use both the forces of their intellect and will and the gifts of nature and grace to execute the commands and fulfill the duties entrusted to them. In this way religious obedi-ence, far from lessening the dignity of the human person, by ex-tending the freedom of the sons of God leads it to maturity. Superiors, as those who are to givaen ~ account of the souls entrusted to them, should fulfill their office in a way responsive to God's will. They should exercise their authority out of a spirit of service to the brethren, expressing in this way the love with which God loves their subjects. They should govern these as sons of God, respecting their human dignity. In this way they make it easier for them to subordinate their wills,~ r~Mt 11:30. Vatican II, Constitution on the Church, Chapter 6, n. 44; R~- wrw roa Rr_meious, v. 24 (1965), p. 714. Vatican II, Decree on Adaptation. The Qualities oI Religious Obedience Under this partic~ular heading many various consider-ations could be taken up. It seems best, however, to limit ourselves to a few by reason of their special con-temporaneity or timeliness: supernaturalness, interior-ness, and activeness. The Supernatural Quality o[ Obedience Perhaps no other quality of religious obedience seems to be suffering more today than that of its supernatural-hess. So many questions about and so many defections from the religious life, especially among older reli-gious, would seem to hinge on the motive because of which they live the religious life. This must be, funda-mentally at least, supernatural. And if religious obedi-ence is to be supernatural, then subjects must learn to obey, to carry out the tasks to which they are assigned and the rules and constitutions because these things represent for them the will of God, at least permissive, here and now. The pleasure or 'lack of pleasure that such an action gives or might give should not be the con-trolling motive; nor should the agreeableness or disagree-ableness of the person giving the command or making the decision; nor should the hope of some reward or advancement or fear of reprisal or anything such. The controlling motive in religious obedience should be: God has asked me to do this. The decisive reason for which we owe obedience to religious superiors is the authority invested in them by God. This authority is a supernatural qual!ty and is distinct from all qualities that may adorn a superior in the natural order. In.a sense it belongs t6 the order of charisms and is conferred by God through proper channels for the good of the religious commu-nity. It belongs to the order of faith both for the superior who needs more than the light of reason to recognize it and for the subject who comes to see God in the supe-rior by calling on his faith and who can come to tr6at the superior as God's representative only with the help of filial piety that is entirely supernatural.TM It belongs also to the order of love. For religious are urged to constantly strive to look beyond their superiors, direct-ing their obedience to the source of all authority, God, and to do so out of love and for love. As we have seen, the purpose or aim of obedience is to promote the growth of love; and love, in turn, is intended to enliven obedience and make it more fruitful. As our love grows deeper, so will our obedience to the great benefit of our own interior lives and to the incalculable profit of those who come under our personal influence. The true liberty ~6 Belanger, "Donum Dei" $, pp. 122-3. ÷ ÷ ÷ Obedience VOLUME 25, 1966 195~ 4. 4. 4. C. .4. $chleck, C.S,C. REV1EWFOR RELIGIOUS 196 of a religious consists not in initiative and responsibil-ity nor in terms of independence, at least primarily; it consists in perfect dependence on God, a dependence that is voluntary and cultivated as actively as possi-ble. For who is less a slave than a will that is truly mas-ter of the lower appetites and that has once and for all given itself entirely to the supreme good. It is Charles de Foucauld who once remarked that Christ took the lowest place in such a way that no one can ever take it from Him. This desire to be forgotten and unknown in loving imitation of the rejected Christ still represents the highest reach of Christian asceticism. There is no question, of course, of shrinking from great apostolic works or wasting one's talents. We are speaking of an attitude, a willingness to be content with the task as-signed, and of preference for the lower or less esteemed, when God's glory would permit such a choice.77 This is the ideal motivation to be looked for in regard to religious obedience. Yet if we are to believe reports and experience, it is much more difficult to achieve today than before.7s We seem to be faced with an acceptance of submission that is based on or conceived of in terms of sensitive interpersonal relationships, of liberties and rights to be safeguarded, of discussions with superiors, of private initiatives to be exercised, and, in the, case of some at least, of necessary resistance" to legitimately ex-ercised authority--a kind of religious sit-in. Again we find that there is a good deal of insecurity in the present generation of young people coming to us, even though this may be masked by an apparent confidence and poise, even forwardness. This insecurity, plus the brain-washing they receive through the various media of com-munication, tends to impel them to seek status. This is not always, perhaps not even usually, merely a selfish want. It is a genuine need for a position of security that will assure them of the esteem and support 0f others. Young religious, especially in communities in which counseling or nursing or teaching or other professional work is generally done, manifest considerable anxiety about possible prospects of being assigned to advanced study and also notable frustration and depression if they are passed over. Despite the democratic myth, status positions are a very prominent feature of our society. The only difference between now and before was that yesterday status was rigid; it was that into which you were born; today it is mobile, it is what you make it. Yet it is there as a frenetic push up and down some ladder reflecting insecurity and acting as a feedback to increase 7~ L. Bondy, C.S.B., "Donum Dei" 3, p. 153. ~ G. George, S.J., "Donum Dei" 3, pp. 82 ft. it.TM In the novitiate it may be piety--provided it is not too eccentric--whereas in the juniorate and later on it may be professional excellence even to the point of this becoming a kind of neurotic ambition. The real author-ity figures are the professors or teachers who replace the novice mistress or even juniorate mistress. And the area of competition and prestige shifts from spiritual competence and excellence to excellence in studies,s0 Again, we also find that after some years of profes-sional service in one or other of the apostolates of the community, the supernatural motivation has either not grown at all or has even notably regressed. And then obedience has become for such members only a trial, only a series of fetters and frustrations, so that psy-chologically they become convinced that the community and the religious life is more of a hindrance than a help not only professionally, but also spiritually, that is, in their striving after the perfection of love of God and neighbor. And we all know that there is nothing more painful than to see certain religious lose even the pri-mordial meaning and motivation of their vocation and forget the why of their presence in religious life and fall more and more into a state of regret for having entered and of irritation,sl In fact we can say that the really crucial moment of religious life comes some ten or fif-teen years after entrance, and it usually revolves on the question of obedience. The dream of perfect surrender if it was present earlier appears for what it really is, a daily cross even for the most holy. A less painful solu-tion than sanctity or defection is always at hand---the path of comfortable mediocrity. The problem is solved by simply lowering the ideal, often seeing it primarily or exclusively in terms of sociological and psychological terms and structures and solutions. The motives learned in the early years of formation lose their cogency, and they become an encumbrance rather than a help.s2 As a result of these problems brought about by the societal structure of today there is a growing tendency to feel that reasons must always be given a subject every-time she is asked to do something or given an assign-ment. And this is supported by the argument that only ~See V. Packard, The Status Seekers (New York: McKay, 1959), p. 253. so If this is not handled carefully by those in charge through constant education, formal and informal, intense inner conflict and confusion can result. The tensions in some community juniorates and scholasticates would bear out this idea of "value conflict." s~ Much of this is brought on by changes in outlook and by cer-tain crises considered in our treatment of virginity and to be men-tioned further on in this article. s~ Later on in the part on practical suggestions we shall see what can be done to forestall this occurrence. Obedience VOLUME 25, 1966 197 4. c. ~. S~hled~, REVIEW FOR RELIGIOUS that authority is really strong which obtains consent and participation rather than mere compliance. To give orders is easy but to obtain commitment and intellec-tual and intelligent participation is a major challenge. It is an inescapable responsibility of authority and one which can easily be overlooked. If this principle is used within limits (and I think that it has been oftenS3), it is true and can be followed with-out harming the supernatural motivation of religious obedience. But to make this principle apply at all times and in all circumstances, and especially within the con-text of strict parliamentary procedure and democracy, would exceed its applicability and would indeed destroy the very nature of religious obedience. Every attempt to reduce the relationship between superior and subject to one of mere dialogue between the two, a dialogue in which the subject would not be really obliged to follow the decision, or one in which the subject would be always allowed--by the v.ery nature of the contract--to make his own choice, would destroy the whole notion of obedience and render the relationship between superior and subject within a religious context meaningless. As Plus XII mentioned in an address to a general congre-gation of the Society of Jesus in 1957: And those persons are straying far from the truth who consider that the teaching of the Letter (St. Ignatius' Letter on Obedience) is to be abandoned, and that in place of hierarchical and religious obedience there should be substituted a certain "democratic" equality which would permit the subject to discuss with his superior until agreement between them is reached.~' It is true that where one carries out a command or obeys a constitution or rule which he thoroughly under-stands and with which he is heartily in agreement, there is no question of disobedience. But neither is there necessarily an act of the virtue of obedience. It is quite possible that the subject does what she is given to do from motives that are simply natural or human. And this particularly if training along the lines~.of supernat-ural obedience has never been insisted on. The habit of always giving the reasons for obedience or of point-ing out the reasonableness of the command or assignment given could easily cause a psychological stance that would make the reasonableness of the command and the fact that we both agree on this a condition for obey-ing. Then the virtue has been dethroned, and the per-son could be placed in a precarious vocational situation ~This is used well by A. Greeley, "Fraternal Authority," pp. 562-5. ~ The States of Per]ection, p. 295. This is "selective obedience" at its worst. See C. Davis, "A Catholic Obedience," America, Novem-ber 7, 1964. as far as perseverance is concerned. For there are and there will always undoubtedly be situations in religion when a person will come under a superior who does not wish to or who cannot always give reasons or point out the reasonableness of something which has to be done. For sometimes, to point out the reasons would mean the violation of a secret (the reputation of another member of the community) entrusted to a superior only in virtue of her office, and perhaps after much prayer and reflec-tion, on the part of a subject. I am not saying that reasons should not be given and even frequently, perhaps. For supernatural obedience to really take effect, the formation of the natural on all levels (and not just will-power formation) must also be present. Candidates of 17-18-19-20 are in full adoles-cent development. They are products of today and the societal structures of today; and there is nothing to be gained by closing our eyes to what they are or what they come from, all that I have-mentioned above, demo-cratic environment, a milieu of status-striving, an at-mosphere of constant questioning, and striving for inde-pendence. In fact, we can even ask ourselves seriously whether or not the cultural determinants in the United States today do not make it much more difficult for the majority of young religious to ever arrive at real ex-cellence in the supernatural practice of obedience. At least it is more difficult to arrive there. And superiors and those in training programs must accept this fact.s5 Thus it is very useful and necessary to give specific rea-sons for which things are done to facilitate obedience in the subject (to enlighten their minds before they act), to increase maturity, and even to prevent criticism. Thus the natural good and the spiritual good of the subjects dspecially in the very early training years would dictate that such a policy could and should be followed. But as the theology and meaning of religious obedience is ex-plained to them, occasions, not artificial or contrived but natural and arising out of circumstances, should be given to subjects when they will not be given the rea-sons why they are asked to do this or that. These of course should be given according to the capacity of each subject. This grad~4al training will most likely be much slower today. What we regard as alarming and perhaps a symptom of decline in regard to religious motivation and the nature of the young girl is a retarded appearance of a rather normal adolescence crisis centering around the struggle for independence from authority. Likewise in the case of older religious passing through an obedience crisis (usually around the mid-thirties), you s~ G. George, S.J., "Donum Dei" 3, pp. 82-$; L. Bondy, ibid., pp. 151-2. 4- 4- 4- Obedience VOLUME 25, 1966 ]99 4- REVIEW FOR RELIGIOUS will find pressures making it extremely difficult for them to'respond in an ideal way. She must be helped through this to a deeper and more mature self-gift in and through obedience without sacrificing the essentials of the super-natural quality of obedience merely to keep peace in the family or keep a restless section of the community pacified. Thus the real danger in regard to the supernatural quality of obedience today lies not in the acceptance of the subjects as they are at various stages of personal and cultural development (for this is necessary), but in superiors not willing or a[raid to make the effort to lead them higher and [urther, to a more per[ect supernat-ural obedience as described above. Religious obedience like everything else that pertains to the order of grace is very ofte6 mysterious and demands a deep spirit of faith. Faith, however, is of things that are not seen, of things that lie beyond the grasp and comprehension of mere human reason. They pertaiia to another order of things, the supernatural order, the order of eternity or God in time, and consequently must remain mysterious. Not to train a religious gradually and in keeping with her capac.ity to live in this order would be to destroy the supernatural spi.rit that must lie at the very root of reli-gious obedience.8~ The In~erior Quality o[ Obedience A second quality that must characterize religious obedience and that stands in need of clarification today is its inter.iorness, For obedience to be truly interior, one that touches the very heart of man and not merely a mechanical exterior compliance with directives, it must touch both the will and the intellect. In fact, exterior obedience should be the crowning action of religious obedience embodying and giving visibility to the interior obedience of the will and the intellect. So often obedience of the will is badly misunderstood. It is taken as dying to self-will or as annihilating one's will. This is true if we speak of the specifically selfish in the will, its ill-regulated aspect, But in another and perhaps far more accurate sense obedience per[ects the will instead of suppressing it. It is not a passive virtue consisting in not-wanting. It is positive and active and is meant to consist in wanting as intensely as possible ~The greatest thinkers, often those who have personally suf-fered much from authority, have generally been its staunchest de-fenders and the most supernaturally obedient of men. Teilhard de Chardin i:ould write: "In spite of Rome's having its own r~asons for judging that in the present form my concept of Christianity may be premature or incomplete, I am resolved to remain a child of obedience." what God wants. And in this it finds its highest perfec-tion ~nd fulfillment. The will attains its perfection when it is in possession Of its object, which is the good; and the greater the good, the more is the will perfected. Since the divine will is the object of the human will in religious obedience, the human will is perfected in a supreme degree. In a sense, then, obedience of the will is meant to touch and fashion the whole heart so that a religious ever more fully obeys as life progresses, not through constraint but rather through a connatural in-clination or through that inclination which comes through the gradual growth of the virtue. Just as the eyes are instinctively attracted by beauty of sight and the ears by beauty or harmony of sound, so too the will of a re-ligious should as the years pass by become more and more connaturally attracted by the good which it finds in obedience to God. A religious obeys or should obey because she recognizes the right of another to'command her and because she wishes this other person to have this right and because she loves the order that has been given. Only the supernatural virtue of obedience can bring about this love of authority and command in the life of a religious, and this is not an easy task. It is a constant struggle, but it is something that she should be aiming at from the moment that she embraces this life. And it will certainly grow in the religious who co-operates with all the graces given her in this regard. Obedience so understood does not consist in con-straint, It is rather a free act which alone has full value before God. And it is a kind of sacramental embodiment of the stance of our Lord: ,I lay down my life; no one can rob me of it; for I lay it down of my own accord." 87 In fact we might note that it is to facilitate this obedi-ence in freedom that in nearly all communities the rules and constitutions do not of themselves oblige under pain of sin. It is with this object in view, to draw' out,of subjects a free and voluntary obedience, that most supe-riors today prefer to request rather than to issue strict commands.88 When we come to the other side of interior obedience, obedience o[ the intellect, we touch on a problem that can easily present extreme difficulties both for subjects and for superiors. We have often heard it said that for obedience to be perfect it demands the submission of one's judgment as well as of one's will. This has to be understood carefully, however, Often it is understood to mean that the religious is forced to abdicate her judg-ment and the normal exercise of her intellect. Yet when + + 4- Obedience 8*Jn 10:17-8. ss R. Morency, S.J., "Donum Dei" 3, pp. 16~-5. VOLUME 25, 1966 4. C. A. $chleck, REVIEW FOR RELIGIOUS correctly understood, religious obedience, just as it re-spects the normal orientation of the will, also respects the normal orientation of the intellect. What religious obedience demands is that we submit to others, the rules and constitutions and legitimate authority, our prac-tical judgment at all times, save where an obviously sinful action is prescribed. It also requires that we sub-mit our speculative judgment when this is possible. I say "when this is possible" because what is sacrificed by religious obedience is our speculative judgment. But if there happens to be an instance in which the judgment to be made is not ours to make but is dictated by norms or laws or principles extrinsic to us (and well-qualified norms), then we cannot sacrifice our judgment nor do we have the right to sacrifice it because the judgment in this case is really not ours to give. Such would be the case in the following rather obvious examples: two plus two equals five, or square pegs are best put into round holes. Our speculative judgment could not pos-sibly make us accept these judgments simply because they are not ours to give. They are dictated by norms extrinsic and objective to ourselves which we cannot change and have no right to change. Thus obedience of the judgment does not consist in our bowing before every decision of superiors without judgment of any kind. Quite the opposite. Obedience of the judgment requires the exercise and the use of one's judgment. Nor does obedience of the judgment de-mand that we think the same as our superior thinks or that we judge to be most perfect in itself all that the superior commands, speculatively speaking. The supe-rior is not infallible and can make mistakes. She can at times act imprudently and even unjustly,s° This difficulty, while perhaps rarer in the past because often superiors were far better educated than their sub-jects, is one that is frequent in religious life today. Many subjects have as good, if not better, training in their fields of work than their superiors. We may have a superior of a community engaged in hospital work who ¯ has never been trained in the field. It is quite likely that the problems of the religious engaged in that work will not always be understood by her or handled in the wis-est and most prudent manner. Or we have a superior of a house of philosophy or theology who has spent his en-tire priestly life in parish work or in the field of mis-sionary endeavor. It is quite possible for such a person to make decisions which the subjects, let us say the fac-ulty members, know by their own experience of years of teaching not to be the most prudent or wise. To such Ibid., pp. 177, 162. judgments and decisions no subject can yield his or her speculative judgment simply because he or she does not possess the right or the ability to yield or to make this judgment conform to that of the one in charge. Obedience of judgment, then, does not demand that we canonize all the actions of superiors nor obey be-cause and to the extent that the command is reason-able as this is usually understood. It demands that she recognize this principle: "It does not belong to me to make the decision; it belongs to the superior." Thus a religious cannot regulate her own will or what she does by her own judgment but by the judgment of the su-perior since it is this judgment that she has taken as her rule of action in the practical here and.now situation. She sees in it the designs of God Himself directing her to the end which He has set up foi- her from all eternity. By obedience she vows to give up acting on and accord-ing to her own judgment independently of superiors, which is not the same as giving up the right to make a judgment or to form one. To give up this right would destroy the liberty and freedom and the voluntariness which is so essential in making religious obedience the holocaustal offering of one's will to God. For obedience is not simply a mechanical action on the part of a hu-man person. It is a most personal action and therefore should be freely accomplished. It is an action in which the subject [reely adjusts her will to that of the superior. TO obey without having' moral certitude that such an act is licit is immoral simply because a person is respon-sible for all that she accomplishes, even of that which she does out of obedience. Here, of course, we must be cautious. To establish that an order is legitimate does not take long reflection. In fact, if there is long reflec-tion about the legitimacy of a command, it is usually a sign that the person is psychologically disturbed or hy-percritical and is not an appropriate instrument to de-termine if in the concrete an order is or is not legiti-mate. However, wherever there is question of mere opinion, then obedience will incline us to follow the opinion of the superior to the extent that this is possible. Often-times the position of the superior on something or other is somewhat doubtful, some reasons in favor of it, others opposed. In this case obedience of judgment asks that we consider rather the favorable reasons and be not too strongly attached to the possible objections, that is, if we are to assure a more perfect agreement of will and of judgment. This case often happens in regard to the more practical cases of action, assignments, and so forth, where the superior has a much wider acquaintance with all the factors involved in the decision, ,factors which 4- 4- 4- Obedience VOLUME 25, 1966 2O3 ÷ C. A. $chleck, REVIEW FOR RELIGIOUS subjects cannot see because of their limited vision, fac-tors which affect individuals of the same or different houses or even persons outside the commfinity. Very of-ten a superior is faced with the alternative of the lesser of two evils. We should note that a truly obedient reli-gious wishes that the superior should be right and is always ready to renounce her own will and opinion with ease insofar as it is simply her own. This as we realize demands intense virtue, but it is a goal which every religious should be working to reach. As for "blind" obedience it must not be thought to consist in seeing nothing; rather it consists in submitting one's practical judgment to that of the superior even when the action commanded or the decision indicated to be followed is truly unreasonable from the merely human point of view. For the religious then obeys not becau
Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.
This doctoral dissertation evaluated the use of sustainable biomass sources (agri-food waste and residues, and industry streams) in anaerobic digestion with the goal of replacing maize silage in a large-scale biogas production and investigated alternative pathways of biogas utilisation incorporated in energy systems operating with high share of renewable energy sources. The methods applied in the research included elements of chemical and mechanical engineering in order to create a holistic approach that could be applicable to various biogas plant cases. Experimental investigations showed the biogas yield of residue lignocellulosic biomass of 0.192-0.275 Nm3/kgTS, and bulk food waste of 0.252-0.566 Nm3/kgTS. Meat and bone meal and wastewater sludge were shown to be co-substrates with antagonistic effect in biogas production, however they increased the reaction rate of overall degradation. Pyrolysis of digestate showed lower energy requirements and higher biochar yield (38%) compared to direct pyrolysis of lignocellulosic biomass (24%). The gate fee business model for receiving biodegradable waste and the implementation of new technologies, namely biogas upgrading, are the most likely options for biogas plants in the future. A robust mathematical model of power-to-gas integration showed that the installation of 18 MWel of wind and 9 MWel of photovoltaics with an additional import of 16 GWhel from the grid could produce 36 GWh of renewable methane which could be economically competitive with natural gas if the feedstock gate fee in the proposed system was -120 €/t. Geospatial availability of an energy potential of biogas production from examined feedstocks, combined with Life Cycle Assessment of the alternative biogas utilisation pathways created the synergistic effects in terms of reduced environmental burdens by 4-36 times compared to the current operation. Based on the applied methods and outcomes of the doctoral thesis, the research hypothesis "Applying holistic approach on biogas plants, both on the production and utilisation side, can increase economic profitability and environmental benefits over current subsidised operation" was tested and confirmed. The economic feasibility of biogas plants after exiting subsidy schemes will include the implementation of the gate fee business model for substrates, new investments in biomass pretreatment lines, increase of on-site biogas storage capacity and additional investments in renewable methane production system, primarily biomethane. Environmental burdens of such actions will be reduced through a contribution of biowaste management on urban and rural level, combined with the utilization of biogas for production of biomethane as a replacement to natural gas. ; Biomasa je obnovljiv izvor energije (OIE) te ima važnu ulogu u diverzifikaciji opskrbe energijom u Europskoj Uniji (EU) [1]. Ona doprinosi ravnoteži ugljikovog dioksida (CO2), stvaranju radnih mjesta, smanjenju emisija stakleničkih plinova (eng. Greenhouse gas, GHG) te osiguravanju dostupnosti resursa i njihovom ekonomičnom gospodarenju [2]. U Republici Hrvatskoj biomasa je definirana prema Zakonu o obnovljivim izvorima energije i visokoučinkovitoj kogeneraciji kao "biorazgradivi dio proizvoda, otpada i ostataka biološkog podrijetla iz poljoprivrede (uključujući tvari biljnoga i životinjskoga podrijetla), šumarstva i srodnih proizvodnih djelatnosti, uključujući ribarstvo i akvakulturu, kao i biorazgradivi dio industrijskoga i komunalnog otpada" [3]. Biomasa se može direktno koristiti kao gorivo za dobivanje energije (npr. drvna biomasa u kotlovima), ili se može biokemijskim, kemijskim, ili termokemijskim postupcima pretvoriti u materijal dodane vrijednosti – biogorivo, čime se postiže njezina šira primjenjivost u energetske svrhe [4]. Biogoriva prve generacije dobivena iz prehrambenih usjeva kao uzgojene biomase [5] naišla su na neodobravanje znanstvene zajednice i šire javnosti, primarno zbog korištenja obradivih površina za njihov uzgoj. Napredna biogoriva (druge i treće generacije [5]) proizvedena su iz biomase koja nije kompetitivna s proizvodnjom hrane, a u nju spada otpadna biomasa iz kućanstva i industrije, poljoprivredni ostatci, neprehrambeni usjevi te alge. Ova doktorska disertacija stavlja fokus na korištenje biomase u procesu anaerobne razgradnje za dobivanje bioplina. Cilj istraživanja je ostvariti sinergijski učinak između ekonomičnog korištenja otpadne biomase i proizvodnje energije u sustavima s velikim udjelom OIE kako bi se postiglo smanjenje utjecaja na okoliš u usporedbi s trenutnom praksom u bioplinskim postrojenjima koja uključuje korištenje kukuruzne silaže i proizvodnju električne energije uz zajamčenu otkupnu cijenu. Mjesto nastanka, tip biomase, te njezine količine bitan su faktor za strateško pozicioniranje novih bioplinskih postrojenja, te za planiranje novih lanaca opskrbe sirovinama u postojećim postrojenjima. Geografski informacijski sustav (eng. Geographic Information System, GIS) [6] prepoznat je kao vrijedan alat za mapiranje potencijala izvora biomase, kao i određivanje transportnih udaljenosti od mjesta nastanka biomase do postrojenja. GIS analiza na razini EU pokazala je ukupni energetski potencijal za proizvodnju bioplina iz poljoprivrednih ostataka i životinjske gnojovke na godišnjoj razini jednak 0.7 EJ (oko 195 TWh) [7], što je dvostruko više nego proizvodnja bioplina iz tih supstrata ostvarena u 2016 godini u EU. Primjenom GIS alata na lokalnoj razini u Grčkoj, Sjedinjenim Američkim Državama i Finskoj pokazano je da ekonomski prihvatljive transportne udaljenosti za supstrate mogu varirati između 10 i 40 km [8–10]. Povećanjem radijusa raspoloživosti biomase povećava se i kapacitet postrojenja čime je moguće ostvariti veću proizvodnju obnovljive energije, no istovremeno stvara se dodatan teret na okoliš, kako je još uvijek većina biomase transportirana teretnim vozilima na fosilna goriva [10]. Ono što također treba uzeti u obzir prilikom procjene korištenja biomase u bioplinskom postrojenju je njezina tržišna vrijednost, odnosno plaća li bioplinsko postrojenje za biomasu, ili dobiva naknadu za njezino gospodarenje (eng. Gate fee, GF). U postojećim okvirima proizvodnje bioplina, cijena kukuruzne silaže je između 15 i 40 € po toni sirovine [11], dok alternativni izvori biomase (npr. miješani komunalni biootpad i otpadna hrana) postižu GF u iznosu od -60 do 0 €/tona [11]. Nakon što biomasa uđe u prostor bioplinskog postrojenja, potrebno ju je adekvatno pripremiti za proces anaerobne razgradnje. U tu svrhu mogu se koristiti metode predobrade koje se služe termičkim, mehaničkim, kemijskim ili biološkim postupcima (ili nekim njihovim kombinacijama) [12]. Metode predobrade služe kako bi potaknule proces razgradnje kompleksnih polimernih molekula prisutnih u organskoj tvari, čime se postiže viša konverzija biomase u bioplin [13]. Uspješnost razgradnje biomase te proizvodnje bioplina, kao i stabilnost u procesu određuju se eksperimentalnim mjerenjima, pri čemu se prate procesne varijable kao što su sadržaj suhe tvari (eng. Dry Matter, DM, ili Total Solids, TS), proizvodnja i sastav bioplina, pH, koncentracija hlapljivih masnih kiselina (eng. Volatile Fatty Acids, VFA), ukupni anorganski ugljik (eng. Total Inorganic Carbon, TIC), prisutnost amonijakalnog dušika (eng. Ammonium-nitrogen, NH4-N), koncentracija soli, teških metala i ostalo [14]. Na temelju vrijednosti navedenih procesnih varijabli operatori bioplinskih postrojenja znaju odvija li se proces unutar dozvoljenih vrijednosti te kako reagirati ukoliko je primijećena nestabilnost u procesu. Eksperimentalni podatci također služe za modeliranje kinetike anaerobne razgradnje [15] pri čemu se ovisnosti o kompleksnosti ulaznih podataka i traženih rezultata mogu primijeniti razni kinetički modeli [16–18]. Složeniji modeli zahtijevaju veći broj ulaznih podataka, ali također daju i detaljniji uvid u mehanizam reakcija i otkrivanju tzv. uskog grla procesa koji određuje ukupnu brzinu nastanka bioplina. Osim bioplina, drugi proizvod anaerobne razgradnje je digestat kojeg čine nerazgrađeni ostatci biomase u tekućoj fazi [19]. Tekuća frakcija digestata je obično bogata makronutrijentima – dušikom (N), fosforom (P) i kalijem (K), što ju čini primjenjivom kao gnojivo za tlo [20]. Čvrsta frakcija digestata također sadrži P, ali i zaostali organski ugljik (C) što ga čini prikladnim za poboljšavanje karakteristika tla, kompostiranje [21] ili za neki od oblika energetske oporabe [22]. Prednost korištenja digestata u opisanim načinima leži u činjenici da je njegova tržišna vrijednost mala, tek 2-4 €/t [23]. Proizvedeni bioplin najčešće se koristi kao gorivo u kombiniranoj proizvodnji električne i toplinske energije, kogeneracija (eng. Combined Heat and Power, CHP). Proteklih desetljeća na razini EU mehanizmi subvencija za bioplinske kogeneracije u vidu feed-in-tariffa i feed-in-premija rezultirale su intenzivnom penetracijom bioplina u elektroenergetski sektor [24]. Razina subvencija je definirana na nacionalnoj razini, ali u svim članicama EU nije niža od 80 €/MWhel, što je gotovo dvostruko veći iznos od prosječne veleprodajne tržišne cijene električne energije u EU [25]. Također, ono što je važno napomenuti jest da su subvencije izdane na određeni period (12-20 godina od statusa stjecanja povlaštenog proizvođača električne energije [26]) nakon čega će bioplinska postrojenja morati razmotriti neke druge načine iskorištavanja (eng. Utilisation) bioplina da bi zadržale ekonomski isplativo poslovanje. Prema podatcima Europske udruge za bioplin (eng. European Biogas Association, EBA) u 2020. godini u Europi je bilo instalirano 18,943 bioplinskih postrojenja, od kojih je 18,214 (96%) radilo u kogeneracijskom načinu, a ostalih 4% kao postrojenja za proizvodnju biometana kroz tehnologiju poboljšavanja bioplina (eng. Biogas upgrading) odnosno uklanjanje svih ne-CH4 komponenti bioplina [27]. Ova doktorska disertacija detaljno razlaže inovativnije načine iskorištavanja bioplina u budućim energetskim sustavima, što će uključivati rad kogeneracijskih postrojenja u tržišnim okvirima [28], pretvorbu bioplina u biometan te proizvodnju e-metana kroz implementaciju power-to-gas (P2G) koncepta [29] u sustavima s visokim udjelom energije iz varijabilnih OIE. Primjena procjene životnog ciklusa (eng. Life Cycle Assessment, LCA) [30] može otkriti utjecaje promjene politika sirovina u proizvodnji bioplina i njegovog iskorištavanja u sprezi s budućim energetskim sustavima u odnosu na okoliš. Usporedba LCA performansi za bioplinsko postrojenje koje koristi životinjsku gnojovku i energetske usjeve pokazala je da bioplin za proizvodnju električne energije stvara uštede od oko 300 kgCO2-eq/MWhel, dok upgrading bioplina u biometan i njegovo ubrizgavanje u plinsku mrežu štedi oko 191 kgCO2-eq za proizvedeni MWh biometana [31]. Za preglednije tumačenje opisanih rezultata potrebno je izraziti emisije istom jedinicom, ali i prezentirati podatke o sastavu miksa električne energije (eng. Electricity mix). Za slučaj Irske, LCA je pokazao da integracija P2G koncepta za upgrading bioplina, uz korištenje električnog miksa od 85% OIE, može rezultirati smanjenjem GHG emisija za 70% u odnosu na fosilna goriva [32]. Na temelju pregleda literature (detaljniji prikaz u poglavlju Introduction), dosad nije zabilježeno istraživanje u području anaerobne razgradnje koje povezuje mapiranje i korištenje ostatne i otpadne biomase za proizvodnju bioplina sa njegovim iskorištavanjem u budućim energetskim sustavima. Ova doktorska disertacija je ocijenila takav cjeloviti pristup i predstavila rezultate istraživanja iz perspektive jednog, odnosno više bioplinskih postrojenja. Interdisciplinarni i cjeloviti pristup prema promatranoj temi koristio je elemente kemijskog i strojarskog inženjerstva za ispunjavanje četiri glavna cilja istraživanja: • • Kvantificirati proizvodnju bioplina koristeći nove supstrate biomase kao što su lignocelulozni ostatci iz poljoprivredne proizvodnje, otpadna hrana i industrijski nusproizvodi koji nisu konkurentni proizvodnji hrane, kao što je to slučaj s kukuruznom silažom u sadašnjoj proizvodnji bioplina. • • Procijeniti kinetičke parametre anaerobne razgradnje novih supstrata kombinirajući matematičko modeliranje i eksperimentalne podatke kako bi utvrdili utjecaj kemijskog sastava supstrata na stabilnost procesa i eventualna ograničenja u procesu. • • Utvrditi ekonomski isplative načine budućeg rada bioplinskih postrojenja na naprednim energetskim tržištima nakon što bioplinska postrojenja ostanu bez financijskih potpora i zajamčene cijene električne energije. • • Procijeniti utjecaje na okoliš različitih načina korištenja bioplina integriranih u buduće energetske sustave s visokim udjelom obnovljivih izvora energije. Ostvareni ciljevi istraživanja te rezultati prezentirani su široj znanstvenoj zajednici kroz sedam objavljenih znanstvenih radova (šest radova u kvartilu Q1 te jedan rad u Q2). Znanstveni članak 1 (ARTICLE 1) [33] prikazuje detaljnu analizu lanaca vrijednosti biomase iz različitih poljoprivrednih ostatka, nusproizvoda i otpada (eng. Agricultural wastes, co-products and by-products, AWCB). Rad opisuje faze u kojima i kako nastaje otpad kroz tri specifična koraka u lancu vrijednosti: proizvodnja/uzgoj, obrada u industriji te potrošnja/konzumacija. Analiza uključuje razdoblje od 7 godina, od 2010. do 2016. u 28 zemalja članica Europske unije (EU28) te uključuje četiri različita sektora sa 26 analiziranih dobara (eng. Commodity) i prikladnim vrstama otpada koji se pojavljuju u tim sektorima. Za izračun tehničkog potencijala AWCB korišteni su javno dostupni podaci iz EUROSTAT i FAOSTAT baze, a metoda proračuna uključivala je upotrebu specifične količine AWCB po analiziranim dobrima i sektoru. Rezultati su pokazali da je u analiziranom periodu u EU28 procijenjena količina AWCB iznosila oko 18,4 milijarde tona, a prema udjelima: animalni sektor ~ 31%, sektor povrća ~ 44%, sektor žitarica ~ 22% te sektor voća ~ 2%. Analizirajući pojedine sektore i količine nastalog AWCB, daljnje istraživanje bilo je usmjereno na evaluaciju korištenja određenih AWCB iz lanca vrijednosti biomase u procesu anaerobne razgradnje s ciljem proizvodnje bioplina. Znanstveni članci 2, 3 i 4 pokazuju rezultate takvog pristupa uz primjenu istraživačkih metoda kemijskog inženjerstva. ARTICLE 2 [34] istražuje upotrebu lignoceluloznih ostataka trave kao zamjene za silažu kukuruza u anaerobnoj razgradnji. Uzorci trave prikupljeni su s područja koja nisu kompetitivna s proizvodnjom hrane: neobrađeno zemljište, obala rijeke Save u gradu Zagrebu te bankina autoceste. U istraživanju je određen svježi i suhi prinos biomase, njezin kemijski sastav, prinos te sastav proizvedenog bioplina, a primjenom Anaerobic Digestion Model No. 1 (ADM1) modela određeni su kinetički parametri razgradnje trave. Ujedno, na kraju je dana usporedba okolišnijih učinaka zamjene kukuruzne silaže ostatnom travom u proizvodnji električne i toplinske energije. Rezultati istraživanja su pokazali da je najveći prinos ostatne trave utvrđen za obalu rijeke, sa prosječnom vrijednošću od 19 t/ha svježe mase i 2.6 t/ha suhe mase. Svi uzorci trave pokazali su zadovoljavajuće parametre za primjenu u anaerobnoj razgradnji − omjer C/N između 16.6: 1 do 22.8: 1. Ostvareni biokemijski potencijal metana u monorazgradnji (monodigestiji) ostataka trave su: 0.275 Nm3/kgTS za travu s neobrađenog zemljišta, 0.192 Nm3/kgTS za travu s obale rijeke i 0.255 Nm3/kgTS za travu s bankine autoceste. Procijenjeni kinetički parametri razgradnje trave razlikuju se od do sada objavljenih rezultata, prvenstveno zato što prijašnje analize uključuju specifične tipove travnate biomase, a ne ostatnu (miješanu) travu. Procijenjeni okolišniji utjecaji zamjene kukuruzne silaže travnatom biomasom u proizvodnji električne i toplinske energije pokazali su prednosti u smislu ostvarenog doprinosa kvaliteti ekosustava (eng. Ecosystem quality) i ljudskog zdravlja (eng. Human health), no također i nešto veće emisije GHG uzrokovane izgaranjem fosilnih goriva u poljoprivrednoj mehanizaciji i povećanim transportom trave zbog nižeg prinosa bioplina u odnosu na silažu. Čvrsta frakcija digestata dobivena u procesu monodigestije trave korištena je u znanstvenom članku 3 (ARTICLE 3) kao ulazni materijal za istraživanje procesa pirolize. Cilj istraživanja u ARTICLE 3 [35] bio je odrediti utjecaj anaerobne razgradnje na sastav lignocelulozne biomase korištenjem termogravimetrijske analize (eng. Thermogravimetric analysis, TGA). Također, procijenjeni su iznosi energije aktivacije i modificiranog predeksponencijalnog faktora za travu i njezine digestate, kao i prinos konačnog ostatka pirolize (eng. Biochar). Rezultati su pokazali da je procijenjena količina razgrađene celuloze i hemiceluloze u istraživanim uzrocima trave oko 44–50%. Nadalje, digestati trave pokazali su veći prinos biochar-a (oko 38%) u odnosu na uzorke trave (oko 24%). Kombinirani proces anaerobne razgradnje trave i pirolize njezinih digestata pokazao je manje vrijednosti procijenjenih kinetičkih parametra što upućuje na niže energetske potrebe takvog procesa u odnosu na direktnu pirolizu trave. ARTICLE 4 [36] bio je izrađen u suradnji sa industrijom biomase i bioplina. U radu je eksperimentalno istražena razgradnja otpadne hrane (eng. Food waste, FW) iz bioplinskog postrojenja zajedno s nusproizvodnima iz kafilerije (eng. Rendering plant): mesno-koštano brašno (eng. Meat and bone meal, MBM) i mulj sa otpadnih voda (eng. Wastewater sludge, WWS). Prvo je provedena termička predobrada uzoraka FW (FW1 i FW2) pri temperaturi od 35 °C i trajanju 5 dana u koju su bili dodani MBM i WWS u udjelima od 5, 10 i 15% TS. Nakon toga slijedila je anaerobna razgradnja pri 40.5 °C u trajanju od 40 dana. Uvjeti termičke predobrade i proizvodnje bioplina u laboratorijskom mjerilu replicirani su iz rada samog bioplinskog postrojenja. Također, za vrijeme procesa u laboratoriju bile su praćene sve procesne varijable kao i u radu digestora na postrojenju. Kao rezultat predobrade kemijska potrošnja kisika (eng. Chemical Oxygen Demand, COD) ispitivanih uzoraka povećala se za 7 – 26%. Dodavanjem MBM u FW1 došlo je do povećanja vrijednosti COD kao i NH4-N, dok se u slučaju dodatka WWS u FW2 postiglo smanjenje, što je i bilo očekivano, budući da je WWS materijal s niskim udjelom organske tvari. Kao rezultat testa anaerobne razgradnje dobiveni su sljedeći prinosi bioplina: za FW1 – 0.566 Nm3/kg TS, za FW1-MBM – 0.499 Nm3/kg TS, za FW2 – 0.252 Nm3/kg TS i 0.195 Nm3/kg TS za FW2-WWS. Tako širok raspon vrijednosti rezultat je heterogenosti FW (FW1 i FW 2 uzete su s vremenskim razmakom od dva mjeseca na istom postrojenju). Prema sastavu proizvedenog bioplina, kao i ostalim procesnim varijablama može se zaključiti da su FW1 i FW2 vrlo slični po sastavu, ali da je istovremeno postojao neki uzročnik inhibicije u proizvodnji bioplina za uzorak FW2, koji se nije mogao procijeniti na temelju dostupne opreme i provedenih mjerenja. Tek su mjerenja električne vodljivosti ukazala na to da uzorak FW2 sadrži nešto veću koncentraciju soli koja bi mogla biti uzročnik smanjenog prinosa bioplina. Nusproizvodi kafilerije dodani u 5%-tnom udjelu uzrocima FW rezultirali su smanjenjem proizvodnje bioplina za 12% u slučaju MBM i 23% u slučaju WWS, ali nisu utjecali na stabilnost proizvodnje. Štoviše, analizom kinetike razgradnje ustanovljeno je da MBM i WWS ubrzavaju proces razgradnje FW što se vidi iz višeg iznosa reakcijske konstante. Također, pokazano je da ispitivani uzorci najbolje koreliraju sa kinetikom prvog reda što je vidljivo iz najniže ostvarene vrijednosti RMSE (eng. Root mean square error) koja je iznosila 0.015 Nm3/kg TS. U znanstvenom članku 5 (ARTICLE 5) [37] provedena je tehno-ekonomska i scenarijska analiza rada bioplinskog postrojenja nakon isteka subvencija za proizvodnju električne energije. Vođenje takvog sustava temeljilo se na iznosu cijena električne energije i biometana (eng. Unit commitment with economic dispatch) koje su određivale koja od jedinica za prihvat bioplina: CHP, upgrading ili spremnik ima najveću ekonomsku isplativost u danom trenutku. Za opis dinamike korišten je program MATLAB/Simulink, a za ekonomsku analizu MS Excel. U prvom scenariju prikazan je utjecaj cijene proizvodnje električne energije u bioplinskom postrojenju (eng. Break-even point of electricity production, BECPel) na broj radnih sati kada ono može ostvariti svojevrstan profit na dan-unaprijed tržištu (eng. Day-ahead market) električne energije. Rezultati su pokazali da kada vrijednost BECPel postane 40 €/MWhel, bioplinsko postrojenje može ostvariti (neki) profit radeći samo 4,000 sati godišnje, kako je ostalo vrijeme cijena električne energije na tržištu niža od cijene proizvodnje. Kada BECPel postane 100 €/MWhel bioplinsko postrojenje ne može ostvariti nikakav profit radeći na dan-unaprijed tržištu. Kao jedno od rješenja koje se nameće za smanjenje vrijednosti BECPel je korištenje supstrata s negativnom cijenom (GF model) koja je detaljnije prikazana u članku 6 (ARTICLE 6). Drugi scenarij uključivao je instaliranje upgrading jedinice i proizvodnju biometana, a proizvodnja električne energije ovisila je o cijenama na tržištu uravnoteženja (eng. Balancing market). Takav pristup je pokazao da bioplinsko postrojenje i uz relativno visoku cijenu biometana od 80 €/MWh, može u određenim trenutcima ostvariti i veći profit ako radi na balancing tržištu. Treći scenarij za bioplinsko postrojenje uključivao je integraciju industrijskog otpada iz proizvodnje šećera za proizvodnju bioplina i njegovo korištenje za proizvodnju procesne topline u vrijeme šećerne kampanje. Takav pristup pokazao se relativno neisplativim za bioplinsko postrojenje kako je cijena prirodnog plina na veleprodajnom tržištu još uvijek dosta niska i bioplin joj ne može u tom smislu biti konkurentan. ARTICLE 6 [38] predstavlja rezultate integracije P2G koncepta u rad bioplinskog postrojenja koje se nalazi u GF poslovnom modelu, odnosno prima naknadu za ulazni supstrat pri proizvodnji bioplina. Cilj istraživanja bio je razviti robustan matematički model na satnoj razini za procjenu optimalnih kapaciteta vjetroelektrane i solarne elektrane, veličine spremnika za bioplin te kapacitete elektrolizera, upgrading jedinice i metanatora (eng. Methanation unit) koristeći linearno programiranje i besplatni (eng. Open source) programski jezik Julia. Kao funkcija cilja korištena je minimizacija ukupnih troškova. Matematički model testiran je na postojećoj bioplinskoj elektrani instalirane snage 1 MWel. Utvrđeno je da P2G koncept zahtijeva integraciju 18 MWel vjetra i 9 MWel solara na lokaciji, uz dodatan uvoz električne energije iz mreže u iznosu 16 GWhel kako bi se na godišnjoj razini proizvelo 36 GWh obnovljivog metana. Analiza je pokazala da GF (u promatranom slučaju za otpadnu hranu) značajno doprinosi ekonomskoj održivosti obnovljivog metana: promjena GF za 100 €/toni rezultira smanjenjem troškova njegove proizvodnje za 20-60%. Ustanovljeno je da za vrijednost GF=-120 €/tona obnovljivi metan iz prikazanog koncepta postaje cjenovno konkurentan prirodnom plinu. Robusna priroda modela pokazala je da nesigurnosti povezane s proizvodnjom električne energije iz vjetra i solara na lokaciji mogu povećati troškove proizvodnje obnovljivog metana za 10-30%. ARTICLE 7 [39] integralno obuhvaća rezultate svih dotad objavljenih radova u sklopu izrade doktorske disertacije i smješta ih u kontekst testiranja hipoteze. U njemu je provedena geoprostorna analiza (eng. Geospatial analysis) bioplinskog sektora korištenjem javno dostupnog programa QGIS te procjena okolišnijih utjecaja pomoću programa SimaPro. Cilj rada bio je mapirati energetski potencijal otpadne trave, industrijskih nusproizvoda i otpada, te komunalnog biootpada (otpadne hrane) za zamjenu kukuruzne silaže u postojećoj proizvodnji bioplina te planiranje proširenja bioplinskog sektora. Kao studija slučaja (eng. Case study) korištena je Sjeverna Hrvatska (eng. Northern Croatia), područje s intenzivnim bioplinskim sektorom te snažnom industrijom, poljoprivredom i velikom gustoćom stanovništva. Rezultati su pokazali da bi navedene sirovine mogle zamijeniti 212 GWh bioplina iz kukuruzne silaže u postojećim bioplinskim postrojenjima te stvoriti dodatnih 191 GWh biometana u novim postrojenjima. Također, geoprostorna analiza je pokazala da su neka bioplinska postrojenja izgrađena u neposrednoj blizini plinske transportne mreže (<2km udaljenosti) i da imaju potencijal za utiskivanje biometana u plinsku mrežu. Cjelokupna analiza utjecaja na okoliš postojećih bioplinskih postrojenja pokazala je da integralni pristup proizvodnji i korištenju bioplina stvara sinergijske učinke u smislu smanjenja opterećenja na okoliš, što izravno dokazuje hipotezu studije. Kompleksnost P2G koncepta i njegovi intenzivni energetski zahtjevi čine ga trenutno nepovoljnijim u usporedbi sa klasičnim upgradingom bioplina, no isti dolazi do izražaja kada se u razmatranje uzmu budući energetski sustavi s visokim udjelom OIE. Znanstveni doprinosi ovog rada ostvareni su kroz provedena istraživanja te prikazani kroz objavljene rezultate u radovima kako slijedi: • Eksperimentalnim istraživanjem anaerobne razgradnje novih supstrata biomase odredit će se potencijalne prepreke u proizvodnji bioplina, poput pojave inhibicije ili utjecaja tipa biomase na stabilnost procesa: ARTICLE 2: Ustanovljeno je da lignocelulozna biomasa u obliku ostatne trave ne sadrži fizikalno-kemijske karakteristike koje bi ograničile njezinu upotrebu za proizvodnju bioplina. Štoviše, pokazalo se da ista uzrokuje poboljšanu kontrolu pH što doprinosi stabilnosti proizvodnje bioplina. Nedostatak njezinog korištenja je taj što je za ostvarivanje većih prinosa potrebno primijeniti neki oblik predobrade. ARTICLE 4: Heterogenost otpadne hrane utječe na vođenje procesa za što je potrebno ustanoviti robusnu kontrolu procesnih varijabli. Pokazalo se da i na razini bioplinskog postrojenja postoje neke varijable koje se ne prate na dnevnoj razini (prisutnost soli i metala), a koje mogu uzurpirati proizvodnju bioplina. Ustanovljeno je da kafilerijski nusprodukti i otpad u manjim količinama mogu doprinijeti povećanju brzine razgradnje otpadne hrane. • Predložiti alternativne mjere za trenutni sektor bioplina uzimajući u obzir tržišne cijene i analizu utjecaja na okoliš koristeći pristup procjene životnog ciklusa. ARTICLE 5: Alternativne mjere za bioplinski sektor u vidu proizvodnje biometana i rada bioplinskih postrojenja na day-ahead i balancing tržištu električnom energijom pokazala se kao najvjerojatnija opcija nakon napuštanja poticajnih sustava za proizvodnju električne energije. U takvim okvirima tranzicija s kukuruzne silaže na supstrate alternativne supstrate postati će prihvatljiva operativna odluka uz dodatne investicije u novu opremu. ARTICLE 6: Integracija varijabilnih OIE u rad bioplinskih postrojenja pokazala je da će se u budućnosti paradigma bioplinskih postrojenja kao takvih promijeniti – više neće biti samo pasivni proizvođači struje, nego će postati aktivni sudionici na tržištima energijom. ARTICLE 2: Pokazano je da otpadana trava više doprinosi kvaliteti ekosustava i ljudskom zdravlju nego kukuruzna silaža, iako uzrokuje veće emisije stakleničkih plinova, prvenstveno zbog intenzivnijih potreba za transportom na fosilna goriva. ARTICLE 7: LCA predloženih mjera za sektor bioplina koje uključuju zamjenu kukuruzne silaže alternativnih oblicima biomase te iskorištavanje bioplina u sustavima s visokim udjelom OIE pokazala je sinergistički efekt u smislu smanjenja cjelokupnog tereta na okoliš. Analiza je također pokazala da je integracija P2G u promatranim okvirima još uvijek neatraktivna zbog kompleksnosti sustava i energetski intenzivnih procesa. • Napredni model geografskog informacijskog sustava mapiranja novih izvora biomase koji će u kombinaciji s različitim načinima korištenja bioplina integriranim u sustave visokih obnovljivih izvora energije u naprednim energetskim tržištima rezultirati robusnim matematičkim modelima primjenjivim na različite slučajeve bioplinskih postrojenja. ARTICLE 6: Razvijeni robusni model integracije P2G koncepta u rad bioplinskog postrojenja pokazao je sinergiju između GF poslovnog modela te integracije obnovljive električne energije i topline koji su objedinjeni u postavljenoj matematičkoj formulaciji nivelirane cijene obnovljivog metana (eng. Levelized cost of renewable methane, LCORM). ARTICLE 7: Razvijeni GIS model obuhvaća analizu postojećih bioplinskih postrojenja i pozicioniranje budućih biometanskih postrojenja na temelju geoprostorne analize dostupnih alternativnih supstrata i položaja plinske mreže. Hipoteza ovog istraživanja je da je primjenom cjelovitog pristupa u radu bioplinskih postrojenja, i na strani proizvodnje i iskorištavanja bioplina, moguće povećati ekonomsku profitabilnost i doprinos zaštiti okoliša u usporedbi s trenutnim subvencioniranim radom. Kroz provedena istraživanja hipoteza je testirana i potvrđena uzevši u obzir sljedeće: • Ekonomska profitabilnost bioplinskih postrojenja nakon napuštanja subvencija i ograničenja u korištenju kukuruzne silaže bit će teže ostvariva. Uključivat će implementaciju GF poslovnog modela za supstrate za što će biti potrebne nove investicije po pitanju linije za predobradu, povećanje kapaciteta za spremanje bioplina na lokaciji kako bi postrojenje bilo fleksibilnije na tržištu električne energije te dodatne investicije u sustav za proizvodnju obnovljivog metana, prvenstveno biometana. • Cjeloviti pristup pokazao je da će doprinos budućeg bioplinskog sektora smanjenju okolišnih tereta ići kroz dvostruki doprinos: iz gospodarenja otpadom za proizvodnju bioplina koji će uključivati prvenstveno komunalni i industrijski biootpad u urbanim bioplinskim postrojenjima, a poljoprivredne ostatke u ruralnim bioplinskim postrojenjima, te iskorištavanja bioplina za proizvodnju obnovljive energije u vidu biometana.
Innovation is a core topic for the social and administrative sciences concerned with organizations management. Hence the name of our journal: INNOVAR, depicted as action and reflection. Insights about innovation are diverse, ranging from the importance of change in production techniques pointed out by Marx, to the structural vision by Schumpeter and the Neo-Schumpeterians about creative destruction as one of the drivers of capitalist development (Chang, 2016). In recent decades, innovation has been gaining an increasingly prominent role in economic and organizational processes due to the emergence and consolidation of the so-called "knowledge-based society" (Drucker, 1994; Castells, 1996; Dubina, Carayannis & Campbell, 2012).Innovation demands the confluence of multiple factors and dimensions, such as creativity, science and technology, the interactions between University, business and society, as well as competition, the role of the State and innovation financing, among others. Precisely, the intersection between the role of the State and innovation financing has been one of the research interests of the Italian economist Mariana Mazzucato. In her book The Entrepreneurial State - Debunking Public vs. Private Sector Myths, Mazzucato (2016) advocates for a change in the understanding of the role of the State within innovation processes. Using empirical evidence from the sectors of communications technology (exemplifying companies like Apple), renewable energies and the pharmaceutical sector, Mazzucato points out to the active and paramount role of the State in contemporary innovation, considering that states have been investors and executors of projects in the base of innovations such as the touch screen, the cps, the Internet or Siri, which were later exploited by private companies. Whether in the field of military defense, aeronautics or the energy sector, investments by the State and the resulting projects have been vital for the conception and subsequent diffusion of innovations. The characteristics of high-risk investments that can be undertaken by the State added to the way it brings together and articulates multiple capacities and institutions, constitute transmission chains that are essential for innovation.Mazzucato's contribution is questioning a series of myths around innovation that suggest this phenomenon arises only by the activities of private entrepreneurs and investors. This perspective, now dominant, demands a downsized State focused on encouraging private forces, so that the invisible hand and competition promote the emergence of new knowledge leading to innovations. Mazzucato's book (2016) opens wide paths for research since it does not deny the relevance of companies and innovative entrepreneurs, but it calls to recognize, characterize and assess the importance of public organizations and projects in the dynamics of innovation. All of this encourages the academic research interests of INNOVAR, to which we summon Ibero-American academic community of the Management Sciences.Our current issue is made up by four of our traditional sections: Strategy and Organizations, Marketing, Human Factor, and Business Ethics. These gather ten papers by Colombian and international partners.Three research papers are published in Strategy and Organizations section.As a results of an international cooperation, Professors Julio César Acosta, from Externado de Colombia University, Mónica Longo-Somoza, from the Council of Education of the Community of Madrid - Spain, and María Belén Lozano, from the University of Salamanca - Spain, introduce their work "Does Family Ownership Affect Innovation Activity? A Focus on the Biotechnological Industry". This work tried to identify the profile of innovative firms in order to analyze whether family ownership is a feature related to innovation initiatives and processes. For that purpose, a hierarchical cluster analysis is performed in a sample of 243 Spanish companies within the biotechnology sector. It is concluded from the study that innovative Spanish firms belonging to this sector are non-family-owned firms. The negative relationship between innovation and family ownership could be explained by the conservative behavior of family-owned companies, which avoid taking the risks demanded by innovation.Professors Valentin Azofra, from the University of Valladolid - Spain, Magda Lizet Ochoa, from the Autonomous University of Tamaulipas - Mexico, and Begoha Prieto and Alicia Santidrian, from the University of Burgos - Spain, present the paper "Creating Value through the Application of Intellectual Capital Models". This research aims to link both the adoption level and the use of intellectual capital models with the creation of value in companies under a long-term perspective. Empirical work involved the selection of companies showing commitment towards the use of information systems on intellectual capital. Based on information from 79 Spanish companies a model was developed and then applied in order to relate the variables of growth in sales, productivity per employee and intellectual capital index, among others, to the adoption level and use of indicators on intellectual capital. Results show that companies with higher levels of intellectual capital models report better indexes related to aforementioned variables, which represent, in turn, greater creation of value.Additionally, independent researcher Giuseppe Vanoni and Professor Carlos Rodriguez from the National University of Colombia authored the paper "Growth Strategies Implemented by Economic Groups in Ecuador (2007-2016)", a study intended to identify growth strategies of 132 economic groups in Ecuador during the time frame previously stated. After a complete literature review and the introduction of the conceptual notions of "economic group" and "growth strategy", empirical work shows that a specialization-based concentration strategy prevails among the studied groups. Furthermore, this work allowed concluding that Ecuadorian economic groups belong to some specific families, and that the economic stability experienced by this country over the course of the period under study had a direct influence on the concentration strategy by specialization adopted by economic groups.Marketing section in this issue of INNOVAR introduces four papers.Brazilian researchers Celso Ximenes and Josemeire Alves, and Professors Gabriel Aguiar, from the Faculdade Mauricio de Nassau, and Danielle Miranda de Oliveira, from the Uni-versidade Estadual do Ceará in the city of Fortaleza - Brazil, take part in this issue with the work "You Solved my Problem, but I Won't Buy from You Anymore! Why Don't Consumers Want to Go Back Doing Business in Online Stores?". This study set as its main goal to understand the motives driving online consumers not to make new purchases when experiencing troubles with purchase processes, even when inconveniences were solved. Following a qualitative approach and based on a sample of 200 complaints over four e-commerce enterprises, a descriptive focus allowed classifying the possible problems and solutions deployed by companies. Results point that consumers manifest their wish of not making further purchases with the same company due to problems with logistics as well as delays with problemsolving and handling complaints.From the University of Seville in Spain, Professors Carlos Javier Rodríguez and Encarnación Ramos add to this current issue the paper "Influence of Religiosity and Spirituality on Consumer Ethical Behavior", whose objective is to analyze consumers' ethical behavior. For this reason, a model of structural equations relating the scales of religiosity and spirituality and contrasting the results of 286 surveys to Spanish citizens is developed. The study implied resizing the Consumer Ethics Scale based on the results found in the literature in order to fit the purposes of this work. The paper concludes by presenting evidence on the existence of a relationship between religiosity-spirituality and the ethical behavior shown by consumers.Professors Alejandro Tapia, associated to the University Loyola Andalucía, and Elena Martín Guerra, from the University of Valladolid, both institutions in Spain, are the authors of "Neuroscience and Advertising. An Experiment on Attention and Emotion in Television Advertising". This paper presents the results of a neuroscience experiment applied to advertising, whose purpose was to study how attention and the generation of emotional responses influence the recall of w spots. The experiment was carried out in a group of 30 students aged 18-22, who were exposed to advertising spots of the University of Valladolid. Results from this exercise show important aspects influencing attention and emotion towards the spots, both positively and negatively, among them: comic content, language, loudness or negative and sad contents, and some others.From the Center of Economic and Management Sciences at the University of Guadalajara - Mexico, Professors José Sánchez, Guillermo Vázquez and Juan Mejía sign the work "Marketing and Elements Influencing the Competitiveness of Commercial Micro, Small and Medium-Sized Enterprises in Guadalajara, Mexico". This study seeks to state the correlation between different key marketing elements that impact micro, small and medium-sized enterprises of clothing items in Guadalajara, Mexico. Based on structural equation modelling, strategies, knowledge and planning in marketing were identified as determinants for the competitiveness of this type of companies. Empirical work used a sample of 380 companies of the retail-clothing sector. The results confirm a positive and significant correlation between key marketing factors and competitiveness, where marketing factors are decisive for companies within the sector, which have been regarded as the weakest link in Mexican economy.Our Human Factor section gathers two studies derived from research processes.We include the paper titled "Subjectivity and Power in Business Organizations: A Case Study", authored by Adriana Valencia Espinosa, Professor at the University of Valle -Colombia. This work was praised as one of the best lectures presented during the First International Congress on Organizations Management that was venued at the National University of Colombia. The objective of this research was to understand the impact of business organizations on the subjectivity of employees, emphasizing the implications of labor breakdown (the termination of a contract). The case study is carried out at a renowned company in Valle del Cauca - Colombia, whose core business, among other lines, is mass printing and editorial processes. This paper addresses testimonies by key participants, that is, workers who experienced labor ruptures with the company. The article also identifies some mechanisms deployed by the organization in the process of sensemaking and the creation of meaning for subjectivity mobilization.Professors Matias Ginieis, María Victoria Sánchez and Fernando Campa from the Rovira i Virgili University, in Spain, present in this issue the paper "How much is the Staff According to the Type of Airline and its Geographical Location in Europe? A Comparative Analysis". This research study was aimed at determining the link between the costs per employee, the types of airlines (traditional or low cost) and the different geographical locations of the headquarters of the studied airlines (Western Europe, Eastern Europe, the United Kingdom and the Nordic countries). A total of 152 airlines were analyzed during the period 2008-2013. Based on statistical correlation tests it was possible to determine there is no relationship between the type of airline and staff-related costs.Last but not least, our Business Ethics section presents a research paper for this issue of INNOVAR.At the University of Zaragoza in Spain, Professors Francisco José López and Ana Bellosta contribute to this issue with the work titled "Corporate Social Responsibility and Good Corporate Governance practices in Spanish Ethical Mutual Funds: Analysis of Investee Companies". This paper studies the type of firms composing the portfolio of Spanish ethical mutual funds, characterizing such companies on the basis of the Corporate Governance model they follow, their organizational structure and some of their economic and financial variables. Different models of Corporate Governance by investee companies and their relationship with financial variables are presented and then evaluated. Results show that companies under the German corporate governance model are preferred by ethical mutual funds, followed by those companies with Anglo-Saxon corporate governance models, which means that, for allocating resources, ethical mutual funds take an interest in companies that involve different stakeholders in their governance processes.We are sure these contributions will be of great interest for the academic community of the Social and Management Sciences both in Colombia and abroad. ; La innovación es un tópico medular para las ciencias sociales y administrativas preocupadas por la gestión de las organizaciones. De allí el nombre de nuestra publicación: INNOVAR, expresado como acción y reflexión. Las concepciones sobre la innovación son diversas y van desde la importancia del cambio en las técnicas de producción, señalado por Marx, hasta la visión estructural de Schumpeter y de los neoschumpeterianos, según la cual la destrucción creativa es uno de los motores del desarrollo capitalista (Chang, 2016). En las últimas décadas, la innovación ha venido ganando un lugar cada vez más protagónico en los procesos económicos y organizacionales, por el surgimiento y consolidación de la llamada "sociedad del conocimiento" (Drucker, 1994; Castells, 1996; Dubina, Carayannis y Campbell, 2012).La innovación requiere la confluencia de múltiples factores y dimensiones, como la creatividad; la ciencia y la tecnología; las relaciones entre universidad, empresa y sociedad; la competencia; el papel del Estado, y la financiación de la innovación, entre otros. Precisamente, la intersección entre el papel del Estado y la financiación de la innovación ha sido uno de los temas de investigación de la economista italiana Mariana Mazzucato. En su libro El Estado emprendedor. Mitos del sector público frente al privado, Mazzucato (2016) aboga por un cambio en la comprensión del papel del Estado en los procesos de innovación. Con evidencia empírica de los sectores de tecnología de las comunicaciones (ejemplarizando con empresas como Apple), las energías renovables y del sector farmacéutico, Mazzucato señala que el Estado ha tenido un papel activo y determinante en la innovación contemporánea, debido a que ha sido inversor y ejecutor de proyectos que están en la base de innovaciones como la pantalla táctil, el CPS, Internet o Siri, que luego son aprovechadas por empresas privadas. Bien sea en el campo del sector defensa, el aeronáutico o el energético, las inversiones del Estado y los proyectos que ejecuta han sido vitales para la gestación y posterior difusión de las innovaciones. Las características de las inversiones de riesgo, que puede ejecutar el Estado, y la forma como congrega y articula múltiples capacidades e instituciones se constituyen realmente en cadenas de transmisión vitales para la innovación.La aportación de Mazzucato (2016) consiste en cuestionar una serie de mitos sobre la innovación, que plantean que tal proceso emerge solo en virtud del actuar de emprededores e inversores privados. Desde esa mirada, hoy dominante, se reclama un Estado mínimo, concentrado en incentivar las fuerzas privadas, para que la mano invisible y la competencia promuevan el surgimiento de nuevos conocimientos que desemboquen en innovaciones. El libro de Mazzucato (2016) abre un sinfín de oportunidades de investigación, puesto que no niega la relevancia de la empresa y los emprendedores innovadores, sino que nos convoca a reconocer, caracterizar y evaluar la importancia de las organizaciones y los proyectos públicos en la dinámica de la innovación. Todo ello alienta la investigación académica que interesa a INNOVAR, y a la que convocamos a la comunidad académica de las ciencias de la gestión en Iberoamérica.La presente edición está organizada en cuatro de nuestras tradicionales secciones: Estrategia y Organizaciones, Marketing, Factor Humano y Ética Empresarial, en las que publicamos diez artículos de nuestros colaboradores nacionales e internacionales.En la sección de Estrategia y Organizaciones, se publican tres trabajos, resultado de investigación.Fruto de una colaboración internacional, los profesores Julio César Acosta, de la Universidad Externado de Colombia; Mónica Longo-Somoza, de la Consejería de Educación de la Comunidad de Madrid, España, y María Belén Lozano, de la Universidad de Salamanca, España, aportan el trabajo titulado "Does family ownership affect innovation activity? A focus on the biotechnological industry". Este trabajo buscó identificar el perfil de las empresas innovadoras, para analizar si la propiedad familiar es una característica que se relaciona con las iniciativas y procesos de innovación. En la investigación se realiza un análisis clúster jerárquico con una muestra de 243 empresas españolas del sector de la biotecnología. Se concluye que las empresas españolas que innovan en este sector no son empresas de propiedad familiar. La relación negativa que se encuentra entre innovación y propiedad familiar, puede ser explicada porque las empresas familiares en tal industria son conservadoras y evitan tomar riesgos como los que la innovación reclama.Los profesores Valentín Azofra, de la Universidad de Valladolid, España; Magda Lizet Ochoa, de la Universidad Autónoma de Tamaulipas, México, y Begoña Prieto y Alicia Santidrián, de la Universidad de Burgos, España, aportan el artículo "Creando valor mediante la aplicación de modelos de capital intelectual". La investigación pretende vincular el nivel de implantación y uso de modelos de capital intelectual con la creación de valor en la empresa, desde una perspectiva de largo plazo. Para el trabajo empírico se seleccionaron empresas que muestran compromiso hacia la utilización de sistemas de información sobre el capital intelectual. Con base en información de 79 empresas españolas, se realizó y aplicó un modelo para relacionar las variables de crecimiento en ventas, productividad por empleado, índice de capital intelectual, entre otras, con el nivel de uso e implantación de indicadores sobre capital intelectual. Los resultados evidencian que las empresas con mayores niveles de implantación de modelos de capital intelectual presentan mejores índices de productividad, crecimiento en ventas y eficiencia del capital intelectual, es decir, mayor creación de valor.Por otra parte, en una colaboración interinstitucional, el investigador independiente Giuseppe Vanoni, y el profesor Carlos Rodríguez, de la Universidad Nacional de Colombia, suscriben el artículo titulado "Estrategias de crecimiento implementadas por los grupos económicos del Ecuador (2007-2016)", con la que se pretende identificar las estrategias de crecimiento de 132 grupos económicos en el Ecuador, durante el periodo señalado. Luego de una importante revisión de la literatura y de la definición conceptual de "grupo económico" y de "estrategia de crecimiento", el trabajo empírico muestra que prevalece una estrategia de concentración, basada en la especialización. Se concluye que los grupos económicos en Ecuador son pertenecientes a familias concretas. La estabilidad que vivió el país en los años del estudio influyó en la estrategia de concentración por especialización de los grupos económicos.La sección de Marketing del presente número de INNOVAR está conformada por cuatro artículos.Los investigadores brasileños Celso Ximenes y Josemeire Alves, y los profesores Gabriel Aguiar, Facultade Mauricio de Nassau, y Danielle Miranda de Oliveira, de la Universi-dade Estadual do Ceará, en Fortaleza-Brasil, participan con el trabajo "Resolveram meu problema, porém nao compro mais! Por que os consumidores nao desejam voltar a fazer negócios com Lojas Virtuais? El trabajo se planteó como objetivo comprender los motivos que llevan a los consumidores online a no realizar nuevas compras, cuando tuvieron problemas en el proceso, pese a que tales problemas hubiesen sido resueltos. Desde un enfoque cualitativo, con base en 200 quejas de cuatro empresas que venden sus productos en Internet, se realizó un trabajo descriptivo y cualitativo que permitió categorizar los posibles problemas y las soluciones desplegadas por las empresas. Los consumidores expresan su voluntad de no realizar otra compra con la misma empresa por problemas logísticos, demora en resolución del problema y demora en la atención de la queja.De la Universidad de Sevilla, España, los profesores Carlos Javier Rodríguez y Encarnación Ramos aportan a esta edición el artículo titulado "Influencia de la religiosidad y la espiritualidad en el comportamiento ético del consumidor". El objetivo de la investigación es analizar el comportamiento ético del consumidor, para lo que realiza un modelo de ecuaciones estructurales que relaciona las escalas de religiosidad y espiritualidad, y que contrasta los resultados de 286 encuestas realizadas a ciudadanos españoles. La investigación implicó redimensionar la Consumer Ethics Scale, con base en los resultados encontrados en la literatura y con el propósito de ajuste perseguido en el trabajo. Se concluye el artículo presentando evidencia de la existencia de una relación entre la religiosidad-espiritualidad y el comportamiento ético del consumidor.Los profesores Alejandro Tapia, vinculado a la Universidad Loyola de Andalucía, y Elena Martín Guerra, de la Universidad de Valladolid, ambas instituciones en España, son los autores de "Neurociencia y publicidad. Un experimento sobre atención y emoción en publicidad televisiva". El artículo presenta los resultados de un experimento en neuro-ciencia, aplicado a la publicidad. El propósito era estudiar cómo la atención y la generación de respuesta emocional influyen en el recuerdo de una cuña publicitaria (spot) en televisión. El experimento se desarrolló con un grupo de 30 estudiantes de entre 18 y 22 años, que fueron expuestos a cuñas publicitarias de la Universidad de Valladolid. Los resultados muestran que existen condiciones importantes que impactan en la atención y la emoción hacia los spots, tanto positiva como negativamente, entre ellos, el contenido cómico, el idioma, la fuerza del sonido, la presencia de contenidos negativos y tristes, entre otros.Desde el Centro Universitario de Ciencias Económico-Administrativas, de la Universidad de Guadalajara, México, los profesores José Sánchez, Guillermo Vázquez y Juan Me-jía suscriben el trabajo "La mercadotecnia y los elementos que influyen en la competitividad de las mipymes comerciales en Guadalajara, México". El artículo busca establecer la correlación que existe entre los diferentes factores clave de mercadotecnia que impactan en las micro, medianas y pequeñas empresas de prendas de vestir en Guadalajara, México. A partir de un modelo de ecuaciones estructurales, se establecieron como factores clave las estrategias, el conocimiento y la planeación, todos de mercadotecnia, como variables determinantes de la competitividad de la mipyme. Para el trabajo empírico, se usa una muestra de 380 empresas del sector de prendas de vestir al menudeo. Los resultados verifican que existe una correlación positiva y significativa entre los factores clave de marketing y la competitividad, por lo que resultan determinantes para estas empresas, consideradas por muchos como el eslabón más débil de la economía mexicana.La sección de Factor Humano recoge dos trabajos, resultado de procesos de investigación.Publicamos el artículo titulado "Subjetividad y poder en la organización empresarial: un estudio de caso", de la profesora de la Universidad del Valle, Colombia, Adriana Valencia Espinosa, y que fue una de las mejores ponencias presentadas en el Primer Congreso Internacional de Gestión de las Organizaciones, realizado en la Universidad Nacional de Colombia. El objetivo del trabajo de investigación fue comprender la incidencia de la organización empresarial en la subjetividad de los empleados, enfatizando en las implicaciones de la ruptura laboral (la finalización del contrato). El estudio de caso se realiza en una reconocida empresa del Valle del Cauca, dedicada, entre otros negocios, a la impresión masiva y los procesos editoriales. Se abordan relatos de participantes clave, trabajadores que vivieron rupturas laborales con la empresa. El artículo identifica algunos dispositivos desplegados por la organización en el proceso de creación de sentido y producción de significado que moviliza la subjetividad.De los profesores Matias Ginieis, María Victoria Sánchez y Fernando Campa, de la Universitat Rovira i Virgili, España, en esta edición se publica el artículo "¿Cuánto cuesta el personal según el tipo de aerolínea y su ubicación geográfica en Europa? Un análisis comparativo". La investigación se planteó establecer la relación existente entre los costos por empleado, los tipos de aerolíneas (tradicionales y de bajo costo) y las diferentes zonas geográficas de ubicación en Europa en que están domiciliadas las aerolíneas (Europa occidental, Europa del este, Reino Unido y países nórdicos). Se estudiaron 152 compañías áreas, en el periodo comprendido entre el 2008 y el 2013. A partir de pruebas estadísticas de correlación, se estableció que no hay una relación entre el tipo de aerolínea y el costo del personal.Finalmente, la sección de Ética Empresarial para este número de INNOVAR recoge un artículo de investigación.Desde la Universidad de Zaragoza, España, los profesores Francisco José López y Ana Bellosta aportan el trabajo "Corporate Social Responsibility and Good Corporate Governance Practices in Spanish Ethical Mutual Funds: Analysis of Investee Companies". El artículo analiza los tipos de compañías que conforman el portafolio de los fondos mutuos de inversión ética españoles, caracterizando tales empresas desde el modelo de Gobierno corporativo que siguen, su estructura organizacional y algunas de sus variables económicas y financieras. Se presentan y evalúan diferentes modelos de Gobierno corporativo de las empresas en que se invierte y su relación con variables financieras. Los resultados muestran que las empresas que siguen un modelo de gobierno corporativo alemán son las preferidas por los fondos mutuos de inversión ética, seguidas de las empresas con modelos de Gobierno corporativo anglosajones. Es decir, a los fondos mutuos de inversión ética les interesa que las empresas en que invierten incluyan diferentes grupos de interés en sus procesos de gobernanza.Confiamos en que estos trabajos resulten de interés para la comunidad académica en ciencias sociales y administrativas a nivel nacional e internacional.
Part three of an interview with Matilda Koeller. Topics include: What it was like when her husband's mother died. His parents' involvement in politics, church, and social clubs. Work his family did on their house. Her husband's education, the work he did and his desire to fight in World War I. The social clubs Matilda and her husband belonged to. ; 1 MATILDA KOELLER: No, no. He did mostly home construction, repair work, you know. And Uncle Charlie worked. Uncle Al worked with him but they couldn't agree, so Al went on, on his own. DONALD KOELLER: And what was Uncle Al… he didn't become. he was a carpenter and remained a carpenter? MATILDA KOELLER: Yeah. Yeah. He remained a carpenter, but one of his last projects was at the Chicago Filter Plant at the foot of Grand Avenue, that great, big filter plant there. Um, I think you can go through it, 'cause we went through it. He worked there and he made big money. DONALD KOELLER: So there were five children? MATILDA KOELLER: And he waved the check in front of Dad, you know, when Dad wasn't working and never gave him a cent. DONALD KOELLER: When you say "Dad". MATILDA KOELLER: My-my husband, your father. And-and, uh, Al was going to treat Dad to a state dinner and that never. DONALD KOELLER: Was that a close family? I mean. MATILDA KOELLER: Yeah, very, very close. Yeah, very, very. they all looked pre. DONALD KOELLER: But not very friendly though? MATILDA KOELLER: Well, that was, uh, that was. remember, when Al was 60 years old and, uh, he had his own family, but the family was very close. They-they looked out for one another very, very much. They were very close, uh, uh, that, that was taught by his mother. DONALD KOELLER: By Clara? MATILDA KOELLER: Yeah, by Clara. DONALD KOELLER: And you said earlier Clara died. MATILDA KOELLER: She died. She took sick and they rushed her to the hospital and within a week, she was dead. And it was a terrible blow, not 2 only to the family but to the neighbor, Mrs. Lawrence. She'd been. DONALD KOELLER: The Mrs. Lawrence that I knew, that we knew in here? MATILDA KOELLER: Yeah, yeah, yeah. It was a terrible big blow. DONALD KOELLER: Why? Was she especially liked in the neighborhood? MATILDA KOELLER: Well, she was well liked in the neighborhood, and Dad and Freda were out to Walton League during that Sunday night, you know. Anyway, she had so many. those days, you had the coffin in the house and they were afraid the house would cave in. There were so many people in there. You know, they were. DONALD KOELLER: In those days, the Koeller family in that neighborhood was popular. MATILDA KOELLER: Yeah. DONALD KOELLER: I mean, I remember differently as it… MATILDA KOELLER: Well, no. Well, see, that was a different class of people. Then it was mostly Swedes and Germans, see. And they all. well, of course, too, Clara belonged to a fraternity and they all came. That was her only relaxation, too, was this fraternity. They had a picnic there once a year. And that flock of people came to see her, plus the neighbors. DONALD KOELLER: So then Frederick Koeller went back to Germany to get his mother? MATILDA KOELLER: Mother. DONALD KOELLER: And she then finished the rearing of Walt. MATILDA KOELLER: No, she didn't. Walter at that time was 18 years old. Your father was then 18 years old. And it was a case of he had to learn to cook, or starve. He always said, "Because Dad was a very good cook." DONALD KOELLER: You mean he did the cooking at home? Who was home? You mean he cooked for his father? 3 MATILDA KOELLER: Well, he had. yeah. They all chipped in, cooking and washing clothes. And Freda got married. I don't know now whether Freda was married. Mae was married. Now, Freda, I think, got married and they lived in the home but they couldn't get along so they moved out. Then Walt was left alone. DONALD KOELLER: With Charlie? MATILDA KOELLER: Well, Charlie then, he left home because there was no room, you know, and he left the home. And then he came back. DONALD KOELLER: He left to join the service. MATILDA KOELLER: Yeah, he left to go to service, and I guess he didn't come back home. I know there was no family when Grossmother died. Then him and Frederick, Charlie and Frederick, lived together. DONALD KOELLER: In the old house. MATILDA KOELLER: Yeah, in the old house. And then when we got married, when Dad and I got married, Mae and your father and mother would always go home on Sunday and cook a nice meal. Charlie was then the cook and he used to make a good meal for the whole family. And then we chipped in a dollar each to help pay for the food, you know. But Charlie would make mashed potatoes and put in half a pound of butter. You know, he was a good cook. And fruit salad, boy, all the fruit that. you know, he would open cans and cans and then buy bananas and different kinds of fruits and it was. DONALD KOELLER: Let's go back, just a couple of general questions. Did Dad ever talk about. what was the church background to Frederick and Clara? Were they members? MATILDA KOELLER: Well, they were. Frederick was confirmed in the Lutheran faith. I got their marriage certificate. Now, whether Clara was confirmed in the Lutheran faith, that, I don't know. But the church that they were brought up moved on Fullerton and. well, I don't know. Fullerton and they somehow or another4 then went to [unintelligible - 00:07:09] Church. And there is where Walt was confirmed. I'm pretty sure there is where Walt was confirmed. DONALD KOELLER: Were they active in the church beyond attending in any way? MATILDA KOELLER: Uh, the parents, no, none. DONALD KOELLER: Somewhat like your family then where they send the kids. MATILDA KOELLER: Yeah. They sent the children there. DONALD KOELLER: Was Frederick and Clara at all involved in politics or in city activities or any.? MATILDA KOELLER: No, no. Dad Koeller. DONALD KOELLER: You said Clara was part of some kind of guild or. MATILDA KOELLER: No. Frederick never was, but Clara belonged to a fraternity. Now, which fraternity, I don't know. And they had summer picnics. And they used to decorate the members' graves. So evidently, that must have probably. the group that Clara belonged was all passed away. Whether it continued, that, I wouldn't know. DONALD KOELLER: Where are Clara and Frederick buried? MATILDA KOELLER: At Concordia Cemetery, but it is changed. The name is changed now. Too different, too different, and it's. I think the name now is Oak Forest or Forest Oak. And there is where I want to have the graves taken care of. DONALD KOELLER: They need perpetual care. MATILDA KOELLER: Yeah, perpetual care. DONALD KOELLER: Who else is buried there? MATILDA KOELLER: Well, there is Grossmother and Clara and Frederick and Uncle Charlie – four. And the four graves that are next to it is where Uncle Al and Maude and two babies of theirs, they were removed from a different grave and put in two graves on this lot. DONALD KOELLER: With Al and Maude. 5 MATILDA KOELLER: Yeah. DONALD KOELLER: What can you tell me then now about Dad's childhood? It would be nice if Dad was here to answer all these but. MATILDA KOELLER: You mean, you mean. DONALD KOELLER: I mean, my father. MATILDA KOELLER: Yeah. Well. DONALD KOELLER: He was the youngest of five. MATILDA KOELLER: Well, as much as I know. he was the youngest and him and his mother were very close. And he used to go to the store, do most of the grocery shopping. He became a very good meat buyer. You know, he knew all the meats. When we got married, he knew all the different cuts and he knew just what he was buying and always the good cuts of meat, you know. And he used to have to walk [unintelligible - 00:10:28]. There was the grocery store or a dry good and grocery store and he used to have to walk quite a distance to go to that store and do shopping. DONALD KOELLER: Did Dad ever talk about the time they moved to Race Avenue? Could he remember that experience? MATILDA KOELLER: No. If you want to know something about. Walt was the youngest and Al was the oldest. And they dug out. Grandpa, Frederick Koeller decided he was going to open a wood and coal shop. By that time, he had horses and wagon. That's why that garage was really a barn because that hayloft is where they kept the hay for the horses. DONALD KOELLER: The old garage? MATILDA KOELLER: The old garage. DONALD KOELLER: What we call the old garage? MATILDA KOELLER: Yeah. You remember those big two doors, you know. DONALD KOELLER: That was a big barn. 6 MATILDA KOELLER: Well, then they dug out the back part of the basement, and every Sunday, Dad's friends came in and worked and they put this. added on and dug out and I know that Al was just a kid and that's all they had to do was work, work, work, you know, because Dad was a real. DONALD KOELLER: And when you say "Dad," you mean Frederick? MATILDA KOELLER: Frederick, yeah. And Clara, Walter's mother, used to have to serve a big meal for all these workmen that came in because that's the way they did things those days. Friends helped friends. DONALD KOELLER: And that was when they built the back room, the kitchen, what we know as the kitchen. MATILDA KOELLER: Yeah, and the basement. Yeah, and they dug that all out, you know. And it was quite. not only hard for Al because he had. he didn't have freedom. He had to work hard. But also for your grandmother who have to do so much cooking. DONALD KOELLER: And then for youngest Walter, he was running around, bringing everybody water, huh. MATILDA KOELLER: I suppose. [Laughs] But I mean, you know, he did a lot of delivering the milk. All of that was before, see. They didn't have. DONALD KOELLER: So they gave up the cow and all that when they came to Race. MATILDA KOELLER: Yeah, yeah, gave up all that. DONALD KOELLER: Did he actually get a coal business then, too? MATILDA KOELLER: No, it never panned out. See, that's why they had the front entrance, and that was going to be, I guess, the office. It was that big room in the front. It never panned out to be a coal and wood. Then he evidently must have gotten a carpentry job or something or. it never panned out. DONALD KOELLER: Did Dad ever talk about special places they went or things they did in his 10, 11, 12-year-old time? 7 MATILDA KOELLER: Well, the only thing that I can remember is that they went to this fraternity that she belonged and they had a very good friend by the name of Sanders and visited back and forth. And the Sanders are buried down in the same cemetery, and I know that your father and I used to pass the Sanders' grave and it was sort of pathetic because the whole family was gone and nobody to take care of the graves. But they have stones on that. DONALD KOELLER: How did Dad describe himself when his mother died? You said he was very close to her. What was he, 16,17 at the time? MATILDA KOELLER: He was 18. DONALD KOELLER: Eighteen. MATILDA KOELLER: Yeah. He took it pretty hard and he always promised to. let's see. He promised his mother to take care of the finances for his father, see. And so, Dad's name was on his father's bank book and took care of all the finances because Dad bought notes, home notes and things like that. And of course, he lost practically all of that with the Depression. DONALD KOELLER: Dad was a very bright, young man. MATILDA KOELLER: Yeah, your father was, yeah, very. He knew finances and he always read finances. And another thing, you know, he used to read so much of the newspaper. I used to swear that he read it from front. from the beginning to the end because when we got married, you know, he sat there and read paper, and I wasn't interested so much in newspaper. I would sit there and maybe chat or something and he would sit there and first thing you know, I started crying because I felt I was neglected. The paper was more important than I was. That was the first year we were married, you know. DONALD KOELLER: Boy. MATILDA KOELLER: Yeah. 8 DONALD KOELLER: You should've hit him. MATILDA KOELLER: I should've, you know. But that was his way at home. Before he was married, he promised that. I think he promised his dad that he wouldn't. or he promised himself he wouldn't get married until Grossmother was passed away. DONALD KOELLER: I have a little problem now. Let's just check dates. You may not be able to do this. If Dad was born 1898 and was 18 when Clara died, that would mean she died in 1916. World War I started in 1914. MATILDA KOELLER: Oh, no, no, no. Clara died in 19. wait, 1916. Yeah, something like that. DONALD KOELLER: So then when he went to get Grossmother, World War I was going on then? Not the United States. I mean, Germany was fighting Great Britain. MATILDA KOELLER: Yeah. Yeah. DONALD KOELLER: And the United States wasn't involved. MATILDA KOELLER: Yeah. DONALD KOELLER: So then there was risk that they would be sunk, depending on what kind of ship could get out of Germany. Well, that would be something that. who would know stuff like that? I mean, if you. I mean, who left. MATILDA KOELLER: There's nobody in the family that would know, except on the notes that dad has in the family tree on his side. Now, whether he has anything written there – because I kept saying to dad, "Get your family tree together, please," you know, and he just lacked ambition. And I said it to him. I said it to him between four and six months before he died. He used to sit by the front window and just do nothing, just sit. And I said to him, "Why don't you fix the family tree?" not thinking that he would die, just so that he would have something to do. 9 DONALD KOELLER: Or somebody could have come and sat with him with a tape recorder. MATILDA KOELLER: Yeah. Yeah. DONALD KOELLER: But anyway, Dad's school, how far. as I recall, Dad did not go very far with schooling. MATILDA KOELLER: Well, Dad graduated. He went to college for two years. DONALD KOELLER: Oh, he finished high school? MATILDA KOELLER: Yeah. Oh, yeah. DONALD KOELLER: And two years of. where did he go to school? MATILDA KOELLER: Well, what was that school on Milwaukee there? Carl Schurz, I think. I mean, Carl Schurz. well, you know. DONALD KOELLER: That was the high school? MATILDA KOELLER: That was the high school there. DONALD KOELLER: Can you see. do you know where he went to college, what college he went or what he studied? MATILDA KOELLER: I don't think he went. I'm sure he graduated from high school. But I know that he took up—what do you call it—economics, because he knew a lot about economics, so he must have taken that up some. other than high school, some college or some night school. DONALD KOELLER: What did Dad say or remember as his first job, you know, apart from working for his dad? MATILDA KOELLER: Well, the only thing that he used to talk a lot about. he was a salesman for a while. DONALD KOELLER: Yeah, I've heard him talk about that. Tell me about his job as a salesman. MATILDA KOELLER: Well, he got a job selling the rubber covers for the typewriters. Did he ever tell you that? DONALD KOELLER: Oh, yeah. MATILDA KOELLER: Yeah. And then he went to Indiana and… Dad was like. people took to dad. So he got into this office and I guess they 10 didn't want to be bothered with him but he says, "I'll let one of the girls try it in the office." And she liked it. I don't know. He sold everybody a set of those basically. DONALD KOELLER: What was the purpose of the rubber tip? MATILDA KOELLER: The rubber tip would be easier on the fingers and less noise on the typewriter, I think. DONALD KOELLER: So he traveled from office to office, peddling? MATILDA KOELLER: Yeah, peddling these and he. DONALD KOELLER: When would that have been? MATILDA KOELLER: Well, that would have been in the early '20s, the '20s or somewhere around there. DONALD KOELLER: Dad was too young to go to World War I. MATILDA KOELLER: Yeah. DONALD KOELLER: He was too young. MATILDA KOELLER: He was too. and they. DONALD KOELLER: Just barely, though, right? MATILDA KOELLER: Yeah. And they said, "Oh, you're underweight." So he went home and ate bananas, bananas and drank water, bananas and he didn't. he didn't gain an ounce. [Laughs] DONALD KOELLER: He did want to join. He did want to join. MATILDA KOELLER: Yeah, he did want to join. Yeah, he wanted to join. Because I guess living at home wasn't so, you know. with his mother gone. DONALD KOELLER: Well, it was a pretty glamorous war, the way they're describing it, a patriotic thing to do. MATILDA KOELLER: Yeah, yeah, it was a very patriotic thing. Because Oscar, you know, your uncle, he always regretted that he couldn't serve because he had to support his mother, you know. And he always felt a misfit. DONALD KOELLER: And the war was over then before Dad was old enough to.11 MATILDA KOELLER: To go. And he was. and in the second place, he was underweight. DONALD KOELLER: Under. yeah, he must have been because if he was. 1898, well then by 1918, he was 20. That was old enough to go. But he was underweight. MATILDA KOELLER: Yeah, but he was, but he was. DONALD KOELLER: Was he a healthy man, a healthy boy, or.? MATILDA KOELLER: No, he had a speech impediment. He had kind of a speech trouble. Because his mother didn't know that, you know, living with him until he was to talk at, I think, the graduation or something. Then she realized that he had an impediment in his speech and that held him back, too. DONALD KOELLER: But he overcame that. MATILDA KOELLER: Yeah, he overcame that. DONALD KOELLER: Do you know how? MATILDA KOELLER: Yeah. Well, I suppose as. I think how he overcame it, probably joining the Walton League because he used to get up and talk and you can't. and he did stutter once in a while because I remember, you know. he didn't know me but I knew him. DONALD KOELLER: So you met Dad in the Walton League? MATILDA KOELLER: Yeah. Well, he belonged to the Walton League and I belonged to the Walton League. DONALD KOELLER: And this is at Bethlehem Church? MATILDA KOELLER: No, this is at Christ Church. DONALD KOELLER: Christ Church. MATILDA KOELLER: But in those days, if you were a year. as much as a year younger, you were a shrimp. And that is why they had the Senior Walton League and then the Younger Walton League. DONALD KOELLER: Junior Walton League. 12 MATILDA KOELLER: Junior Walton League. See, I was three years younger than Dad. And by that time, Walt was well established in the Walton League. He went to conventions and he gave reports, and I used to be there at the meeting but he never knew me. DONALD KOELLER: So he was deeply involved in. MATILDA KOELLER: Very deeply involved in Walton League. Yeah. DONALD KOELLER: And the church in general? MATILDA KOELLER: And the church in general. But he. DONALD KOELLER: What kinds of things did the Walton League do in those days? MATILDA KOELLER: Well, they used to go on hikes and picnics and, of course, they had bunco then. DONALD KOELLER: Bunco. What's bunco? MATILDA KOELLER: Yeah. But then, you know, it got so out of hand, you know, that. from Saint Louis, it. DONALD KOELLER: What was bunco? MATILDA KOELLER: Bunco was playing with dice. Bunco was playing with dice and you know, and. well, the first dice was thrown, then you were to work on that one. you know, if one was thrown, then you had your two dice and you throw it. Well, if you didn't get a one, then the next party would try. And whoever got a three once, that would be bunco. DONALD KOELLER: And what would that do for you? MATILDA KOELLER: That means that whoever. your partner would get a mark on their tally, see, and if you threw three twos or three threes or something, that would be counted as five. And whoever got 23 first. your partner and you got 23, then that would be the end of that game, of that until. you would play maybe an hour and a half. Then they would give a prize. But it got so out of hand, that that's all they wanted to do, was play bunco. DONALD KOELLER: This was the young people? MATILDA KOELLER: This was the young people. 13 DONALD KOELLER: These weren't the old folks like… MATILDA KOELLER: No, no. DONALD KOELLER: This was the young people come together and have a good day. MATILDA KOELLER: Yeah, yeah. And we raised money, a little money, that way. For what, I don't know, you know. DONALD KOELLER: Then all of a sudden, the church. MATILDA KOELLER: Yeah, the church started to put a clamp on it and then of course, eventually, it. because we used to. it wasn't only done down at church. We'd hire a big hall. DONALD KOELLER: This was the Walton League? MATILDA KOELLER: Yeah, this was the Walton League. DONALD KOELLER: [Laughs]. Did you have dances? MATILDA KOELLER: No. No dancing. DONALD KOELLER: Why not? MATILDA KOELLER: Well, why not? [Laughs] Because your body and his body would be up against and that was temptation. DONALD KOELLER: Oh, I remember. Of course, I remember. MATILDA KOELLER: Of course, now, [Luz] Church. They had a dance in Luz Church And she wrote and she says, "Just think: What we couldn't do, we're doing now." [Laughs] DONALD KOELLER: "Letting our kids get away with." But when you went to Walton League, you went to these bunco things or the picnics and. MATILDA KOELLER: Yeah, yeah. But that was. I belonged to Talitha Club. DONALD KOELLER: The what? MATILDA KOELLER: I didn't go too much to Walton League because I was. not that I want to make myself younger than what I. but I never was taken for my age. I was always taken. and once I worked with the Revere Electric and I. the fellow, he fell for me. And when I told him. actually, he tried to guess my age and keep going down. I was then going with your Dad and I was 25 and 14 he says, "Well, I'll start out with 22, and 21, 20." Then he went back to 22 again and 23. And he said, "Well, you're not that old, you know." He says, "You're older than 18." I was actually 25 and he wouldn't believe me. So you can imagine when I was 18 that I probably looked like 15, and so. DONALD KOELLER: But the Walton League then really was for people in their young 20s. MATILDA KOELLER: Yeah, yeah. DONALD KOELLER: Well, what was the Talitha Club? MATILDA KOELLER: Talitha was a girls' club of sewing, where we would get together and sew every other week. And then, of course, then later on, too, they got into the bunco business. So between the Walton League and that, it was just way out of hand, you know. DONALD KOELLER: And this was in the early '20s? MATILDA KOELLER: Yeah, this was. DONALD KOELLER: What job did Dad have when you first met? MATILDA KOELLER: Well, Dad had this job of transporting automobiles from Janesville to Chicago. He had what you would call a trailer./AT/mb/ee
Die Inhalte der verlinkten Blogs und Blog Beiträge unterliegen in vielen Fällen keiner redaktionellen Kontrolle.
Warnung zur Verfügbarkeit
Eine dauerhafte Verfügbarkeit ist nicht garantiert und liegt vollumfänglich in den Händen der Blogbetreiber:innen. Bitte erstellen Sie sich selbständig eine Kopie falls Sie einen Blog Beitrag zitieren möchten.
Robert Fico has long been a dominant figure in Slovakia, having served as prime minister from 2006-10, 2012-18, and then 2023-present. He has upset many believers in transatlantic unity for various reasons — chiefly his opposition to the West's arming of Ukraine, which shares a 60-mile border with Slovakia. Depicting the war there as an "American-Russian conflict," Fico campaigned last year on giving Kyiv "not another bullet." Often characterized as a "pro-Kremlin" politician, he has criticized Western sanctions on Moscow.On May 15, Fico was the target of an assassination attempt. A gunman shot him five times at close range in Handlová, a small town in central Slovakia. Fico survived albeit in critical condition. The attack marked the first assassination attempt on a European prime minister in 21 years. According to Interior Minister Matúš Šutaj Eštok, the alleged assailant, Juraj Cintula, was politically motivated and possibly not acting alone. The attempt occurred shortly after presidential elections, which one of Fico's allies, Peter Pellegrini, won in the second round.Political and social divisionsSlovakia's politics are extremely polarized. Among Slovaks, many staunchly support Fico while many others loathe him. There are those in the country who embrace Western-style liberalism and believe Bratislava's foreign policy should be closely aligned with its Western allies in NATO and the EU, both of which Slovakia joined in 2004. On the conservative end of the spectrum, a majority of Slovak voters support Fico's government as a defender of Slovak traditions by, for example, rejecting "gender ideology.""Each group not only holds different visions for Slovakia's future but also perceives the other's agenda as a direct threat to their way of life and values, and this is exaggerated and weaponized as a means of political capital," Zuzana Palovic, co-author of "Czechoslovakia: Behind the Iron Curtain," told RS.The murder of journalist Ján Kuciak and his fiancée in 2018, the government's COVID response, and Russia's invasion of Ukraine in 2022 all deepened polarization in Slovakia. Fico's government routinely criticizes the opposition for serving the Western liberal order while his opponents attack him for being too Moscow-friendly and rolling back media freedoms. Many point to Russian propaganda as a significant driver of polarization in this former Soviet satellite, which is the case in other EU member-states too.In the 2020-23 period, a number of Fico's political allies were indicted for corruption and subsequently convicted. "While some of the cases were half-baked, Fico's defense always has been that everything is just a political witch hunt—yes, he sounds like Trump here," according to Andrej Matišák, a journalist who works for the Slovak daily Pravda. "By undermining the work of policemen, prosecutors, and judges, he created another piece of the polarization puzzle," he told RS."The Slovak politicians themselves contributed to the status quo in Slovakia. Political accusations are never ending in Slovakia," said Lívia Benko, a research fellow at the Austrian Institute for European and Security Policy. "The recent political landscape reveals that the number of hateful statements from politicians is on the rise," she added.The assassination attempt has exacerbated tensions within Slovak society. Outgoing President Zuzana Čaputová has emphasized the need to prevent further escalation. But her appeal thus far appears to be ignored by both sides of the political spectrum."The appeal for calmness and unity is not being respected to the extent it should be by either the polarized society, in which family members do not speak to each other over politics, nor by the coalition and opposition," Benko noted."The current political landscape in which politicians and their family members are getting threatening letters is very complex," she added. "Slovak politics are full of conspiracy theories and disinformation. This is all reflected on social media platforms."Talk of 'civil war'Following the assassination attempt, Eštok warned that the country is "on the edge of a civil war" due to the rhetoric on social media. According to Palovic, such language coming from the minister "reflects concerns about the stability and unity of Slovakia — mentally, emotionally, and socially."Matišák said Eštok's talk of civil war was understandable given the powerful emotions at that moment. But he also described it as a "very unfortunate statement.""Only the government has the means to start the civil war, and, in that case, it wouldn't even be a civil war; it would be some kind of putsch against the democratic regime in Slovakia. I don't believe that will happen, so I read the minister's words as an attempt to communicate with his own electorate to suggest that first of all the 'other side' is responsible for what happened. As I said, it is unfortunate, and he should know better," Matišák said."It's the rhetorical equivalent of firefighters starting their job by throwing a canister of gas into the fire," Matej Kandrík, a co-founder of Adapt Institute, a Bratislava-based think tank, told RS."It's both irresponsible and dangerous. Slovakia is nowhere close to a civil war. Unfortunately, [Eštok] is speaking like he is a candidate running in the election and not as a minister of the interior."The road aheadUnsurprisingly, this month's assassination attempt has clearly raised serious concerns about the trajectory of Slovakia's deep-seated societal and political divisions. What comes next will depend heavily on the government's actions, according to Benko, particularly regarding how the state may use the attack as a pretext for cracking down on the opposition and independent civil society groups and media.Doing so, on the other hand, could negatively affect its standing with the EU, an important source of financial and development assistance."The terrible shape of public finances increased the relative importance of EU funds for Slovakia. Suppose the European Commission will stay adamant about protecting the rule of law and the quality of democracy. In that case, it should prevent the most aggressive moves to solidify the power of the government," Kandrík told RS. "Still, I expect the situation to worsen for all pro-democratic actors.""In a normal country, the normal reaction would be for all political elites to lock themselves around the principles of democracy and the rule of law. However, it seems that some people in Slovakia, especially from the pro-government spectrum, are intensifying the polarization," said the Slovak journalist."I am afraid that the main aim of the majority of the players from the governing coalition is to use the current events to strengthen their grip on power [rather than] to calm down the situation. On the other hand, I very much hope I will be proved wrong."Implications for US foreign policyBack in the 1990s, when the autocratic leader Vladimir Mečiar was independent Slovakia's first prime minister, the Slovak government basically ran the country like a mafia state. In the mid-1990s, NATO delayed Slovakia's membership application due to the country's domestic issues. By 1998, then-U.S. Secretary of State Madeline Albright called Slovakia a "black hole in the center of Europe." That was only six years before it joined the transatlantic alliance and the EU.Today, Washington has much at stake in the future of Slovakia, which sits on the fault line of a divided Europe. Having militarily cooperated closely with the U.S. since 1993, Slovakia remains an important U.S. ally on NATO's eastern flank at a time of intensified hostilities between Russia and the West.Amid a period in which Fico and Hungary's Viktor Orbán increasingly align their countries with Moscow in ways that many Western policymakers believe is a thorn in the EU's side, debates over how Washington and Brussels should try to influence these "renegade EU leaders" in Bratislava and Budapest are sensitive. There is reason to consider how Western pressure on these Russia-friendly NATO and EU members has potential to backfire in ways that further erode the West's unity against Moscow.This month's attempted assassination risks manifesting in an exacerbation of Slovakia's internal tensions, as well as those between Bratislava and Brussels. This would be especially so if Fico's government pushes through initiatives that weaken the rule-of-law. Although the immediate implications of the attempt on Fico's life for Washington's interests are currently difficult to assess, instability in Slovakia could have major ramifications for U.S. foreign policy interests in this part of Europe, particularly within the context of the continent's evolving security architecture.
Die Inhalte der verlinkten Blogs und Blog Beiträge unterliegen in vielen Fällen keiner redaktionellen Kontrolle.
Warnung zur Verfügbarkeit
Eine dauerhafte Verfügbarkeit ist nicht garantiert und liegt vollumfänglich in den Händen der Blogbetreiber:innen. Bitte erstellen Sie sich selbständig eine Kopie falls Sie einen Blog Beitrag zitieren möchten.
After news of the reported explosions on the Nord Stream pipelines broke a year ago today, the media was ablaze with speculation, mostly in the direction of the Russian government."Everything is pointing to Russia," blared a POLITICO headline two days after the explosions. Quoted in the piece were a number of foreign commentators including the former president of the German Federal Intelligence Service, saying that only Russia had the means and motives to do it. "We still don't know 100 percent that Russia was responsible," said Olga Khakova, deputy director for European energy security at the Atlantic Council. "But everything is pointing to Russia being behind this." U.S. Energy Secretary Jennifer Granholm told BBC on Sept. 30 that it "seems" Russia was was behind the sabotage.By October the Washington Post Editorial Board was raising the alarms about more attacks against "the West.""This is the kind of capability usually wielded by a state actor, though NATO did not say officially what everyone suspects unofficially: The author of this strike against Europe's stability and security was Russia. Now, the United States and its allies must meet a new challenge: threats to critical infrastructure, just as they are about to try to get through winter without Russian oil and gas."Aside from a Twitter-impulsive former Polish foreign minister gleefully suggesting the U.S. did it, the mainstream media commentariat had no inhibitions about openly blaming Russia through the fall of 2022.A year later, however, the world still does not know "who done it." Some critics suggest the probes may be getting into politically uncomfortable territory, with recent German reports pointing to a Ukrainian military connection to the blasts. "Whether it's instinctive or by direction, there is a clear attempt to simply bury this story completely," said Anatol Lieven, the director of the Quincy Institute's Eurasia Program, comparing the seeming lack of U.S. media interest to George Orwell's "memory hole" in the novel "1984." "Obviously that is because the main theories that have been advanced for the responsibility of the sabotage, if true, would be imminently embarrassing for Western governments."Germany, Denmark, and Sweden have been conducting separate investigations. In a joint statement on Sept. 30, Denmark and Sweden told the United Nations Security Council in a letter that the leaks were caused by at least two detonations with "several hundred kilos" of explosives. By late last year, however, European sources were quietly dismissing Russia's role in what was being deemed as a sabotage, saying there was "no conclusive evidence" that would lead to Moscow.Since then there has been reporting by Sy Hersh that the United States coordinated the attacks, using a secret expert U.S. Navy diving team. This was largely ignored, refuted and scoffed at by the mainstream media and officials in the West. Soon after, it was revealed that German investigators were pursuing a second theory: that it was the work of a pro-Ukrainian outfit, either rogue or Ukrainian government-connected. Swedish investigators believe, by the way, that the attack could only be the work of a state actor.Leaked CIA documents earlier this year show that the U.S. had intelligence that the "Ukrainian military had planned a covert attack on the undersea network, using a small team of divers who reported directly to the commander in chief of the Ukrainian armed forces," at least three months before the actual explosions. What we don't know is if the Ukrainians actually went through with it, though at least one unnamed U.S. official said the CIA "warned" Ukraine not to.Most recently, an exhaustive investigation by 19 Der Spiegel writers reported that all roads were indeed leading to Ukraine. At least that is what German investigators are telling them. From their report Aug. 28:Investigators from the BKA (Federal Criminal Police Office), the Federal Police and the Office of the Federal Prosecutor have few remaining doubts that a Ukrainian commando was responsible for blowing up the pipelines. A striking number of clues point to Ukraine, they say.And the possible motives also seem clear to international security circles: The aim, they say, was to deprive Moscow of an important source of revenue for financing the war against Ukraine. And at the same time to deprive Putin once and for all of his most important instrument of blackmail against the German government.How far up the chain it goes nobody yet knows, or if other state actors were involved. After the story of the CIA leaks, Zelensky vehemently denied the charges."I am president and I give orders accordingly," he said. "Nothing of the sort has been done by Ukraine."But the mystery continues and there seems to be no urgency — save for Der Spiegel's intensive reporting — to push the issue further, at least in the U.S. press. That's likely because, as Lieven and others contend, there is no political gain, only embarrassment if the U.S. is behind the attack, as Hersh alleges, or Ukraine is, as the German inquiry seems to be unraveling. For his part, Russian President Putin believes the U.S, not Ukraine, is the culprit. Others, including the German defense minister have suggested the Kyiv theory is a "false flag" to blame Ukraine. "It seems very strange" that NATO governments, with their massive intelligence capabilities — particularly Washington's global reach — "seem unable to get to the bottom of this," Jacobin reporter Branko Marcetic tells RS."But even stranger still is the seeming lack of Interest and discussion from these countries' various media establishments and politicians, about an attack that destroyed a major piece of a NATO ally's infrastructure."To be fair, as Der Spiegel notes, the German investigators "cannot conduct investigations in Ukraine, and it isn't expected that Kyiv will provide much support. The German authorities have also shied away from submitting a request to Ukraine for legal assistance because doing so would require that they reveal what they know."Meanwhile, who has benefited from the permanent shutdown of Nord Stream 1 (the EU was importing 35 percent of its natural gas from this pipeline until it was shut off after the invasion) and Nord Stream 2 never going online (which the U.S. had swore would never happen)?"The United States without a question (has benefited)," asserts Lieven. "It made it much more difficult for Germany to ever move back into an intensive energy relationship with Russia and made German and other European countries even more permanently dependent on imports of liquified natural gas from the United States."Nord Stream pipelines, which run from Russia to Germany, are majority owned (51 percent) by Russian Gazprom, along with German, Dutch and French stakeholders. In 2022, Europe became the primary destination for U.S. LNG exports in 2022, according to the Energy Information Association, accounting for 64 percent of total exports. Four countries — France, the U.K., Spain, and the Netherlands — accounted for a combined 74 percent of those exports. Aside from the U.S., Germany is also getting gas supplies from Norway and the Gulf States. Meanwhile the West's break from Russian energy beyond the Nord Stream rupture has done serious damage to the German economy. But the torrent of responses after the Sept. 26 attack blamed Russia because, as was the line, Moscow wanted to strike fear into the West. President Putin did it because Moscow was "weaponizing energy" and that it was "desperate." None of that has been walked back and without any real attention to what really happened, no one truly feels the need to.In fact, in its own anniversary recollections, the Washington Post barely mentions that this narrative was repeated for another month after the explosions."Whether or not that's the full story is hard to say at this point," Marcetic said, pointing to the Ukrainian connection, "but the fact that a state that is receiving unprecedented levels of military and financial support from NATO has been accused of carrying out an attack on a NATO ally is obviously significant. Yet this is another data point in this war that many clearly would rather not discuss or acknowledge even as it pertains directly to burning issues like Ukraine's possible entry into the alliance."The mystery, as they say, remains unsolved.
The main motivation that guides this article is the need to contribute to broadening and deepening the objects of study addressed by feminist perspectives in international relations. This is for two related reasons: firstly, to contribute to the process of ontological revisionism of the discipline that has been inaugurated by these kinds of approaches; and, secondly, to contribute to the visibility of international practices and dynamics that perpetuate logics of subordination and exclusion towards different corporeality based on the matrix of colonial, capitalist and patriarchal domination. This article departs from the premise that international cooperation is a complex and multidimensional object of study that has historically been approached by the liberal tradition of international relations (Pereyra Rodríguez, 2014). Gradually, different approaches to the discipline began to inquire about the motives, procedures and outcomes as a result of the growing importance that these interactions acquired as fundamental dynamics of international relations. In the framework of the academic literature on feminisms, international cooperation has received less attention with respect to another set of processes associated with development, conflicts, and peace and security. In this sense, the purpose of this article is to contribute to the problematization of international cooperation from feminist perspectives broadly, and from decolonial feminism in particular. This will be done in a systematic way based on the methodology of documentary review. It is important to state that in the field of international relations, feminist perspectives express a "set of ideas woven around the critique of patriarchal values and dynamics on which states and global societies were structured" (Villarroel Peña, 2007, p. 66). According to the author, the new approaches implied a series of disruptions in the ontological, epistemological and methodological dimensions that, consequently, motivated the formulation of new models of knowledge production. In such context of emergence, feminist perspectives were considered dissident proposals in relation to the traditional mainstream theoretical schools because they aimed to highlight the insufficiency of paradigmatic investigations of the discipline that had been based on a partial and not neutral approach of international dynamics and practices (Villarroel Peña, 2007; Salomón, 2002). In order to achieve the proposed aim, in the first section of this article, the general panorama in which gender studies in the Social Sciences was inserted shall be described. Likewise, the conditions of emergence and enunciation of feminisms in the discipline of international relations will be addressed, and their main ontological, epistemological and methodological contributions will be made explicit. In the second section, the specificity of the situated narrative of decolonial feminisms, understood as a disruption of the homogenizing and falsely universalistic postulates of hegemonic feminisms, will be analyzed. Based on the guidelines offered by the first two sections, the third section will inquire into the implications of international cooperation for feminisms in general, and decolonial feminisms in particular. The goal here is to elucidate to what extent a perpetuating mechanism of asymmetries is expressed, and how it is possible to overcome patriarchal logics from an emancipatory perspective. Finally, brief conclusions will be shared. In summary, some relevant conclusions have been found through the elaboration of the article. In the first place, it is important to note that, although international cooperation does not represent the object of study most in-depth analyzed by feminist perspectives in international relations, this focus is fundamental for the same two reasons that justify this article. That is, due to the need to contribute to the ontological revisionism of the discipline, and the need to make visible the ways in which international practices and dynamics perpetuate logics of subordination and exclusion towards different corporeality based on the matrix of colonial, capitalist and patriarchal domination. Secondly, the study of international cooperation from perspectives –like feminism- that seek to contribute to the transformation of unequal and hierarchical gender social relations is fundamental not only in academic terms, but also in a practical way. Indeed, the combination of research and political activism promulgated by feminisms should radiate in the elucidation of the practices and dynamics of international cooperation because it is precisely in this field that important opportunities can be detected to make visible and socialize conditions of existence, resistance and struggle shared between different social groups located in different places. In effect, research must be thought of as an inessential component of political practices inasmuch as it offers horizontal action guidelines, and as it contributes to identifying the perpetuation of mechanisms that reproduce asymmetric logics in an androcentric, cisgeneric and colonial way. Thirdly, intersectionality -such a significant category for feminist approaches- can become a central hermeneutical perspective to formulate instances of international cooperation that are devised in a respectful way with the particularities of local identities, interests and expectations. Likewise, it can be shown that it allows for the provision of pragmatic content to the decolonial strategy of building alliances between social groups to promote demands that were historically invisibilized. In short, it has been demonstrated that international cooperation itself does not represent a sign of progress, evolution or emancipation. On the contrary, we state that it is a mere interaction whose content and planning must be based on the capacity of agency of local actors, and whose development must be in accordance with the particularities expressed by each social group. In addition, feminist criticisms of the ways in which international cooperation was traditionally conducted should not be limited to advocating a greater incorporation of female officials as the ultimate goal of the demands. Indeed, recovering the criticism directed towards hegemonic feminism, particular attention should be paid to promoting pinkwashing initiatives that in no way contribute to dismantling the underlying problems that emerge from the matrix of colonial, capitalist and patriarchal domination. On the contrary, it is emphasized that international cooperation should only be a possibility in so far as it is structured on the basis of the demands of the groups involved. In this sense, initiatives must be bottom-up, and should be respectful of local identities and expectations. Lastly, we can conclude that as long as international cooperation initiatives are not structured in a situated and contextual way, it will be very unlikely that collective emancipation strategies can be articulated. Moreover, this will only contribute to reaffirming the reproductive mechanisms of gender asymmetries in the international system. Contributions from decolonial feminisms, therefore, are essential to generate limitations to the reproduction of unequal and hierarchical gender social relations both in the areas of international cooperation policy formulation, and that of theory formulation. ; La motivación principal que orienta el presente artículo está justificada por la necesidad de contribuir a ampliar y profundizar los objetos de estudio abordados por las perspectivas feministas en Relaciones Internacionales por dos motivos: en primer lugar, para coadyuvar al proceso de revisionismo ontológico de la disciplina inaugurado por esta clase de enfoques; y, en segundo lugar, para aportar a la visibilización pragmática de prácticas y dinámicas internacionales que perpetúan lógicas de subordinación y exclusión hacia distintas corporalidades en base a la matriz de dominación colonial, capitalista y patriarcal. Se parte de la premisa de que la cooperación internacional representa una interacción básica de las relaciones internacionales y que, en el marco de la literatura académica de los feminismos recibió menor atención con respecto a otro conjunto de procesos asociados con el desarrollo, los conflictos, la paz y la seguridad. En tal sentido, el propósito del presente artículo consiste en contribuir a la problematización de la cooperación internacional desde las perspectivas feministas de manera general y de los feminismos decoloniales de modo particular de forma sistematizada a partir de una metodología de revisión documental. Para poder dar cuenta de ello, en la primera sección se describirá el panorama general en el que se insertaron los estudios de género en las Ciencias Sociales. Asimismo, se abordarán las condiciones de emergencia y enunciación de los feminismos en la disciplina de las Relaciones Internacionales y se explicitarán sus principales aportes ontológicos, epistemológicos y metodológicos. En la segunda sección, se analizará la especificidad de la narrativa situada de los feminismos decoloniales entendida como una ruptura hacia los postulados homogeneizantes y falsamente pretendidos universalistas de los feminismos hegemónicos. En base a los lineamientos ofrecidos por las dos primeras secciones, en la tercera sección se indagará acerca de las implicancias de la cooperación internacional para los feminismos de manera general y de los feminismos decoloniales de modo particular con el propósito de dilucidar en qué medida se expresa un mecanismo perpetuador de asimetrías y de qué forma es posible lograr una superación de las lógicas patriarcales en clave emancipatoria. Finalmente, se compartirán unas breves conclusiones.
Els artistes són imprescindibles en les societats democràtiques. L'art enriqueix a la societat, ens ajuda a interpretar i a reflexionar sobre la realitat. La societat s'ha de donar de les lleis necessàries perquè els artistes puguin de les seves obres i d'aquesta manera assegurar-nos que podem continuar beneficiant-nos i enriquint-nos amb les seves creacions, fins i tot quan aquestes obres poden ser reproduïdes sense que el seu creador pugui fer res per evitar-ho. Aquest és l'objectiu de la Llei de Propietat Intel·lectual: Fomentar la innovació i el progrés, i protegir els drets patrimonials i morals dels autors i titulars de les obres protegibles. La història de l'art reconeix l'art conceptual com un moviment artístic fonamental sense el qual seria impossible entendre l'evolució i el discurs de l'art dels nostres dies. Però la naturalesa de l'art conceptual i desmaterialitzat sembla haver col·lisionat amb les definicions i doctrines legals del dret d'autor. La consideració d '"obra protegida" per la Llei de Propietat Intel·lectual no coincideix sempre amb el concepte d' "obra artística". A l'altra cara de la moneda hi ha l'art apropiacionista: L'apropiació artística és l'ús d'una o més obres alienes pre-existents, gairebé sempre sense permís, ja sigui transformant el seu aspecte original o reproduint-les total o parcialment sense cap modificació, per ser incorporades en un context diferent al seu context original, amb l'objectiu d'examinar qüestions referents a la seva originalitat o de rebel·lar significats que prèviament no eren visibles en l'original. Aquesta pràctica està absolutament generalitzada entre els artistes contemporanis, i els artistes apropiacionistes són els que amb més freqüència s'ha ocupat de la crítica o comentari polític en les seves obres. El sistema de límits que permet l'ús de continguts aliens a la pròpia obra no està pensat per a aquest tipus d'obres, i el dret de llibertat de creació dels artistes que s'expressen mitjançant obres d'art que incorporen obres de tercers no preval en tots els casos. La Llei de Propietat Intel·lectual s'ha adaptat ràpidament a les necessitats i pretensions de les obres creades per les indústries culturals que basen el seu model de negoci en l'explotació de drets d'autor en un context digital. Però Fa més de 100 anys, el 1917, Marcel Duchamp va canviar la història de l'art per sempre amb la seva obra "Fountain". Ni el concepte d '"obra protegible" com a àmbit de protecció material de el dret d'autor ni el sistema de límits o excepcions a la Llei de Propietat Intel·lectual han avançat de forma paral·lela als corrents artístics. Potser aquests són alguns dels motius que han portat artistes visuals a deixar de percebre la Llei de Propietat intel·lectual com "la seva" Llei i a reclamar una major flexibilitat en els límits. ; Los artistas son imprescindibles en las sociedades democráticas. El arte enriquece a la sociedad, nos ayuda a interpretar y a reflexionar sobre la realidad. La sociedad debe dotarse de las leyes necesarias para que los artistas pueden vivir creando sus obras y de esta manera asegurarnos que podemos continuar beneficiándonos y enriqueciéndonos con sus creaciones, incluso cuando estas obras pueden ser reproducidas sin que su creador pueda hacer nada para evitarlo. Este es el objetivo de la Ley de Propiedad Intelectual: Fomentar la innovación y el avance, y proteger los derechos patrimoniales y morales de los autores y titulares de las obras protegibles. La historia del arte reconoce el arte conceptual como un movimiento artístico fundamental sin cuya existencia sería imposible entender la evolución y el discurso del arte de nuestros días. pero, sin embargo, La naturaleza del arte conceptual y desmaterializado parece haber colisionado con las definiciones y doctrinas legales del derecho de autor. La consideración de "obra protegida" por la Ley de Propiedad Intelectual no coincide siempre con el concepto de "obra artística". Al otro lado de la moneda está el arte apropiacionista: La apropiación en arte es el uso de una o más obras ajenas pre-existentes, casi siempre sin permiso, ya sea transformando su aspecto original o reproduciéndolas total o parcialmente sin modificación alguna, para ser incorporadas en un contexto diferente a su contexto original, con el objetivo de examinar cuestiones referentes a su originalidad o de rebelar significados que previamente no eran visibles en el original. Esta práctica está absolutamente generalizada entre los artistas contemporáneos, y los artistas apropiacionistas son los que con más frecuencia se ha ocupado de la crítica o comentario político en sus obras. El sistema de límites que permite el uso de contenidos ajenos en la propia obra no está pensado para este tipo de obras, y el derecho de libertad de creación de los artistas que se expresan mediante obras de arte que incorporan obras de terceros no prevalece en todos los casos. La Ley de Propiedad Intelectual se ha adaptado rápidamente a las necesidades y pretensiones de las obras creadas por las industrias culturales que basan su modelo de negocio en la explotación de derechos de autor en un contexto digital. Pero Hace mas de 100 años, en 1917, Marcel Duchamp Cambió la historia del arte para siempre con su obra "Fountain". Ni el concepto de "obra protegible" como ámbito de protección material del derecho de autor ni el sistema de límites o excepciones a la Ley de Propiedad Intelectual han avanzado de forma paralela a las corrientes artísticas. Quizás estos son algunos de los motivos que han llevado artistas visuales a dejar de percibir la Ley de Propiedad intelectual como "su" Ley y a reclamar una mayor flexibilidad en los límites. ; "Artists are essential in democratic societies. Art benefits society, it helps us to understand and to reflect on reality. Society must promote the necessary laws so that artists can make a living creating their works and to ensure that we can continue to benefit and enrich society with their creations, even when these works can be reproduced beyond the control of their author. This was the objective of Intellectual Property Law: To foster innovation and progress, and to safeguard economic and moral rights of authors and titleholders of works protected under Intellectual Property Law. Art History recognizes conceptual art as a fundamental artistic movement that is essential to understand the evolution and discourse of art today. But nevertheless, the nature of conceptual and dematerialized art seems to have collided with the legal definitions and doctrines of copyright. The consideration of "protected work" by Intellectual Property Law does not always fit with the concept of "artistic work". On the other side ther is appropriation in art: Appropriation in art is the use of one or more pre-existing works, without permission of its right holder, either transforming its original appearance or reproducing it totally or partially without any modification, to be incorporated in a context other than its original context, with the aim of examining questions regarding originality or to reveal meanings that were not previously visible in the original. This practice is quite widespread among contemporary artists, and artists who work with appropriation very often deal with criticism or political comment on their works. The system of limits that allows the use of protected content in new creations is not intended for appropriation artists and the right of freedom of expression of these artists who express themselves incorporating works of others in their own works does not prevail in all cases. Intellectual Property Law has quickly adapted to the needs and claims of works created by cultural industries that base their business model on the exploitation of copyright in a digital context. But more than 100 years ago, in 1917, Marcel Duchamp changed the history of art forever with his work "Fountain". Neither the concept of "protectable work" of copyright nor the system of limits or exceptions of Intellectual Property Law have advanced in parallel with artistic trends. Perhaps these are some of the underlining reasons that have led visual artists to stop perceiving Intellectual Property Law as "their" Law and that have brought them to demand greater flexibility in fair use.
