Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.
The Mercury December, 1909 HELP THOSE WHO HELP US. The Intercollegiate Bureau of Academic Costume. Cotrell & Leonard ALBANY, N. Y. Makers of CAPS AND GOWNS To Gettysburg College. Lafayette, Lehigh. Dickinson. State College, Univ. of Penn sylvania, Harvard, Yale, Princeton. Wellesley, Bryn Mawrand the others. Class Contracts a Specialty. Correct Hoods of Degrees To The Class of '10. We have begun our college campaign for next Spring and Bummer. Over 25,000 employers look to Hapgoods for their men in sales, offices and technical positions in all departments. Most of these firms use college men. They arrange with us to cover the entire college world for them. We have a unique proposition o* immediate interest to any college man who will be open for a propo-sition. Let us tell you about it. Write to-day. !\\ITMOJVJMJ OttGJJVIZjlTlOJV UJf BltjiMJV ItUliKIillS. Commonwealth Trust Building, Philadelphia, Pa. THE) RIGHT TAILOR IN THE) WRONG LEGATION J. W. B^etim 2ND STORY iST NATIONAL BANK BUILDING After April ist will occupy room now occupied by Gettysburg National Bank WE RECOMMEND THESE FIRMS. Established 1867 by Allen Walton. ALLEN K. WALTON, Pres. and Treas. ROBT. J. WALTON, Supt. HUMMELSTOWN BROWN STONE COMPANY QUARRYMEN and Manufacturers of BUILDING STONE, SAWED FLAGGING and TILE. Waltonville, Duphin Co., Pa. CONTRACTORS FOR ALL KINDS OF CUT STONE WORK Telegraph and Express Address, Brownstone, Pa. Parties visiting quarries will leave cars at Brownstone Station on the P. & R. R. R. HOTEL GETTYSBURG, Headquarters for BANQUETS. Electric Lights, Steam Heat, All Conveniences. Free Bus to and from station. Convenient for Commencement Visitors. RATES $2.00 PER DAY. £iver-y Qitacruecl. D. R Gqtftfo.ll, Proprietor. EXPENSES IN COLLEGE $250 cash or a 3'ear in College cau be earned by one young man or young lady in each county in the United States. Plan easy and does not interfere with other occupation. No money required. For particulars address M. H. PEMBERTON, Columbia, Missouri. IWYSSfi iMMENl[STORE Successors to the E. M. Alleman Hardware Co., Manufacturer's Agent and Jobber of HARDWARE, OILS, PAINTS AND QUEENSWARE, GETTYSBURG, PA. The only Jobbing House in Adams County. ^^M PATRONIZE OUR ADVERTISERS. «««»*«#««*«»«»«»»«»««a«4He^»#«»««««#«««««#ftftft«« i • «* • « « «««« «* » »« » »» «« » « « ««« » « »»♦ * » « *«« ***« « **« ««« ** «« * **«««« Seligrqciri ARE GETTYSBURG'S MOST RELIABLE THJLO^S *£ And show their appreciation of your patronage by giving you full value for your money, and closest attention to the wants of every customer. <& Give Them Your Patronage ««« «« »• »«« « «« «««« * »«««« « «»» »*» »« ««»»««« »« ««*« »« « »««»*»««» » *«»«»«« *ft»«ft«»«tt*««#««aftfttf»ftft«»«»tt«ft«#«ft««*«««ftft«###« TATRONIZE OUR ADVERTISERS. * innrFHS special I ^pasSS! ' i Is open for the fir I fe^ -- ^CsJJI munity who will * MUIS^SS^&I Piano or Organ. A Special Proposition rst person in an; com-deal with us for a WEAVER ORGANS AND PIANOS have no question mark to the quality. I I11I 1 I II 1 I MAIL THIS COUPON TO US. Send me special proposition for the purchase of a Piano. Name . Address WEAVER ORGAN AND PIANO CO., MANUFACTURERS, YORK, PA , U S A. ■j- "it ■I- "it *± nt 'M "it "it 't£it. w 'i- M/ tjt Wt * '•V 3t For Artistic Photographs Prices Always Right -GO TO— TjPTOjsr T|e Lutheran The Leader in PHOTO FASHIONS Frames and Passapartouts Made to Order. Come and Have a Good Shave or Hair Cut HARRY JL SEFTON'S BARBER SHOP 35 Baltimore St. Barbers Supplies a Specialty. \lso choice line of Cigars. Pulliciitioii Society No. 1424 Arch Street, PHILADELPHIA, PA. Acknowledged Headquarters for anything' and everything' in the way of Books for Churches. Colleges, Families and Schools, and literature for Sunday Schools. PLEASE REMEMBER That by sending your orders to us you help build up ami develop one of the church in-stitutions with pecuniary ad-vantage to yourself. THE IUI ERCURV The Literar7 Journal of Gettysburg College. VOL. XVII GETTYSBURG, PA., DECEMBER, 1909 No. 7 CONTENTS. THE IMPORTANCE OP HEREDITY IN DECIDING A MAN'S OCCUPATION 2 WM. A. LOGAN, '10. THE FIRST CHRISTMAS.—Poem ' 5 NEWTON D. SWANK, '11. THE MUNICIPAL BATHING BEACH AT WASHING-TON G D. E. A. K. HER REASON 8 JI. IT. KRUMRINE, '11. ART. II.—TENNYSON'S CENTENARY, AUGUST 1809- 1909 12 REV. CHARLES WILLIAM HEATHCOTE, A.M., B.D. THE HONOR SYSTEM SHOULD PREVAIL AT PENN-SYLVANIA COLLEGE 15 MARY M. BAUSCH, '11. THE AMERICAN BUSINESS MAN 17 HARVEY W. STRAYER, '10. NEITHER PESSIMISM NOR OPTIMISM 20 FLORENCE G. HEATHCOTE, '10. DOES SMOKING AND DRINKING INTERFERE WITH INTELLECTUAL PROGRESS ? 22 H. F. BAUGHMAN, '10. SPAIN'S CRIME 24 EARL S. RUDISILL, '12. THE POSSIBILITIES FOR IMPROVEMENTS IN GET-TYSBURG 26 HARVEY S. HOSIIOUR, '10. EDITORIALS 28 EXCHANGES 31 z. THE MERCURY. THE IMPORTANCE OF HEREDITY IN DECIDING A MAN'S OCCUPATION. WM. A. LOGAN, '10. jO consider the question of the importance of heredity in determining a man's occupation we must see what effect heredity has in general upon the life of a man, and since occupation is an outgrowth of imitation, we must determine the effect of heredity, in particular, upon imitation. But let us first see what heredity means in this connection. There are those who would tamper with the term "heredity" in its purity, corrupting it by making it cover its own natural ground and that-rightly belonging to "early environment." We prefer, and justifiably so, to look upon it in its own sphere and to exclude any contribution from this other factor. Hence, we define heredity as the name given to the transmission of gains or losses in organic development from parent to child. And upon this definition rests the solution of our question. Heredity, certainly, has importance, however limited, in de-termining a man's line of work—in fact it has importance as a determining factor in man's whole life. Taking our definition, we admit a transmission takes place in the generation of chil-dren, but note that it is a transmission of gains or losses in organic development, and hence, becomes a question of large or small capacity; for it is easy to understand that the parent who lias gained in organic development will transmit to the child an organism of superior development and therefore of greater ca-pacity. The reverse is also true of the parent who has lost in organic development. And now, although we admit this, at the same time we know from observation, that unless favorable con-ditions are brought to bear upon the life of that child of superior development, that superiority will be overcome, largely, by the lack of said conditions, and, by the time the person is ready for occupation the factor of superior development will be so subju-gated to the unfavorable conditions that it will be recognized as playing a very small part in determining the occupation which the person will take up. On the other hand, let the child of in-ferior organic development be surrounded by favorable condi- THE MERCURY. tions—what do we notice ? Simply this, that although it cannot exceed a certain limit of development, it can and will, by virtue of these favorable conditions, overcome its inferiority, and, again, we find it true that heredity plays a part, but a very small part, in determining the occupation the child will follow. This ex-plains the phenomenon of great, powerful men born of lowly and sometimes ignorant parents, yet by virtue of later environment they become the powers that they are. Now, that we may get the really vital factor which solves our question, we must consider the element, "conscious imitation." It is this, after all, which determines the occupation however true it is that it too, has its detriments. To be concise we shall quote Baldwin, who sets forth plainly the rise of conscious imi-tation, and heredity's part in this rise. He cites the fact of the late rise of conscious imitation: sixth or seventh month. This fact may be accounted for on the very evident ground of the distinction of congenital functions from the new accommo-dations of the individual child. The child's early months are taken up with its vegetative functions. The machinery of he-redity is working itself out in the new individual." And fur-ther: "In the main, therefore, there is instinctive tendency to functions of the imitative type, and to some direct organic imi-tations; but those clear conscious imitations which represent new accommodations and acquirement are not as such instinc-tive, but come later as individual acquirements." Here we see heredity limited to the determining of action in the early months of the individual's life, and giving way to that more potent fac-tor, conscious imitation which in turn is determined by environ-ment. But we have not said that heredity has no power in de-termining a man's occupation and it is for us to show now, how it limits environment. Tins has been indicated above, but not explained. Let us take the ease of transmission of losses. The parent is frail and weak and the child inherits a similar frame and weak-ness; then no amount of habit, custom or education will make that child capable to assume an occupation which requires a large, strong body. And so with the inheritance of weak organs of whatever name—a weak heart, brain, a diseased stomach, etc. —inheritance of any of these means that habit, custom or educa- THE MERCURY. tion, in a word, environment, can only succeed in making the individual fit for an occupation which will not involve any strains whatever upon the weak or diseased organs. On the side of the trasmission of gains environment docs not have this limiting influence, but, as was stated explicitly above, a favorable environment tends to produce further gains, while an unfavorable environment limits even the organism of su-perior development. To take a specific case, we know a man, born of strong, healthy, intellectual parents, whose life was somewhat in this order—school (where he ranked high) work, (first in a store then in a factory with his father, then at a trade); night school, college, seminary, and ministry. The observed facts show that the man was born with an organism of superior development which was favorably environed during his early years,—then a less favorable influence came to bear, and, (that he might have more money), he went to work. Here we see environment showing itself in two directions—from store down to factory, and from factory up to trade. But finally, en-vironment lets his organism work along favorable lines, giving him a continuous uplift through the stages from night school to college, to seminary, and to his occupation. To sum up briefly, then, we admit that a transmission of ca-pacity takes place in generation of children, but we contend that this capacity may be limited or increased according to the un-favorable or favorable environment of the individual. We say that heredity is replaced by conscious imitation, to a large de-gree and imitation is the performing of those things which we see being performed about us. And when it comes to the de-termination of an occupation wc, in choosing, imitate those whom we have found it pleasant to imitate in other matters, or we choose an occupation for which our habits, customs or educa-tion has made us adept. And all this leads to the truth: "Man is a creature of environment," however true it may be that lie himself determines largely, his environment. THE MERCURY. THE FIRST CHRISTMAS. NEWTON D. SWANK, '11. In snowy-white December's dreary days, There comes to mind that bright'ning tale of glory; Of how the angels chanted hymns of praise, And to the shepherds told the wondrous story. Good shepherds, keeping watch o'er flocks by night In that same country where the Christ was born, Were dazed as they beheld a glorious sight Ere they had caught a glimpse of waking morn. They, sore afraid, drew back with cries of fear From that great shining light sent by the Lord. Then God's own angel did to them appear; Above, in radiant brilliancy, he soared. The angel to the shepherds softly said: "Fear not, I bring you tidings of great joy, Which to all people shall be widely spread; For unto you the Christ, your king, is born! This new-born babe is Christ, the Lord of men; In manger lying wrapped in swaddling clothes, Him .you will find in David's Bethlehem"— Then suddenly a host of angels rose. They chanted soft in heavenly array, And then sang: "Glory be to God on high, And on earth peace, good-will toward men alway." The joyous shepherds were no longer shy. As these celestial angels went from them The shepherds spoke to one another thus: "Let us now even go to Bethlehem To see this Son that God hath sent to us." THE MEECUEY. They came with haste, and found sweet Mary mild, Good Joseph with the oxen standing by; Within the manger lay the Holy Child,— God's gift to man His Love doth verify. When they the babe had seen they spread abroad The saying, which was told to them about This child, the precious gift for man from God; And all who heard sent up a prayer devout. The shepherds, glorifying God, returned; With great rejoicing they left Bethlehem, Where they such wondrous things had seen and learned; But Mary kept these things and pondered them. THE MUNICIPAL BATHING BEACH AT WASHINGTON. D. E. A. K. |ASHIN"GT01ST, the city beautiful, home of great men and fair women, has like many other large cities come to realize that not only in the palaces of kings, but also in the homes of the poor, are brain and brawn, beauty and grace to be found, for although frequently styled, "the city of diplomats and politicians," she has within her confines many from the poorer classes to whom are denied many of the neces-sities, not to speak of the luxuries of life. The children of these poor, compelled to bear the sweltering heat of summer, suffered without any means of relief. Seaboard cities are fanned by cooling breezes and afford to the younger element all the bathing facilities the ocean allows. Country towns have woods and the inevitable swimming hole. Washington, although situated on the Potomac, is blessed with none of these natural bounties, for due to the depth of the water and the currents, the river has been shunned rather than sought. What was to be done in the face of such conditions? Action THE MERCURY. 7 followed swift on the heels of the realization of the necessity. The citizens of the district petitioned the commissioners and they readily granted to the committee appointed, the old Fish Commission pools and grounds and a money appropriation to make the necessary repairs and alterations. Thus one of the city's most beneficent charities had its beginning. It was but a beginning, and that only, for since this the labor expended has been almost herculean. Unused pools have been filled in, low ground has been graded, drainage has been put in, locker houses and office buildings have been provided and con-crete swimming pools built. Has it been worth while? For an answer I would ask you to go to the Bathing Beach grounds some afternoon about one o'clock. When one is a full half mile from the pools already the small boy with his bathing suit is in evidence. Although Wash-ington is a city of "magnificent distances," yet from the out-skirts they come, rich and poor, big and little, young and old, and all in a hurry. When they arrive at the grouds all willingly get in line to receive their free admission slips, for a record of the name, age and residence of all patrons is kept. At the small boys' hours the big fellow declares, "he's only a kid;" at the older boys' hours, the little one is a man grown, supports a family, "and has chewed tobacco for a year;" few such excuses however, are offered during the ladies' hours. If the troubled waters in the pools at Washington could work miraculous cures ,many would be the number healed, for from early morning to evening few are the minutes in which the pools are not "disturbed"—and not always by angels either. Splash! Splash! Splash ! All day long. One can see hundreds in the pools or waiting on the wharves. Here a senate page is having a game of tag with a "newsy" who for an hour has dropped his cry of "Sta'-Times- -Evenin' Pape," and is enjoying a dip; there "Tubby" Regan, winner of many races, paddles in his inevitable tub, joyfully ignorant of the fact that Johnny Shugrne is just ready to spill him from his slippery throne. There are shallow pools for waders, deep ones for swimmers,. "muddy" ones for the dusky patrons; all are accomodated, all are-happy, all are safe. Swimming instructors and life guards with 8 THE MERCURY. ceaseless vigil keep careful watch over the bathers, so accidents are few, fatalities none. And who is largely responsible for the instruction and con-tinuance of this factor which has proved to be an unspeakable blessing to many? Dr. Wm. B. Hudson, the present superin-tendent, "the swimmer's friend, looked Up to by the boys, re-spected by the men, asked for by the ladies; a "West Point man^ a University of Pennsylvania graduate who has entrusted to other hands his large profitable practice that he might for a mere pittance give his time and energy for the good of "the other man." All honor to such truly great men, who in a spirit of widest altruism forget self in their consideration for their fel-lows. ± ± HER REASON. M. H. KRUJIBIXE, '11. SJSPT this a grand night? Beyond description!" "It certainly is." "It is an ideal night to take a walk. Nothing would be quite as enjoyable to me as a walk. Will we take one?" Oh !— The t-t-ti—w-well! Let's take a walk." Such were the words exchanged between Jack Roberts, the big Sophomore class president and Miss Drew, the Freshman co-ed, respectively, as the former was leaving Miss Drew after having spent a most enjoyable evening in the company of the Fresh-man co-ed. It was at 11 o'clock and the walk came as a sur-prise to both. It was quite a novelty to these two representa-tives of hostile classes. True, Miss Drew had reflected on the time but the night was too grand to resist. Then, too, we must not forget that one was a class president and the other a class secretary and loyal Freshman co-ed. "Hustle on your wraps, Miss Drew, and we'll be out enjoying the glorious night," said Jack, his head in a whirl. The very fact that he had spent the evening with Miss Drew was enough THE MERCURY. to fluster him for a week and the walk in addition was enough to cause a brain-storm. He had eyed the Freshman co-ed with hungry eyes many a time as she appeared in chapel, on the campus, in dining hall or wherever she chanced to come within sight. Many a time had the rustle of her dress, the wave of her golden tresses or the sparkle of her beautiful, blue eyes caused his heart to take a sud-den leap and flutter beyond control. What this present occasion did we can only conjecture. Then, too, Mis Drew, the popidar and generally admired Freshman co-ed had not been entirely averse to the attentions paid her by the big Sophomore president. In fact, she had played several games of tennis with him, but never had Jack teen honored with her company as he was to-night. But the walk is not yet taken. "Oh! I am ready," was the quick reply, as Margaret, the co-ed, hastily donned her wraps. Soon they were off for a stroll in the country, under the open canopy of heaven, bestudded with countless stars. The silvery moon, too, was shedding its gor-geous light on the earth beneath. Thus they went forth to drink in the fresh air and beauties of the night. ISTor was their en-joyment of the walk unexpressed. "Isn't this evening perfectly charming. It is an ideal ni , I mean, it is an ideal evening. An evening such as poets love to describe. How grand it is and my enjoyment of it cannot be expressed." Such were the words of Margaret as they went along. "You have expressed my feelings exactly, Miss Drew," was the scant reply of Jack. He had other feelings to contend with. Feelings such as scarcely permitted him to open his mouth lest they give utterance,—to his sorrow—perhaps. He was perplexed and rather meditative. But he was well aware of all that hap-pened and was a very earnest audience to Margaret, reflecting carefully on all she said, which was much. Margaret apparently was enjoying the walk so much that she did not think of any-thing else. She was very talkative, as if for some specific pur-pose. As the walk was continued the perplexity of Jack did not cease, but rather increased. He was perturbed and it was only 10 THE MERCURY. a matter of time when it would become evident to his companion. '"Shall I say it ?—Will I tell her ?" mused the big class president. "How will she take it? No. I dare not, I must not, for when I mentioned Borneo and Juliet in connection with this night, she made a queer move and uttered an unexplainable sound. She objected to any such thought. Did she object? Perhaps she winced for another reason," mused Jack further. At this time the representatives of the two hostile classes were quite some distance from the college. It would take them about half an hour to get back and then they would have to walk briskly. Yet they kept on apparently unaware of the time and distance. All of a sudden an outrageous yell and din reached their ears. It was a din and it kept up for some time. Pres-ently Jack broke the silence caused by the din with the words, "What noise?" Margaret, innocent as a Freshman only can be, of course did not know. But all of a sudden, as if becoming suddenly aware of the time and distance from the college, she exclaimed rather excitedly, "Let's turn back. I fear the hour is growing late and we are some distance from the college—a good half hour's walk!" "Say a good hour's walk," said Jack as he turned to go back before he was aware of it. They journeyed back but the hideous noise and din marred their walk. How they did not know, but even Margaret was silent and Jack could not muse as before, with such an uproar going on. Furthermore he was afraid that he should be back at college, on the campus where the noise was made according to all indications. He was a class president and a Sophomore, too. What might not his class be doing. They were trained to "work" under him and without him they were as sheep without a shepherd. Perhaps the Freshmen are busy. He became alarmed the closer they came. His nerves were all a-tinkle. Just then they had come close enough to distinguish some words. "Sophomores! ""Sophomores!" "Freshmen!" "Freshmen!" "Freshmen!" burst upon their ears. "The Flagscrap!" burst forth Jack, as he made a sudden leap as if to run. THE MERCURY. 11 "Pardon me, Miss Drew, I—I forgot." "Merely class spirit," was the reply. The fact was only too well known to both now. The long looked for flag scrap had at last "come off." Then Jack did think. Here he was while the flag scrap was. going on, on the college campus. To him the walk ended in a tragedy, at least so he thought then. As they hastened back they wished their respective classes suc-cess as was only natural. Since the journey before them lasted about half an hour more, the former feelings of Jack came back. He had not said anything yet, but had come to the conclusion ihat Margaret was rather favorably inclined towards him. He gave that as her reason for taking a walk with him at such an hour. He could see no other reason. She surely must have had one and this to him seemed most plausible. Finally they reached their destination and in delicious pain Jack left the Freshman co-ed. He had not forgotten the class fight and so at the top of his speed he arrived on the college cam-pus. Yelling was at par now but it was all for the Freshmen for they had withstood the Sophomores for thirty-five minutes and their flag was still intact. Thus they had won the scrap since thirty minutes was the required time. The reason the Sophomores could not harm the Freshman flag-was because they lacked a leader—their president. No one knew where he was. That night Jack went to his room rather crestfallen. But then again he was happy for he had not forgotten the walk with one whom he idolized—yes that's what he really did. He still had hope, more strongly than ever, now, that he had left her and had time to reflect, that she had a good reason for taking the walk with him. "Yes, love was her reason" thought Jack. Next day one could see the Freshmen strutting about in high glee over the victory of the night before. After chapel, they all, at different times, and in small groups, congratulated Miss Drew, their secretary, on the noble part she had played in the flag scrap. Yes, the Freshman co-ed had a reason for taking a walk, at midnight, with the big, husky Sophomore president. 12 THE MERCURY. ART II.—TENNYSON CENTENARY AUGUST 1809-1909— Tennyson and In Memoriam. BY REV. CHARLES WILLIAM HEATHCOTE, A.M., Ji.U. IEOM the selections of Tennyson's poems you will notice his work is beautiful for its melody, and harmony. You notice that he possesses a true love for nature and has a noble Christian character. This is manifested in his friendship for Iiallam. There has been very few classic friendships in the history of the world that have come down to us. We know the story of the true friendship, Damon, a Pythago-rean, bore for Pythias. Pythias had been condemned to death by Dionysius I, of Syracuse. Pythias asked to be set at liberty for a short time to settle up his affairs. Damon pledged his own life for that of his friend, who he knew would return. Pythias did return before the day appointed for his execution. Diony-sius was so deeply impressed that he released Damon from his pledge and gave Pythias his freedom. Again we know the true friendship David bore toward Jona-than. In the account given in I Samuel, 23:17-18, we see this friendship manifested. "And he said unto him: Fear not for the hand of Saul my father shall not find thee; and thou shalt be king over Israel, and I shall be next unto thee; and that also Saul my father knoweth. And they two made a covenant before the Lord: and David abode in the woods, and Jonathan went to his house." Thus Tennyson had a true deep friendship founded on love for Arthur Henry Hallam. He reveals his friendship and love in "In Memoriam." Arthur Henry Hallam, the son of the historian Henry Hal-lam, was born Feb. 1, 1811, in London. At an early age he traveled with his parents in Italy and Switzerland. As a youth he was very precocious. After attending a private school, he was sent to Eton. Here he remained until 1827. In October, 1828, he matriculated at Trinity College, Cam-bridge. Here he became acquainted with Tennyson. There THE MERCURY. 13 was formed a friendship which was to iast forever and which was destined to be immortalized in literature. Thus should all friendships be made, not to be broken at will, but to last forever. Friendships should not be made with the purpose of using those friends for selfish motives, but that true communion of soul and spirit might exist here on earth and in the realms of eternal life. Thus the best friendships are made in mature years when one. understands the congenialities of human nature. Furthermore, the true friendships formed in college days last on through life. You know Cicero speaks of friendship thus: "Virtus, virtus inquam C. Fanni et tu Q Muci et conciliat amicitias et eonser-rat. C. De Amit XXVIII, 53 page. Emerson also says: "My careful heart was free again, 0 friend, my bosom said. Through thee alone the sky is arched, Through thee the rose is red; All things through thee take nobler form, And look beyond the earth, The mill—round of our fate appears A sim path in thy worth." Young Hallam did not distinguish himself in Greek, Latin or Mathematics while at college. His work in literature and essay writing was brilliant. He was an orator of strong ability, for he obtained a prize on declamation in 1831. He was well versed in history. He graduated from Trinity in 1832 and in October 1832, he took up the study of law. In August of 1833, Arthur accompanied his father on a trip to the continent from which he was not to return alive. He died at Vienna, Sept. 15, 1833, from an attack of intermittent fever. His remains were brought to England and interred on the 3rd of January, 1834, in Clevedin Church, Somersetshire. Hallam as a young man in his earlier college days wrote many poems which were graceful, and pleasing. We quote this one: 14 THE MERCURY. '"Alfred, I would that you beheld me now, Sitting beneath a mossy wild wall. On a quaint bench which to that structure old Winds an accordant curve." He also wrote several essays of a philosophic character, which show careful thought and preparation. Thus Tennyson as a tribute of honor to his beloved friend wrote "In Memoriam" which was first published in 1850. It is probable when Tennyson first wrote this poem that it was not his intention to publish it. There is no regular order in the poem. Tennyson wrote as his soul passed through its various states, conditions, and feelings. At one time Tennyson lost his note book. We can imagine the deep distress of the poet until it was recovered. Hallam had made a deep impression on Tennyson's life and character. He was a congenial, winsome fellow. Hallam's death was a double shock to Tennyson. In the first place his friendship was clear and indissoluble. In the second place Hal-lam was betrothed to the poet's sister Emily at the time of his death. Thus Tennyson depicts his sorrow, varied feelings, love, etc., in the poem. Prof. Genung says the theme of the poem is: "That love is intrinsically immortal." He also divides the poem thus: Prologue. Introductory Stage I—XXVII. First Cycle—XXVIII—LXXVI1. Second Cycle—LXXVIII—CIII. Third Cycle—CIV—CXXXI. Epilogue. Clianibersburg, Pa. THE 3IEKCU1SY. IB THE HONOR SYSTEM SHOULD PREVAIL AT PENNSYL-VANIA COLLEGE. MARY M. BAUSCH, '11. iX.tlic discussion of this subject, first it must be shown what is meant by the honor system. By this we mean that men and women are put on their honor, that they are pledged to perform all duties with truth, with hon-esty, and with, fairness. They are pledged not to cheat. When a man is put on his honor he is given an opportunity to prove himself a responsible being. The honor system should prevail at Pennsylvania College for two reasons. First, because the morality of the student body would be improved. Second, because the reputation of the institution would be raised in the eyes of the public. The question may be ashed, Is there any honor in our student body? The only way to prove that this exists is to have the honor system introduced into the college government. When once a student is placed on his honor he comes to realization of his position. He is no longer a mere high school boy. He is a man and must be responsible. If he is not responsible he must be taught to be. And the only way to teach responsibility is by placing the student in a responsible position. This in itself is Fufficient reason why the honor system should prevail. Our honor is our most highly prized possession. Can we en-trust our honor to another? Can we place it in the care of pro-fessors, while under his instructions and receive it at will when we pass through the portals of the institution? The four years passed here are to the average student the most formative period of his life. This is the time for you to learn to depend on your-self, to be a leader even if you have not acquired ability suffici-ent to do so. The honor system will help to accomplish these things. It will arouse in the student the desire to do right. The objection is raised that the honor system does not make all honest. This is true. No system can make a man do his work honestly if he is determined to cheat. But a public feeling is aroused against cheating, this public feeling has greater influ-ence than anything else in governing man's actions. 1G THE HEKCUKY. For the honor system to succeed at Pennsylvania College it is necessary for the student to be willing to undergo the conditions which the honor system demands. He must be ready to inform against anyone who cheats. The student must be wholly impar-tial. He cannot allow private friendships and claims to inter-fere with the discharge of his duty. This is one of the greatest principles in the training of the future citizens for our country. A keen sense of honor is especially in demand in piiblic and pri-vate life. It is even more important than education. The educated man who lacks high moral character is more at a disad-vantage than the honest man who is uneducated. The honor system is a stimulus to better work in general. It does not cover examinations only, but it also covers assigned tasks and private work. Besides the greatest cheating does not occur in examinations. It occurs more in written work done out of the class-room where the authority of the instructor does not extend. For example the writing of themes and in mathemati-cal problems. It has been said, "To cheat is one thing, to cheat a teacher is another." This especially applies to private work over which the instructor has no immediate authority. The only way to root out this fault is through the honor system. For only through the students themselves can any reform in this di-rection take place. I have said that the honor system would raise the reputation of the college in the eyes of the public. The most important part of the college is its student body. The student in a large sense makes the college. If he is dishonest, he causes a shadow of dishonesty to be cast over the institution from which he is graduated. The value of his diploma is lowered when the pub-lic once learns that by cheating he is able to pass his examina-tions. The standard of the college is made manifest by the standard of integrity and ability of its students and alumni. If the honor system prevailed at Pennsylvania College, the faculty, or rather the individual professors would be relieved of a very unpleasant duty. The duty of a spy. The imputation that the professor is a policeman would be removed. This is a very strong reason why the honor system should be adopted here. There are many students who have good impulses but lack moral strength. We all recognize the power, a strong personality . u THE MERCURY. 17 has over a group of minds. The boy upon entering college is most easily influenced by the older memebrs of the institution. Xow, if a high sense of honor were fostered in the college, the morals of the Freshman would be strengthened by the example of high honor existing among i\pperelassmen. The student who sees a high standard of honor in a fellow-student may in time be brought to adopt it for himself. Again, there are students who object to giving help, both in examinations and in private work from a sense of honesty to their professors and from principle. Consequently they are open to much criticism. If the honor system were established, they would be supported by the student body as a whole and freed from the charge of selfishness and stinginess. Finally the honor system would be the means for rooting out the idler, the man who will not work, the man who depends on getting through on somebody else's goods. Many of our institutions have established the honor system in all departments and a number of them in several departments. Among those institutions where the honor system has proven suc-cessful are Princeton, Cornell, Lehigh, Virginia, Washington and Jefferson, Washington and Lee, North Carolina, Williams, and Amherst. The methods of teaching at our college are simi-lar to those of the above named institutions, and since in general the character of students is much the same, there is no reason why the honor system should not be as successful here as in those institutions. The only to test its efficiency is to try it. THE AMERICAN BUSINESS MAN. HARVEY W. STRAYER, '10. HE American business man is one who makes an honest effort to earn a livelihood. He is the marvel of the world. He is the culmination of American industrial development. He is the one great, single, vital force responsible for America's supremacy in commerce and industry. To him we must bow our thanks for an hundred comforts which were but yesterday luxuries. 18 THE MERCURY. Through the energy, perseverance, imagination and ingenuity of the business man, feats can be performed undreamed of by the most optimistic ancestor. He has bound our country together by bands of steel; he has harnessed Niagara and a thousand other water-falls and lighted our cities with that indefinable something —electricity. He has laid the Atlantic cable and made Great Britain our own neighbor. He has united New York with San Francisco and made the State of the Golden Gate our door-mat to the Orient. He has braved the dangers of the subterranean depths and digs up for our use the precious stones and metals, and pipes to the surface the no less precious fluids. These things the American business man has done and more. He is no longer subject to nature's laws but defying even the power of gravity, sails through the air whither-so-ever he will. The American business man is above all a man of ingenuity. He harnesses nature and guides her in her own work of produc-tion. In our western country, the arid plains of yesterday are the gardens of to-day. By great engineering feats, water streams are coaxed from original courses and by proper care are made to make the parched and burned desert to bloom and blossom as the rose. In a word our business men have made living a pleasure when a century ago it was a positive pain. But our description of the business man lacks perfection until we see him in his home. See him there and you have the secret of his success. For it is there he receives encouragement and inspiration from that fount of American helpfulness—the American woman. To speak, further of the business man in his relation to the home is needless for an American reader. You may think my eulogy overdone, for I am painting the business man at his best in the home and in the industries. But even this superb creature has defects, the greatest of which it the utilization of ever moment of time for family and self at the expense of the State. For our business men too often neglect to give even a moment to the nation—to the State—to the city. They are pigmies in politics and state-craft and invite upon themselves the opprobium of the more patriotic citizens. Under these conditions of indifference the unscrupulous poli-tician springs up even as the mushroom in the night, but alas! his tenacity for life is a thousand times that of the tender and THE MERCURY. 19 short-lived mushroom. dies and never resigns. "The unscrupulous politician seldom This was the truism expressed by Jef-ferson and this fact makes it a double task to root out the American grafter, once he has attained his power. But let us thank Providence, the seat of the grafter is not al-ways unshaken. There are always some honest business men aware of the public dishonesties; always somebody ready to lead the people in their crusades against public evils; always some men ready with public confidence behind them to clean the legis-lative halls of their reeking political filth. Such men as Berry of Pennsylvania, Folk of Missouri, and Heney of California, are simply repaid for their herculean tasks by the public confidence—a thing not measured in dollars and cents. Yes, we want our business men to be honest and our honest business men to be politicians. Not until our business men be-come politicians and place politics on the high plane where it deserves to be, can we hope for continued good government. If our public officials are not honest and our business men not politicians enough to understand the public questions of the day, we tremble for the perpetuity of our country. But there is a better spirit abroad in the land. Politics is being cleansed and officials are learning the lesson that public office is a public trust. Slowly but surely we are evolving the American business man who finds time for his community and his country. This busi-ness man then, supreme in the commercial world; loving in the-home; and watchful in the State will be the hope of the future. Trusting in him in the days to come, we expect our offices to be filled with men of unimpeached integrity and the destiny of our country to be made secure. 20 THE SIEECURY. NEITHER PESSIMISM NOR OPTIMISM. FLORENCE G. HEATHCOTE '10. |MOJS"G the philosophers who have flourished during past ages the most varied theories of the universe have pre-vailed. Some have radically propounded the theory of optimism while others advocated that of pessimism. Schopenhauer's is a philosophy of despair. His belief was that the world, in which we live, with its social conditions, is the worst that ever could exist. Thus unhappiness was the inevi-table and moral rule of the human life. Leibniz's idea of this life was diametrically opposed to that of Schopenhauer's; for him happiness greatly overbalanced the pain of this world and the present world-order is the best possible. But these same two ideas exist among every class of men. The Europeans, as a whole, are rather pessimistic. This is probably on account of their less progressive condition. The Americans, on the other hand, are considered to be very optimistic on ac-count of being in a condition of prosperity. Yet America has to-day many "Schopenhauer's" as well as "Leibnizs" and their theories are just as radical as those of either of these philoso-phers. For the truly pessimistic man of to-day unhappiness is the prime element of life and the quicker death comes, the better for him. His religious, social, and business activities appear to him as only things of misery and torture. It is very evident that there is very little progress in anything a man undertakes when he upholds such a theory. "Despair is death," is a true saying. The pessimist can do very little, if anything, for the uplift of the human race, and especially for the progress of his country, with such a sombre view of life. His gloomy theory paralyzes effort. His theory, however, is only a misrepresentation, which is due to the magnifying of the various misfortunes and sorrows of this life which he has experienced. He sees no honor or justice in anything and thus he deliberately rales God out of his thoughts entirely. In such a state of mind no one is able to appreciate nature or to help others to see the right. On the other hand a radical optimist is just as far from real- THE MEitcuny. 21 izing what this life really is as the pessimist with his dark view of the universe. The optimist has, indeed, heen one of the main factors in the steady development of our land, but he, too often, forgets what true happiness really means. Everything is life and sunshine to him; misfortunes are immediately overlooked without affecting his character in the least, and thus he is car-ried on by the whirl of success, forgetting all and only looking for his own selfish joy and pleasure. Yet he is helping to pro-mote a rapid growth, perhaps, in the industrial world, but with no other thought in view except his own selfish end. Thus he has no sympathy for those who are his inferiors financially or socially and in the end he must discover that his is not the truly great happiness after all. "A man's lot is not really happy when all his desires are always and fully realized, but when he obtains a proper share of joy and sorrow, success and failure, plenty and want, straggle and peace, work and rest, and obtains it at the right time." But the truth is that there must be a blending of the opti-mistic and the pessimistic ideas, if life would appear to us reah There should be sufficient recognition of evil, so as not to ignore its presence, and a due appreciation of the good, to serve as an inspiration to high endeavor. "Life is hope" and what benefit can there be derived if one is continually in despair. The dangers and misunderstandings are well balanced by the numer-ous gifts in nature and the joy of good health. Our nation can advance only if its citizens have a "common-sense" view of life. It is by pain and persecution that their characters can be strengthened to fight the battles of life. Some great scholar has said, "This earth is dear to mortal men, not merely in spite of its tears and crosses, but also on account of them." It has been just through those men, who have held the "com-mon- sense" view that our nation is what it is to-day. Their foremost thought has been that the first thing to be done is to care for one's fellow-men. Through this noble thought there have been innumerable improvements along all lines. To make life pleasant and enjoyable for man, the construction of rail-roads, telephone, and telegraph lines have been accomplished. Useful arts and sciences have been inculcated; free schools and 22 I'll E .MI'.IICIJIIY. colleges have been opened; public libraries and churches have been erected all over the country. Even criminals of to-day are put into healthy and clean prisons where they are compelled :to do some work or to learn a trade. One of the great fruits of man's helping his fellow-men is very evident in the provision of free sanitoriums for curing various diseases and the preven-tion of epidemics. In a land where there is so much liberty offered to all and whose laws are so just, every citizen should endeavor to do his best for its welfare and advancement. To sit idly by and look at its darkest side or its brightest side will never be fruitful of any good, but let us be encouraged by the good and do our best in abolishing evil so that "this government of the people, for the people, and by the people may never perish from the earth." DOES SMOKING AND DRINKING INTERFERE WITH IN-TELLECTUAL PROGRESS. II. F. BAUGIIMAN, '10. NE of the most familiar terms used in athletic circles is the term "training." By it is expressed careful selec-tion of diet, early bed hours, clean morals and above all a strict abstinence from alcoholic beverages and to-bacco. The trainers and players all recognize the evil effects of these dissipations upon the physical system, so when football and track seasons at college come around, the candidates for these teams sign a pledge to "keep training." Perhaps after these di-versions have passed out of season, the same men who have trained faithfully for weeks may "break training" and drink and carouse as though attempting to make up for time lost. At least most men at college indulge in the use of tobacco, and a few in the use of intoxicants. 3Tow it is suggested that if such indulgences are not good for the physical system, are they not also detrimental to intellectual progress? From the statements given above it wovild appear that the majority of students think they are not, but we must remember that men do not always do THE MEBCUEY. 23 what is of the most advantage to them. We will consider the effects of each separately upon the mind, taking smoking first as it is most prevalent. Medical science shows us that smoking, especially cigarette smoking, is most injurious to the brain tissues. The smoker in-hales the poisonous nicotine and it is taken to the lungs where the blood is carried for purification, instead of receiving cleans-ing, it is acted upon by this freighted with poisonous matter. This blood is carried to the brain, there to feed the tissues with poison. Of course not all the poison is carried by the blood, be-cause the blood corpuscles and other scavengers act upon it to purify it, but they are taxed excessively by this extra task and sooner or later these organs lose part of their power and permit more poison to be carried to the brain to build up unhealthy tis-sues, which of course cannot perform their functions to any great degree, thus hindering intellectual progress. Men of experience have recognized the injurious effects of the poison, and legislators in many States are working for legisla-tion which will keep this cause of mental and physical degenera-tion from the boys in school; they recognize the fact that sound, healthy minds cannot develop in bodies that are poisoned by the same substance which must be carried also to the brain. Ke-cently in the "Philadelphia Press" there was an account of the case of a school boy whose excessive practice of the cigarette habit cost him his liberty. The account states that his mind was dulled and the boy was becoming incorrigible. This shows the effect of smoking upon one child, and its effects must be simi-lar, though not always to so great a degree, upon every smoker. Certainly the habit hinders greatly intellectual progress. Drinking is much more injurious and its effects are more plainly seen than the effects of smoking. Alcohol has a deaden-ing effect upon a man's mental powers which is well manifested while he is under the influence of liquor. He regains his pow-ers to a certain degree soon after the stimulant loses its power, hut he cannot forever do this. Gradually the brain must weaken, because a man cannot abuse any organ repeatedly without its having an evil effect upon that organ. I have seen performed an experiment with alcohol on the brain of a pigeon. When the alcohol came in contact with the tissues 24 THE MEIiCtfUY. the whole mass stiffened and congealed and remained so for quite a while. This is what happens to a less degree in a man's brain when he becomes subject to drink. The blood always carries the poison to the brain and there is does its harmful work. The ha-bitual drinker so impairs his mental powers that at last he loses 1hem entirely and becomes insane; there are perhaps more cases of insanity due to drink than to all other caiises combined. Now the liquor must have the same effect on every brain in propor-tion to the amount used and the strength of that organ for re-sisting, so no one can indulge in alcoholic beverages without im-paring his mind, and he must of necessity hinder his own men-tal progress. Smoking and drinking interfere most effectively with intel-lectual progress, and the man who wishes to always have a clear brain and do rational thinking to a point of supermacy must ab-stain from these indulgences. SPAIN'S CRIME. EARL S. RUDISILIi, '12. IING ALFONSO of Spain, in ten minutes rendered fruitless his country's ten-year diplomatic struggle for a place among the world powers when he permitted the execution of Professor Francisco Ferrer. Investiga-tions have shown that Ferrer was entirely innocent of the charge laid at his door and even if this had not been proven, the con-demnation of such a scholar against the will of all Europe, could not but reflect on the intelligence of the Spanish Government and impair its influence with the other powers. Professor Ferrer was a man of courage and great principles, a firm believer in democracy and the founder of the "Modern Schools" in Spain. It was his manly courage that spoke forth when he uttered his last words, "Aim straight; long live the Modern Schools." His democratic spirit was the indirect cause of his execution, for it was on account of this spirit that he was suspected of partaking in the outbreaks in Cataloma and Barce- THE MERCURY. lona. As the founder of schools, lie rendered the same service to Spain which our Thaddeus Stevens rendered to Pennsylva-nia and in both instances was it done in spite of strong opposi-tion. During the last decade Spain has been regaining much of the importance and influence which she seemed to have lost. Since she has been without colonial possessions she has been conserv-ing her resources for domestic improvements and great things have been accomplished. Railroads have been built, agriculture has become more important, commerce has increased and Span-ish influence at court has been doubled. Her relations with ■neighboring nations have become closer. The marriage of the king to the English Victoria has drawn England and Spain closer than ever while France also has become more closely con-nected with her. All this has taken place since the war with the United States and that conflict was largely responsible for it. Even Alfonso himself, has declared that the war was a blessing in disguise. ISTow in the midst of prosperity and improvement Spain has blighted her progress by a self-inflicted wound, and greatly im-paired her increasing prestige among the powers. Instead of friendly greetings she has received from all the world condemna-tion, and King Alfonso, who signed the death Avarrant, by shift-ing the blame on to his prime minister, caused the resignation of the entire cabinet. The government was demoralized. However, the king has appointed a new cabinet with Senor Moret at its head and it will act with a conciliatory policy but it cannot bring back to life the martyr.ed Ferrer, nor can it re-store the moral order of things so soon as it was broken. It will be an uphill struggle and one not soon over, for such a gross de-fiance of moral law will not soon be forgotten. May the future of Spain profit by the past. 26 THE MERCURY. THE POSSIBILITIES FOR IMPROVEMENTS IN GETTYSBURG. HARVEY S. HOSHOUR, "10. E it located where it may, there is no town in America which has been so honored and so revered, as Gettys-burg. This little village among the hills is known the world over. To the foreigner it is the scene of one of the world's most decisive battles; to the American it marks the turning point of the struggle which meant national life to our country; to the Gettysburg man it means all this and more. Four years' sojourn at Gettysburg cannot but add with a peculiar emphasis to our appreciation of the last full measure of devo-tion of those who fought here. But for us there is more than even this. Surrounded by the battlefield at the outskirts of town there is a little college which to every Gettysburg student is one of the dearest places on earth. This is our Alma Mater. It is a small college but there are those who love it. There is a certain atmosphere pervading the place, which seems to have taken the best from the ordinary college town life and happily blended it with the historical halo which surrounds all fields of battle. So far as the town is concerned there seem to be but few chances for improvements. It is not that the place is perfect, but it seems to me that development has already been made along the proper lines and that any departure from them in prin-ciple, would be detrimental. For example, the plan has been to make Gettysburg a residential place and not an industrial com-munity. Development along these lines is the thing needed, not any change in them. It may seem old-fashioned to argue in this strain and the objection would be justified in many places, but for Gettysburg there is a difference. Gettysburg may live behind the times of the modern factory community, but we live, not merely subsist, as is done in many such localities. To me it seems that residential growth is to be encouraged, the old tradi-tions preserved, and factory development discouraged, if Get-tysburg is to be really improved as a town. THE JIEKCUKY. 27 As a college the conditions are somewhat different. There are many radical improvements needed which do not seem to me to be a detriment to the spirit in which the institution has been fostered. The new science hall, the Y. M. C. A. building, the new gymnasium, and the newly arranged curriculum are all needed improvements. A better arrangement of the dormitory life should be attempted. The experience of other colleges seem to justify the efficacy of allowing the various fraternities to pro-vide their own sleeping departments. If this is not done, a new dormitory should be erected in the near future. While improvements in the college curriculum are strongly urged, a departure from the old classical standards is far from being desired. Gettysburg is first of all a school of classical traditions, which are too dear to every alumnus and undergradu-ate, to be discarded. We urge the addition of new courses, but not the abandonment of the old ones. This may seem to be an argument in favor of the life which lives behind the times and to a certain extent it is. Our traditions are dear to us and they last with a tenacity which only such a place as Gettysburg could develop. Every college man lores his Alma Mater, if he is worthy of her name, but the Gettysburg man has something more than this. With four years of such life as we live here, one forms a fabric-work of dreams so to speak, which, if it break or be shattered, was only an influence for good, and which if it lasts through one's lifetime is bound to be an acting force in every man's life. T^ ERCURV Entered fit the I'ostoffice at Gettysburg as second-class Matter. VOL. XVII GETTYSBURG, PA., DECEMBER, 1909 No. 7 Editor in-Chief SAMUEL FAUSOLD, 'IO. Exchange Editor G. E. BOWERSOX, 'io Business Manager PAUL S. MILLER, 'IO Ass't Bus. Managers C. M. ALLABACH, 'II S. T. BAKER, 'II Assistant Editor RALPH E. RUDISILL, 'IO Associate Editors E. J. BOWMAN, 'II C. M. DAVIS, 'II Advisory Board PROF. G. F. SANDERS, A. M. PROF. P. M. BIKXE, FH. D. PROF. C. J. GRIMM, Pit. D. Published each month, from October to June-inclusive, by the joint literary Societies of Pennsylvania (Gettysburg) College. Subscription price, one dollar a year in advance ; single copies 15 cents. Notice to discontinue sending THE MERCURY to any address must be ac-companied by all arrearages. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE MERCURY, GETTYSBURG, PA. EDITORIALS. OF tilings worth while, we often consider whether it is worth the time and money for women to re-ceive a college education. When we glance at the Greeks, we find it was the disgrace and finally the ruin of their civilization that their wives were uneducated. There vir-tue and ignorance, vice and culture were hand in hand, but America has always been distinguished for judgment and justice accorded THE MERCURY. 29 to the gentler sex. Although there is great antagonism as to the co-ed idea, yet we, being thrust into the environment of them and seeing their scholarship and influence, are convinced of their ability to successfully compete with their brothers in every field of study and research. The alumni of our colleges are seeing to it that their hoys are being educated and are urging them to work for greater college facilities. It is such spirit that has created such female institutions as Barnard, Wellesley, Smith and Vassar. Glancingatthe co-ed educational training at Cornell as to their effect on young men, we find that they have cultivated the best traits and most chivalric characteristics of manhood. Their am-bition and success have stimulated every department of college and university to a more earnest effort and higher ideal. Ignorance is no longer an excuse for keeping others ignorant, and to-day college education fits the female for the field which needs her labor, and the world is made richer for her skill and fidelity and better, too, for the independence, that we can do nothing better but quote the words of Pope: "Tis education forms the common mind, Just as the twig is bent, the tree inclined." THE TRUE To-day we hear much concerning the meeaninar PERSPEC- ° TIVE. of that modest word, "success." What constitutes success? It all depends upon the viewpoint, upon the perspec-tive. Hence at one glance, we obtain a realizing sense of the im-portance of perspective. No two persons have the same perspec-tive. The educational and hereditary traits are different for each of us. Hence our perspectives are affected differently. We all see tilings through glasses more or less colored by prejudice and bias. Although our perspectives are very different, they are not necessarily wrong. The farmer boy from Illinois will have an entirely different perspective from the son of a New York millionaire, and yet the two perspectives may be legitimate in every sense. But, that these young men should have the true perspectives of life, they must have a true sense of values. 30 THE MERCURY. It is the same with us all. We must spend a great part of out-lives in attaining the right perspective. The success of one's college career depends largely upon his sense of values. Shall the college student bend his energies in one direction or shall he aim at becoming the "all around man?" Shall he be a recluse, neglecting the social life entirely? Shall he be a social butter-fly, without intellectual ambitions? Shall he strike a happy medium between these extremes? The college student who thinks of nothing but football is a pitiable spectacle. That student is narrow—narrow in every sense, and yet the student who cannot enjoy a lively energetic football game is also to be pitied. The true perspective of life as the world sees it is to work hard, play hard, and at the same time to practice the simple life. This is the aim of the small college—to give one the right per-spective ; to give him lofty ideals, and to place in his hands the means of attaining them. Let us, therefore, second the college in her efforts: let us learn what is worth while and then go after it. GOOD The contention as to what constitutes good reading READING, is an old one. The idea that "No book is so bad but that there is some good in it," has few ardent supporters to-day. There may be something of value in every book but too often that thing of value is neutralized by the baneful. Tell me, good reader, how much of good there is in a novel such as that one en-titled, "A Woman's Temptation," by Bertha Clay. To see a col-lege man read such a book would be ludicrous, were it not that the waste of profitable time has a serious side to it. We admit that the so-called light reading may sometimes be justifiable as a temporary diversion, but let that light reading be from the more admirable writers. Why not read something from Washington Irving, Dickens, or even Jules Vernes in pref-erence to the silly, contemptible, sensational novels which flood our country. To possess a taste for really good literature is a mark of cul-ture, and true appreciation of the masters of our language is not ___^^__ THE MERCURY. 31 attained by the perusal of second-rate productions. No college man can afford to be lacking in intimacy with such men as Mil-ton, Shakespeare, Burns, Emerson and all the others who form that brilliant galaxy of pensmen that has given imperishable fame to the English language. j* EXCHANGES. IHE November exchanges are especially attractive, many being special Thanksgiving numbers, and containing essays and poems suitable to the great national holiday. We notice in reading the various papers that much of the material is contributed by alumni of the various schools. In some instances the entire literary section of the papers are given to alumni productions. What does this indicate ? In one respect it shows a healthy alumni spirit which is indeed com-mendable and in many respects desired. But on the other hand it displays a lack of literary interest on the part of the present generation of students or a disposition on the part of some edi-tors to sacrifice the best interests of their fellow-students in order to fill the magazine with articles having a higher degree of polish. After all the college paper is primarily the students' pa-per, and when it once loses the interest caused by the personal touch given by student articles, its time of service to the college community is ended. We must therefore conclude that when-ever possible literary departments should be filled with good, live articles by those in direct touch with the college life. The literary department of "The Western Maryland College Monthly" is again well filled with interesting articles, the ora-tion, "The Submerged Truth," deals in a broad and clear man-ner with the great problem of the poor in our industrial divi-sions. "The American Home" pictures in a pleasing style, and with patriotic light this greatest of American institutions. "How They Changed Their minds," and "The Eeturn of the Wan-derer" are hardly equal to the usual standard of short stories found in your magazine. We consider "The Haverfordian" as among the best exchanges we receive. Its literary tone and pleasing style are necessary 32 THE MERCURY. characteristics of a good college paper. The numerous short poems always found in its pages, shows that the love and appre-ciation of poetry still exists at Haverford. "The Albright Bulletin" contains some literary productions of high order. Its leading article, "Beacon Lights of American Poetry," is of high merit. Its author pays a glowing tribute to the world-honored Bryant. Yet we believe too much praise can-not be given a poet, who has painted pictures such as has Bryant, or who has moralized as he has in his immortal "Thanatopsis." The mild and gentle Longfellow is fairly dealt with. Oft times we are inclined to think slightingly of Longfellow because he lacks that profundity of thought found in Bryant, Lowell, and Emerson, but we must never forget that "his life and work stand as a true poem." In the article, "A Crisis in Great Britain," a powerful argument in favor of our protective system is pre-sented. A GLIMPSE OF MOONLIGHT. The moon comes up with sudden light, And each star fades to a distant spark, And from the valleys, the gloom of night, And from the hills the dark. The mountains slumber against the skies, And fade in the distance far away- Arid the wind weaves beaiitiful mysteries On the mist where the moonbeams play. And far away, in the moonlight fair, Runs the thread of a silver stream; And (lie white mists float on the soft night air, As tin angel floats through dream. —From the •'•'Southern Collegian." PATRONIZE OUR ADVERTISERS. I"N this Drama of Four Year's Course, Play your part without dad's horse ; This to do is up to you With just a little tact between each yearly act, In some domain take a stroll And sell ALUMINUM for next year's Me (roll). Every summer Uuudreds of students make BIG MONEY selliug Aluminum Cooking Uteusils. For particulars address LOUIS HETZEL, Gettysburg College, GETTYSBURG, PA. THE STEWART & STEEN CO., COLLEGE ENGRAVERS, 1024 Arch Street, PHILADELPHIA. MAKERS OF INVITATIONS, PROGBAMS, MENUS, VISITING CARDS, DANCE CARDS, MONOGRAMS, CLASS AND FRATERNITY STATIONERY. P. S. MILLER, 'to, Representative, Who has a full line of samples. (%;< 1 HI The times an ! the Schools demand that the best things shall be done and in the best manner. gai ±l\ accomplishes everything- that can be required of a good writing- in-strument. Made to last for years oJ service and give its owner the satisfaction which comes with owning "the best." From a31 dealers. TSie Globe trademark is our guarantee citco. 1.76 St. J«i 1 St., Monlrenl 12 I . I.0.I.1.' CRU- da Hi PATRONIZE OUR ADVERTISERS. FU^NTTl/fp Mattresses, Sed Springs, Iron Beds, Picture Frames, Repair Work done promptly. Under-taking a specialty. - Telephone No. 97. H. B. BENDER. 37 Baltimore Street, Gettysburg, Pa. EDGAR C. TAWNEY BAKER West Middle Street. J. B. WINEMAN, DEALER IN CHOICE FAMILY GROCERIES, PROVISIONS AND FRUITS, BOARDING CLUBS A SPECIALTY. L, WEIGAND, DEALER IN FRESH AND CURED MEATS OF ALL KINDS-Boarding Clubs a Specialty. Soul's f^estaupcmt, Ice (sPeaEQ. aiyiC (^uicl^ ISIAI^CII, No. 7 Chambersburg Street. PATRONIZE OUR ADVERTISERS. EMIL ZOTHE, College Emblems, Engraver, Designer and Manufacturing Jeweler, 722 Chestnut St., Phildelphia. Specialti es: Masonic Marks, Society Badgs, College Buttons, Pi ns, Scarf Pins, Stick Pins and Atletic Prizes. All Goods ordered through E. J. Bowman. Charles S. Mumper, DEALS FURNITURE, DEALER IN PICTURE FRAMES OF ALL SORTS REPAIR WORK DONE PROMPTLY I will also BUY or EXCHANGE any SECOND-HAND FURNITURE No. 4 Charnbersburg street, Gettysburg, Pa. CULP'S RESTAURANT, First National Bank Bld'g. The place to eat the best Ice Cream. QUICK LUNCH and Oysters in season. D. J. Swartz, DEALER IN COUNTRY PRODUCE, GROCERIES, CIGARS AND TOBACCO. GETTYSBURG. —IS— J. I MUMPER Your Photographer, If not, why not? 41 Baltimore St., Gettysburg. FLEMMING X BAIR'S LIVERY, Baltimore Street, First Square, Gettysburg, Pa. Competent Guides for all parts of the Battlefield. Arrange-ments by telegram or letter. Lock Bock 257. PATRONIZE OUR ADVERTISERS. WINDSOR HOTEL, Midway between Broad St. Station and Reading Terminal on Filbert St. American Plan $2.50 per day- European Plan $1.00 per day The only moderate prieed hotel of reputation and consequence in PHILADELPHIA. The Modern Steam Laundry . . OF YORK . . Offers the COLLEGE STUDENTS first-class work at Special L,ow Prices. E. C. STOUFPER, Local Agt. C. D. SMITH, Prop. The Baltimore Medical College Preliminary Fall Course begins September ist. Regular Winter Course begins September 20th. Liberal teaching facilities ; Modern college buildings ; Comfortable lecture hall and amphitheatres ; Large and complete equipped laboratories; Capacious hospital and dispensary; Lying-in department for teaching clinical obstetrics ; Large clinics. Send for catalogue. Address DAVID STREETT, M. D., Dean, N. E. Cor. Madison St., and Linden Ave., Baltimore, Md. COMPILER IMPRINT ON JOB WORI MEANS TASTY WORK CAREFULLY LONE. MENU CARDS WINDOW POSTERS LETTER HEADS ENVELOPES DANCE CARDS TICKETS Programs of all kinds. Everything the College Man wants in lJaper and Ink. Specially designed work. Latest Effects in Paper done in Colors along lines of College Men's Associations. Catalog and Book work. The Cettysbuig Compiler will keep old and new students in touch with town and college life.
The Mercury October, 1909 HELP THOSE WHO HELP US. The Intercollegiate Bureau of Academic Costume. Cotrell & Leonard, ALBANY, N. Y. Makers of CAPS AND GOWNS To Gettysburg College, Lafayette, Lehigh, Dickinson, State College, Univ. of Penn sylvania, Harvard, Yale. Princeton, Wellesley, Bryn Mawr and the others. Class Contracts a Specialty. Correct Hoods of Degrees The College Man's Opportunity. We offer the Surest Means of finding your right place. Hundreds of good positions open in business, in teaching and in technical work. Offices in 12 cities. Write us to-day. THE JVATIOJS'Al, 0I{ffJ.!\'JZJiTMOJY Of M/*.//•V BROKliHS. Commonwealth Trust Building, Philadelphia, Pa HOTEL GETTYSBURG, Headquarters for BANQUETS. Electric Lights, Bteam Heat, All Conveniences. Free Bus to and from station. Convenient for Commencement Visitors. RATES $2.00 PER DAY. ■Civery CUtac'keol. Joljn T. W[e(i■ PATRONIZE OUR ADVERTISERS. ** i5 « * * ««a ««»a ft a * * ft ft « ft ft ft «a « ft « »« ft ft ft » ft a ft »« « ft ft «»a « ft ft c ft ft » ft ft » ft « ft ft « Seligniqri ARE GETTYSBURG'S MOST RELIABLE TAILORS And show their appreciation of your patronage by giving you full value for your money, and closest attention to the wants of every customer. Give Them *«« * ««a » ft a »»» » «*** a « ft •ft ft ft » ft ft ft « ft ft ft ft ft ft « ft ft ft ft ft ft ft ft ft ft ft ft ft ft ft ft ft ft ft Your Patronage « «« « ♦ * * * * » * •»»«»»*»»»«»»»»«»*»c»»«aftft««»ft»#»»****»»»*«*♦♦ * a a PATRONIZE OUR ADVERTISERS. •* A Special Proposition la open for tbe first person in any com-munity who will deal with us for a Piano or Organ. WEAVER ORGANS AND PIANOS have no question mark to the quality. MAIL THIS COUPON TO US. Send me special proposition for the purchase of a Piano. Name $ WEAVER ORGAN AND PIANO CO., MANUFACTURERS, f | YORK, PA , U S A. | Address \v '■I-' I I II 1II Students' Headquarters —FOR— HATS, SHOES, AND GENT'S FURNISHINGS. Sole Agent for WALK -OVER SHOES ECKERT'S STORE. Prices Always Right TJie Lutheran PuWicdtioij Society No. 1424 Arch Street, PHILADELPHIA, PA. Acknowledged Headquarters for anything and everything in the way of Books for Churches, Colleges, Families and Schools, and literature for Sunday Schools. PLEASE REMEMBER That by sending your orders to us you help build up and develop one of the church in-stitutions with pecuniary ad-vantage to yourself. Address HENRY 8. BONER, Bupt, THE KA ERCURV The Literary Journal of Gettysburg College. VOL. XVII GETTYSBURG, PA., OCTOBER, 1909 No. 5 CONTENTS. ARTICLE I.—TENNYSON" CENTENARY, AUG., 1809- 1909.—Tennyson and In Memoriam 2 REV. CHARLES WILLIAM HEATHCOTE, '05, A.M., B.D. GETTING EVEN 5 E. C. STOUFFER, '11. CULTURE S G. F. POFFENBERGER, '11. NOBLE CHARACTER OUR NATIONAL SAFEGUARD. 9 PAUL S. MILLER, '10. IS THE GRANTING OF ATHLETIC SCHOLARSHIPS GOOD POLICY? 12 PAUL M. MARSHALL, '10. A COMPLETED PLAN 13 TAXIS, '09. THE WORLD IS OVER-ORGANIZED 16 ROT V. DERR, '10. WHAT IS SUCCESS? 21 E. W. HARNER, '12. OUR SYMBOL—OUR IDEAL 23 RALPH E. RUDISILL, '10. AN INDIAN SOLILOQUY 25 1911. EDITORIALS 28 BOOK REVIEWS 31 2 THE MEEOUEY ARTICLE I.—TENNYSON CENTENARY AUG. 1809-1909.- TENNYSON AND IN MEMORIAM. BY EEV. CHAELES WILLIAM HEATHCOTE, '05, A.M., B.D. |ANY problems have disturbed the human race from the very early ages. We have had men in the past history of the world, and in fact through all periods of later development and even now, asking such questions as. Does death end all ? Whence is the origin of evil ? Why do we have suffering ? Is the soul immortal ? Poets, philosophers, prophets, priests, aye in fact all humanity, have grappled and continue to grapple with these deep problems. Socrates, Plato and Aristotle were not the only ancient philoso-phers who sought to know the cause and effect of things. Thus the problem of life, death and immortality have puzzled sages. We have many poets seeking to bring to light various thoughts to explain these things. The Great Master has pointed out to us, and has revealed to us, that if we are true to God, fellowman and self, we shall inherit eternal life. He has revealed to us the con-ditions, how we may be saved, and thus receive immortality. However, with this revelation each generation is able to meet these various problems and with the spirit of truth to be able to understand them in part at least. Also where true understanding is impossible we have a faith in the Christ, which is firm and strong, for, though now we see through a glass darkly, then we shall see face to face, and we shall be known even as we are known. Thus the poets have struggled with these perplexing problems. They probably give us a better insight into the religious consci-ousness of each generation than do the theological writers. They seem to have a deeper prophetic insight into nature. Thus Mil-ton struggled with the same problems. Though his poetry is not popular, nevertheless it is classic. We find there is a deep in-sight into the problems that have confronted the human race. As Alfred Tennyson mourns the loss of his beloved friend and college mate, Arthur Henry Hallam, in the immortal poem, la Memoriam," so Milton has written "Lycidas," a poem, mourning the loss of Edward King of Christ's College. He had perished THE MBHCOKT. 3 in a shipwreck off the coast of Wales on the 10th of August, 1637. Of him Milton writes: "Weep no more woeful shepherds, weep no more, For Lycidas, your sorrow, is not dead, Sunk though it be beneath the watery flood: So sinks the day-star in the ocean bed, And yet anon repairs his drooping head. And tricks his beams, and with new spangled ore, Flames in the forehead of the morning sky." Again, Thomas Gray in his beautiful poem, "The Elegy Writ-ten in a Country Church Yard, points out the tribute to the hum-ble ones who are the strength and power of a nation and who de-part from their loved ones and the world in time seems to forget them. They are deserving of the highest praise and emulation. Thus he writes: "Let not ambition mock their useful toil, Their homely joys, and destiny obscure; Nor grandeur hear with a disdainful smile The short and simple annals of the poor. The boast of Heraldry, the pomp of Pow'r, And all that Beauty, all that wealth e'er gave, Await alike th' inevitable hour The paths of glory lead but to the grave. Nor yet ye proud, impute to these the fault, If memory o'er their tomb no trophiees raise, When through the long-drawn aisle and fetted vault The pealing anthem swells the note of praise. Emerson, our own beloved poet, came face to face with the great problem of death when his son, Waldo, died January, 1842. He wrote the beautiful poem, "Threnody," about the loss of his child. As we read this poem our hearts go out in sympathy to the poet, for we feel every word of the poem vibrating, as it were, with his sorrow. , GETTYSBURG COLLEGE f I Gettysburg, Pa. 1 | - LIBRARY - § 4 THE MEKCDBY. The first part of the poem is a true picture of the poet's grief. He writes: "And, looking over the hills, I mourn The darling who shall not return." In conclusion he writes: "Silent rushes the swift Lord Through ruined systems still restored, Broad sowing, bleak and void to bless, Plants with worlds the wilderness; Waters with tears of ancient sorrow Apples of Eden ripe to-morrow. House and tenant go to ground, Lost in God, in Godhead found." Of the poem Dr. Holmes said, "It has the dignity of Lycidas without its refrigerating classicism, and with all the tenderness of Cowper's lines on the receipt of his mother's picture. Thus when Tennyson wrote "In Memoriam," great grief filled hisieart for the loss of his dear friend and college chum, Arthur Henry Hallam. Tennyson was a man of strong character, pure and noble ideals. He is a philosopher, poet, sage and prophet. His poetry though deep and classic is also popular. He has a living mes-sage for each one. His poetry comes from a deep sympathetic heart and is therefore living and true. Alfred Tennyson, the English poet-laureate, was born at Som-ersby Eectory, Lincolnshire, Aug. 6, 1809. He graduated from Trinity College, Cambridge, the same institution from which Hallam was graduated. Tennyson won the chancellor's medal in 1829 for the poem "Timbuctoo." Tennyson began to write poetry at a very early age. In 1830 appeared a volume of well written verse. In 1842 he published another volume of poems, which showed deep thought and con-templation and which won for him a high place among the Eng-lish poets. In 1847 appeared the "Princess," and in 1850 the world was THE MERCURY. given the immortal elegy, "In Memoriam." In 1855 the poem "Maud," appeared in a volume together with the "Charge of the Light Brigade," and an ode on the death of the Duke of Welling-ton, part of which reads as follows: "Lo the leader in those glorious wars Now to glorious burial slowly borne, Follow'd by the brave of other lands, He, on whom from both her open hands Lavish honor show'd all her stars, And affluent Fortune emptied all her horn. Yea, let all good things await Him who cares not to be great, But as he saves or serves the State." During the remaining years of his life he published the "Idylls of the King," "Enoch Arden," "The Northern Farmers," "Ti-resias," "Demeter" and other poems, "Akbor's Dream," "The Death of Oenone," "Queen Mary," "Harold," "Becket," "The Cup," "The Promise of May," and "The Foresters." He was raised to the peerage in 1874 on account of his ability and also as a tribute to his work. He died Oct. 6, 1892, aged 83 years, at his home Aldworth Surrey. GETTING EVEN. E. C. STOUFFEE, '11. | HEN Eoger Craig received an appointment on the re-porters' staff of the "New York Journal," all his friends and neighbors predicted a bright future for him, and at the beginning of his career it seemed as though their predictions would come true. His willingness to work, keen per-ception and native courteousness made him a favorite with every-one, and at the same time an invaluable member of the staff. The hardest work was assigned to him but he invariably accom-plished it successfully. AVhen he was sent to interview a man he 6 THE MERCURY. usually had a story for his paper. As a result one promotion fol-lowed another in such rapid succession that, any other young man they would have caused to swell up with pride, but Craig only determined to work harder and rise still higher. He had now been in the employ of the great newspaper four years and during that time had risen to the front rank as a re-porter. Occasionally during those four years a letter went from him to the old editor of the only weekly newspaper which his native New England town. boasted. These the old man pub-lished gladly and the townspeople read them eagerly. At the village store when Roger's name was mentioned and his success discussed, old men between streams of tobacco juice, used to say, "I told you that he'd git along." While Craig was getting along in this happy wajr, the morning came when the entire world was shocked by the news that our President, Win. McKinle}1, had been, perhaps, fatally wounded hy an anarchist while shaking hands with him at the Pan-Ameri-can exposition at Buffalo. Eoger heard the news and then thought a moment. A letter wouldn't reach his home town for two days and that would be too late for that week's issue of the paper. Thinking to do a kindness to the old man he sent a tele-graph dispatch to him telling him of the cowardly attempt on the President's life. The old editor was astounded. In all his life as an editor he had never received a telegram. Carefully adjusting his spectacles he read it again and again. This surely must be a mistake. It cannot be possible. Surely no one would try to take President McKinley's life. Wo one could do that. This must, therefore, be a mere joke of young Craig's. And it was plainly his duty to advise the young man against such foolishness. Accordingly two letters left his office that day. One was addressed to Craig at his rooms in New York. It contained a warning against the danger, and a little fatherly advice concerning practical jokes. "A mat-ter of the importance of his recent telegram was entirely too serious for a joke," etc. The other letter went to the managing editor of the "New York Journal" and said that a watch ought to be kept on young Craig, for he must be somewhat beside himself. Then followed a detailed account of the telegram. In the Mid-dleberg "Chronicle" there appeared a long article saying that THE MERCURY. young Craig must have suddenly lost his reason, for this week he became seized with the notion tht President McKinley was assas-sinated, and telegraphed the same to us. Of course we are very sorry for the man and sympathize deeply with him in his afflic-tion, etc. The next morning when the postman brought in the old man's mail he saw the rival newspaper of the neighboring town had its entire front page taken up by an account of the attempt on Mc- Kinley's life. The old man was dumfounded. He might doubt Craig's telegram, but he never could doubt that newspaper. He saw where his rival had beaten, whereas if he had not been so foolish the advantage might have been his. That afternoon he was kept busy cancelling subscriptions to his paper. That night a weary heavy hearted old man wrote a long letter to the young reporter. He offered profuse apologies for the treatment which had been given him and ended by saying that he never would doubt his word again no matter what news item he might send him, he would publish without for a moment questioning as to its truth. Meanwhile the two letters reached their destinations. Eogers received his with a feeling of amusement. His mental comment was merely, "Blamed old fool. He's crazier than I am." But when the managing editor read his a frown crossed his forehead. He pondered a moment and then summoned young Craig. When the young man appeared a stern-faced manager faced him. The manager motioned him to a chair and then said: "I am sorry that I must inform you that your services are no longer required by us. I have here a letter from the editor of your home paper in which he informs me that you have been sending news matters from our office. We pay enormous sums yearly to maintain private wires, so of course we cannot allow our employees to send away what we pay so dearly for." The young man's head swam. Before all looked bright to him. In a moment all was changed. A feeling of intense anger towards the old man, whose ignorance had caused his misfortune, took possession of him and a desire to get even filled his mind. He went to the nearest telegraph sta-tion and sent the following telegram to the old editor: "At last the long-standing dispute between Emperor William and Edward VII concerning the Imperial Crown has been settled. The two 8 THE MERCURY. rulers decided to fight a duel and thus decide. The weapons were automobiles run toward each other at full speed. Santos Dumont in his airship carried Edward VII, the one who was found to be the nearer alive, to Eome, where he was crowned amid loud acclamations from the people." The next morning the little weekly came out with a full page account of the affair and two days later the sheriff closed the little office forever. And so far as young Craig was concerned, the last that was heard of him he was shucking oysters in a wholesale oyster house down along the Chesapeake Bay. *£• *&• CULTURE. G. F. POFFENBERGER, '11. |UCCESS to-day demands both natural ability and cul-ture. In the past, men have risen to the summit of human achievement through their natural ability alone. But the strenuous, vigorous and active life of the pres-ent requires every contestant in the race to be fully trained.Ig-norance in responsible positions is a thing of the past. Nature often endows a man with one talent which if developed, produces a man of genius, if neglected, degenerates him into an abnormal being. Upon one man may be bestowed strong intel-lectual abilities at the expense of his physical nature; to another may be given the vigor with small attention to intelligence; many in the present age are possessed of both qualities. To equalize the gifts of nature culture should be given the office of mediator and instructor. Culture to-day is within the grasp of everyone, whether he be of high or low birth. To all the schools of the country are open; to all the colleges and universities of the land offer their oppor-tunities. Nor is self-culture less practical; for its end is the same though its means are more severe and trying. The reading of choice literature and the associations with great works of art produce an effect upon the character to be marked as the test of the fully trained mind. Critical power in litera- THE MERCUEY. » ture is a degree of cultivation rarely attained, but when attained, it places its possessor in a position almost superhuman. The perception of beauty is another test of culture. Only a small part of this earth is given over to one's needs; the whole universe however, is within the hand of the fortunate one who perceives beauty in nature. Beauty is an all-pervading presence. It unfolds itself in the myriad blossoms of the springtime; it is beneath the dark shade of the summer trees; it haunts even the depths of the earth and sea. The uncultured man looks upon all these with a hardened heart. To the man of culture it is a reve-lation of the proper course of human action not only here, but even through eternity. The greatest attribute of culture is its power not only to in-duce impressions but to produce expressions. The cultured man is an artist. Expression may be made to the world through the medium of the brush, the pen, or a higher medium still, the hu-man voice. Speech is one of our greatest distinctions from the brute, and its highest cultivation marks the highest type of man. Our power over others depends less upon the amount of thought within us, than our power to bring it out. The ages of the world have been marked by the gradually widening breach between man and beast, the physical and the spiritual. The past is behind us, we must keep up with the pres-ent only. Future years will produce still greater changes, and through the influence of culture, mental and spiritual man will attain that perception which his Creator intended for him. NOBLE CHARACTER OUR NATIONAL SAFEGUARD. PAUL S. MILLER, '10. |HEN we speak of character and its influence it is neces-sary first that we know what is meant by character. By character is meant the composite of definite moral and personal traits which serves to distinguish an indi-vidual and to mark the type to which he belongs. Therefore, 10 THE MEKCUEY. noble character is that which, in the highest sense constitutes the man. It is very evident then, that the men who fill our executive chairs must possess noble characters in order that they may be true to themselves, true to the instincts which, with our race seem to go hand in hand with freedom,—love of order and respect for law. A man to possess a noble character need not be a great man as the world classes great men, but the man who has a true, noble character, who uses his gifts rightly and does his duty in whatever station of life he is situated. One of the most important factors to be considered in the de-velopment and acquisition of a noble character, by which the moral nature must be subjected and brought under control, is the will, by which the mental faculties are directed and energized. It is through a strong will that bad habits are overcome and habits of truthfulness, honesty and obedience are established in their stead. It is through a well controlled will that self-respect, self-control and strength of character is obtained. One of the greatest forces in the world is man; and one of the most determinate and irresistible forces in man is his will. When the will collects its forces and makes a final resolution to accomplish some act it is then that man has the power on the one hand to poison the very springs of national life or on the other to become in reality the agent of God. This nation of ours stands as it is to-day because of such reso-lutions as the latter being carried out by men of strong wills and noble characters. With such powerful forces as Washington and Lincoln to guide and urge us on, it is not only right, but it is the duty of every one of us to attain the highest possible standard of noble character. It is from the young men of to-day, those who are now in the course of their education, that our future governors, senators, statesmen and presidents must be chosen. We may assume, then, that if the seed of a noble character is sown in youth we may ex-pect the rising generation to enter this world prepared to fight the battles of life, and our higher offices filled by men who will strive for the betterment of themselves and their posterity and men who may be entrusted with the government of this grand and glorious nation. TUB MEKCURY. IT If the Englishman is proud of his country, scattered as it w all over the world, so that, as he boasts, "the beat of the morning, drum encircles the earth," if the Swiss peasant loves his moun-tain heights, if the Scotchman delights in his desolate moor, and the Irishman thinks his little island of poverty the dearest spot on earth; if even the despised Chinaman dreads to die outside of his native land, what should be the devotion of Americans to this the grandest land the sun has ever shown upon, a land where hu-man happiness is so widely disseminated, where human govern-ment is so little abused, so free from oppression, so invisible, in-tangible and yet so strong. The world is asking the young American to-day what may we' expect of you when you are called upon to take the place of re-sponsibility made vacant by the deaths of those who now occupy them. Are we going to disappoint the world and make a failure of our lives? Or will we meet the demand of the times and profit by the failures and successes of our predecessors. A nation must also possess a character if it would endure; and this is obtained only through the character of the individual. When national character ceases to be upheld, a nation may be regarded as next to lost. When such a state is reached that honor and obedience are seemingly lost, the only remedy is the restoration of individual character, and if this is irrecoverably lost, all is lost. Then let us, as a rising generation, be marked with that great feature of noble character, that moral worth and intelligence that we may have the power to erect a bulwark which shall prove im-pregnable in that hour of trial, when fleets and fortifications shall be vain. If, therefore, it is in our power to preserve this precious heri-tage, let us cling to it with a patriot's love, with a scholar's en-thusiasm, and with a Christian's hope and may this grand nation which is still part of the great universe be as an ornament of a' free people and continue to be free and which God may preserve-till time shall be no more. iETTYSBURG COLLEGE Gettysburg, Pa. LIBRARY 12 THE MEHCURY. IS THE GRANTING OF ATHLETIC SCHOLARSHIPS GOOD POLICY? PAUL M. MARSHALL, '10. HE problem of the athletic scholarship confronts every college or university of prominence to-day; in most cases it is not a question of dollars and cents but a ques-tion of principle and the future welfare of the college. Whether the moral and mental side of an institution is benefitted by the presence of men that an athletic scholarship has brought to its campus is probably debated in the faculty meetings of every school. The true and original purpose of such a scholarship was to help those students athletically inclined who were financially un-able to get through college; it was intended not for the lazy, happy-go-lucky athlete that is never a credit to any college but for the earnest student whose only hope of education lies in his athletics. Such men, working hard for an education, would probably be compelled to resort to summer ball or professional sport of some kind to carry on their college work and then if they attempted to engage in school athletics there would be the cry of "professional-ism" and "impure sports." This is the man to whom an athletic scholarship is a salvation, an inspiration that will goad him on in every line of work; the duty to his college comes first, and in after life any alumnus can point to him -with pride as a fellow-graduate. He is a credit to the institution he represents. But in these attempts to aid the worthy, the bounds have been over-stepped and the college has forgotten the kind of men the athletic scholarship was designed for; an insight into the man's character is overlooked, not a thought is given to his personality;: there is but one thought and that is the athletic ability of the applicant. Credentials of good character and moral worth are not asked for; all that is needed is a recommendation from some former team-mate or coach to insure the receipt of such a scholar-ship. This man, in his few years at college, whilst he may have been instrumental in a few victories, will probably have had a demoral- THE MEECUBY. 13 izing effect on the student body; the tendency to loaf is prevalent., for he is not interested in college work and the result is that in most cases he is classed as a special student. These specials are a drag to the institution and are seldom a credit to their Alma Mater. The man who does not have graduation in view will never take the interest in his work that should be characteristic of every college man. A college is known by its alumni. Are the men who were in college the beneficiaries of athletic scholarships, fit persons to in-fluence increased attendance and bring credit upon the college? The fact that athletic prominence brings success to an institution is undisputed, but the fact carries with it the provision that only men strong in every line of work shall be allowed to represent the college. On the whole the athletic scholarship discourages study and aptitude in any phase of work other than the athletic; is is mis-used and has become rather an easy way of spending four years than an encouragement to deserving students. To the poorly en-dowed small college that must strive in every way to exist where a few such loafers may have an infinite influence on the student body, the athletic scholarship is the cause of a lowering of every standard of the school's worth. In the university the plan may not reflect on the general student life, but no matter where or what may be the school concerned, the granting of athletic scholarships is indiscreet and not in harmony with the best poli-cies of the institution. A COMPLETED PLAN. TAXIS, '09. HE directors of The Slicem Packing Co. Limited had gathered together and had been discussing the rumors relative to the investigation of their business by the government deputies. The board room was filled with. the smoke from their cigars, and a hush pervaded the chamber. Each man was thinking deeply of the approaching storm. "WelL 14 THE MERCURY. fellows, this city is too hot for me, and I am going to take a trip abroad for my health," finally declared the youngest, and most promising director. "But, Des, that'll never do. You see that will put us in a poor light and we can't afford it," apologetically said one of the others. "Oh shucks Gordon! Poor light or not, I am going abroad. Now gentlemen, you have heard my de-cision. Do as you think best; I shall do as I have just said." So saying H. G. Desmond Vanderpew abruptly left the heated room and directed his steps to his palatial home in Madison Square. Here he made all preparations for his intended trip. Soon after Vanderpew's arrival a cab was seen to stop at his door. Vanderpew descended the wide, white, highly polished marble steps, entered the waiting vehicle and gave a last glance at his father's beautiful mansion, surrounded with artistically arranged flower beds. The carriage, after a half hour's time, finally stop-ped in front of the Past Line Steamship Co. Vanderpew step-ped out, paid the cabby and, handing his suit case to the porter, crossed the gang plank. Soon he felt the movement of the great ship and he began to breathe easier. During the entire trip he remained in his state-room, partly on account of illness, but more especially that he might not encounter any of the government officers who might have decided that they likewise needed recuperation. Vander-pew consulted maps and catalogues to occupy his time. He de-liberated as to the best course to pursue. At last he decided to go to a little town in Germany by the name of Stoburg. "Here," he reasoned with himself, "I can be incognitio, free from molesta-tion, and it will be the last place that those sleuths will stick their noses." Accordingly when the ship was docked at Queenstown, he sought the next departing vessel for the continent, where he boarded a train for Leipsic. When he ultimately reached the station, night had already settled over the quiet town and many of the inhabitants had already obtained a few hours' sleep. Hav-ing refused the assistance of a cabman, Vanderpew trudged along over a well paved street in search of a hotel. Finally, after a painfully long walk he located one and going to the assigned apartment retired, weary, yet with a mind free from fear of the tieputies. THE MEKCUBr. 15 When he awoke the next morning, the sun was high in the heavens. After his necessary toilet had been performed ,he de-scended to the large room, which was used as a bar room, dining room and general parlor. Here he met the fat, cheerful, rosy-cheeked proprietor, who inquired about his welfare. "Oh, I feel fine, and I shall take advantage of this fine weather, and go walk-ing." Vanderpew strolled slowly down the street, idly looking into the shops. At last he found himself at the end of the paved street and at the beginning of a road. "I guess I'll keep right on," he murmured. So saying he stooped, picked up a stone, ex-amined it curiously, then resumed his walk. Soon he was in the midst of one of those renowned forests of Germany. The trees stood in parallel rows. The underbrush so common to American forests had been cleared away and at intervals were benches for • the comfort of the passerby. At the beginning of the forest the State Forester was directing his busy assistants to mark this or that tree which he deemed ready for the ax. After watching the operation so new to him, Vandepew resumed his walk. Gradu-ally the place became forsaken. The sun heated the aisles be-tween the tall cedar trees, while the stirring breeze prevented the heat from becoming too intense. The trees shaded the edges of the paths and the birds filled the air with their songs. In a meditative mood Vandepew strolled on and on. Suddenly he espied a girl sitting on a bench directly to his right. Her tall figure, with its broad shoulders, plump arms and gibson waist betrayed an American lineage, as also did her almond eyes and high pompadour. "Gee! what a beaut!" he muttered, "wonder if there's any wrong in a casual acquaintance. I guess she's Dutch, but I'll be darned if she doesn't look like the best Ameri-can beauty I've ever seen. Well, here goes." In the meanwhile he had approached her. He stopped, summoned courage, and then blurted out, "Sprechen sie Deuteh?" The girl raised her eyes from her book in surprise and asked, "Pardon me, but did you speak to me ?" "Er-er ye-e-s, that is to sayy—yes!" "Are you acquainted here?" he continued meekly. "Just a little," she answered, "you see I am staying at the Hotel and am out for pastime." "How miraculous! I should say how delightful! I am also a guest at the same place. How would you like to 16 THE MERCURY. have a companion in the indulgence?" "Well, I suppose that since we are both Americans, it will not matter if we don't have a formal introduction, just this once. Do you think it will ?Oh, no," he quickly answered, sliding his arm around her slender waist, "of course not." We are co-admirers of nature." "Oh well," he continued, "I shall introduce myself and you can tell me who you are and we will be over Mrs. Grundy's objections. My name is Henry Griswald Desmond Vanclerpew of New York City, twenty-five years of age, secretary of The Slicem Packing Co., millionaire, a free and accepted Mason of the thirty-second degree, Knight Templar, a lover of sports and an admirer of Kipling, et cetera, and you? "Well, Desmond, it is strange you do not remember your old sweetheart, Inda Audrey Meredith, the possessor of nineteen American summers and two German winters, the maker of your twenty odd cushions, also your old yacht mate." "Audrey! How changed! Let's do now what we had plan-ned before your trip abroad. Will you dear?" Their lips met in common consent and silence prevailed. THE WORLD IS OVER-ORGANIZED. ROT V. DERR, '10. I HE inherent meaning of the word "organization," is al-most as old as Time itself. The principles of organiza-tion form the basis of society and government. When-ever a number of people desire to establish a principle, foster an idea or promote an interest, they must first organize. Thus a system of work is laid; disorder and inequality are pre-vented; concentration of effort, and harmony prevail. But the question that concerns us for the present is, whether or not the tendency is toward too much organization. Never in the history of the world has there been so much or-ganization. This is true in Church, in State, in Industry, but especially in social and fraternal life. To be convinced of the growing tendency toward organization, we need only to look at THE MEHODIty. 17 the Church. The average modern city organization counts its organizations by the dozen. There are societies for the old, the middle-aged, the 3'oung; for the men and for the women, old and young. There are missionary organizations, temperance, social, charitable and sometimes individual organizations. That the aims and purpose of all these organizations are praiseworthy and right, is not denied. But the question is whether there is too much organization for the moral and spiritual force necessary to keep it in smooth running order. Is the machinery becoming too huge and unwieldly ? Are we going too far ? It is evident that to carry out successfully these different or-ganizations, their plans and methods of work, each one must be regulated by its system of officers, meetings and routine of work. The regime of just one organization to be executed with any de-gree of success demands a considerable outlay of time, money and energy. How can so many survive? Some must suffer. This accounts for the failure of so many organizations. Not because the aim of the society may not be worthy nor its plans commen-dable, but the expenditure of time and talent necessary to insure its success, is too much, considering the other important and more necessary organizations to which one may belong. One cause of over-organization is the attempt to execute a prin-ciple or policy that is already being enforced, only in a more general way. To be more clear, the tendency is to counteract every particular evil, or to promote every particular virtue by a corresponding organization with its whole system of work. To attack the vice, profanity, the Anti-profanity League is organized. The smoking of cigarettes is assailed by the Anti-cigarette Asso-ciation. Organizations of this nature exist without number. Certainly some of them are absolutely necessary and constitute the best way to fight a foe or promulgate a principle. They are sometimes more effective than an organization having a broad, genial scope. An example of this type would be the Anti-Saloon League, now working wonders by its sane principles and com-mon sense methods. The scope and mission of these organiza-tions vary. Let us ask the question. Is an organization justi-fiable whose purpose and aims are already covered by another greater, more inclusive and comprehensive organization? For example, does the desecration of the American Sabbath demand is THE MEKCUBT. an organization whoso purposes shall be to mitigate its abuse or to give the laborer his rest, and so on, when the State or the Church should properly regulate these matters. This is not per-haps a good concrete example, but it will suffice to illustrate the point in question. It must not be understood that organization is not essential to moral and social reform. The Society for the Prevention of Cruelty to Animals has its place; the Civic Asso-ciation for Public Improvement is certainly a good thing; Purity organizations, Peace organizations and Charity organizations— all may be productive of immense good. But it is the sub-di-visions of these ideas and principles into so many corresponding small organizations that are hurtful. The trouble is not in or-ganization but in excessive organization. Another field in which too many organizations are undouhtedly "responsible for the destruction of the real usefulness of their gen-eral principles, is that of the fraternal secret orders. These, too, like the church and reform organizations have multiplied with great rapidity in recent years. The principles of these various orders are mostly of a patriotic, fraternal, or charitable nature; their emblems are such words as these: Virtue, Liberty, Pa-triotism, Mercy, Charity or Fraternity. One especial feature of the majority of such orders, is the sickness and death benefits. This feature really forms the basis for the large membership. With some exceptions of course, there can hardly be any seri-ous charge brought against the principles of these secret orders. Here, too, the harmful results ensue from the fact that there are too many being organized. They can not compete with the in-surance companies and the already existing secret orders of an established reputation. Frequently men unite with as many as six or more of these orders. These societies like all other orga-nizations must have their regular meetings, whether weekly or monthly, to maintain interest. Evidently faithfulness in dis-charging duties and pledges necessitates neglect of other import-ant business or home relations. As a result of this complexity many a one drops out. Consequently for lack of membership and financial strength, many organizations of this type "go un-der," in common parlance. Hence there is almost absolute loss of the money paid in. This condition needs no further comment. The multiplication of secret fraternal orders without a very ., THE MERCURY. 19 strong, practical, financial basis, is bound to demonstrate the evil effects of over-organization. Tliere is an economic aspect to this problem of organization. And the disastrous effects of over-organization frequently find their causes in economic conditions. The financial side is espe-cially referred to. The carrying out of the principles of an or-ganization incurs more or less expense, depending upon its na-ture. If it is an association for moral, social or civic reform, or if a fraternal order, it must have its official newspaper organ, its corps of workers and representatives in the field. The exten-siveness of the various systems and processes of work vary. In any case the financial funds must be raised to insure the welfare and safety of the organization. Very frequently many must suffer and finally fail through lack of monetary resources. The newspapers representing church denominational interests and moral reform are constantly making strenuous appeals for in-creased subscription lists in order to maintain their existence. The demands upon the average man's poeketbook made by the innumerable organizations are great. Only the most practical, beneficial and important organizations can survive. The others eke out a miserable existence and become a parasite on society. It is pitiable to see an organization launch out with seemingly bright prospects and worthy ideals, soon to be overwhelmned by the more solid, sturdy ones already in existence. Yet this oc-curs somewhere nearly every day. Another feature of nearly all organizations is to hold conven-tions, assemblies and so forth. These may occur annually, bien-nially or in a few cases less often. It may on the surface seem of little value to refer to this fact. But the increase of all sorts of organizations has occasioned so many such gatherings that the. people at large are coming to view them with dissatisfaetiou'- Pree entertainment at even church assemblies is no longer pos-sible at many places. The demands upon good nature and hos-pitality become too excessive. This is but one phase of the man • agement of the convention prohlem. Too much needless organi-zation with its array of conventions and external manifestations, will soon find a complaining public. As stated at the outset the whole world is full of organiza-tions. It is impossible to enter detailedly into all the different I GETTYSBURG COLLEGE 1 f Gettysburg, Pa. LIBRARY 20 THE MEECUBY. fields and discuss this problem of over-organization. Thus fir I have pointed out the tendencies along certain lines and shown the evils thereof. Perhaps in other lines of activity the danger of over-organization is not yet to be feared. The organization in political life certainly cannot be ques-tioned. The safety and welfare of a nation depends largely upon the interest of the people in the government. The sub-divisions of our own country into parts ranging from the grand federal to the county, district or municipal, form the basis for the people's share in government. Let us observe conditions among the industries and professions. Every branch of industry is thoroughly organized, and has its official organs, its conventions, its officers, routine of work, and so forth—all to advance their representative interests. These include all trades and business professions, which are numbered by the hundreds. It would be useless to enumerate them. It is only by the above methods that they can further their interests. The conditions and needs of the age demand such organizations. Take for example, the great agricultural industry: possibly no industry has ever made such strides. The methods of farming are assuming a scientific coloring, through Experimental Sta-tions, State Agricultural Schools, Farmers' Institutes and other organizations. As yet organization does not seem to be produc-ing harmful results along this line of industry. And perhaps the same thing could be said of the other indus+ries and occupa-tions. In like manner the educational and professional fields are im-proving their methods of work. Jfot thus to organize and mutur ally assist each other by new plans and good ideas, would be a cause of selfishness. Hence it is not difficult to undertsand why every week has its record of assemblies of educators, medical men, and the other professions. The tendency along the educational line may perhaps need restraint, lest too many chatauquas over-flow us with methods of work and instruction, and confuse our better judgment. A similar tendency within the past few years is the idea .of reunions. Every day in the summer season is scheduled for some sort of a reunion, varying in extent from a church denominational affair to a Sunday School picnic. Again, THE MERCURT 21 we repeat, the motive and aim are right. But are we carrying the idea too far? To summarize briefly the content of our discussion, we first note that the opposition is not against organization in itself. Over-organization tends to despise rather than marshal concen-tration of effort; it is impossible to devote the required amount of time and money to many organizations, though all may be more or less worthy. Too often over-organization becomes a matter of formal externality and lacks moral or spiritual earnestness. We need but cite the methods of modern evangelism to impress this fact. In conclusion it can be said that the formation of an or-ganization whose purpose shall be to prevent the formation of useless organizations, would be hailed as a great blessing to man-kind. WHAT IS SUCCESS. E. W. HARNER, '12. UCCESS, as generally defined, means the attainment of a proposed object. In this sense the man who makes it the object of his life to win a great fortune and does so, is successful, in that, he accomplishes what he has aimed for. This too, is the worldly conception of the subject. Hence, the man who starts in business, whatever his circumstances may be when he begins, and who, amasses a great fortune, is said to be successful. The politician who reaches out into-the political world and grasps the full glory of a politician, is said to be a successful man, in that he attains that which he has had in view. The young lawyer, who is admitted to the bar and performs his duties with great skill is looked upon by the world as being successful. But what is a successful life? It is not the amassing of wealth only, nor the attainment of high position, nor yet the win-ning of fame in one form or another. Life is made up of many-interests and the reaching of no one particular goal will neces-sarilv mean success. 22 THE MERCURY. "Wealth is not always a synonym of success." Many men whom the world delights to honor, attained their lofty heights of grandeur without ever acquiring anything of wealth. The truly successful are those who have achieved the greatest good in their respective callings, whether that success has brought them riches or not. Honor and fame are not requisites to success. Many men have reached positions of wealth, of high honor and fame, and yet their lives in the true sense have been failures. "Honor and Fame, from no conditions rise, Act well your part, there, all the honor lies." What, then, is true success ? No better answer could be given than that success is the faithful performance of all the duties of life that devolve upon us. God brings every human being into the world for a purpose, and he who comes the nearest to the ful-filment of that purpose is successful, whether he dies rich or poor, occupies a high or humble position, whether his name be known or unknown to the world. The successful are those who can surmount all difficulties, who can govern their own lives and Avho can say to the devil when tempted, "Get thee behind me Sa-tan." Men of great physical strength or those who are great in battle are not always successful, but those who are the architects of their own fortunes, and whose lives are full of kind deeds and noble acts. "It calls for something more than brawn, or muscle to overcome, An enemy that marches not with banner, plume or drum, A foe forever lurking nigh in silent, stealthy tread, Forever near thy board by day, at night thy bed. All honor, then, to that brave heart, though poor or rich he be, Who struggles with his baser part who conquers and is free. He may not wear a hero's crown nor fill a hero's grave, But truth will place his name among the bravest of the brave." THE MERCURY. 23 OUR SYMBOL—OUR IDEAL. RALPH E. RUDISILL, 'lO.* N all ages the achievements of man and his aspirations have been represented in symbols. Eaces have disap-peared and no record remains of their rise or fall, but by their symbols we know their history. The mono-liths of the Assyrians and the pyramids of the Egyptians tell their stories of forgotten civilization. They teach us sad lessons of the vanity of ambition; cruelty of arbitrary power, and the miseries of mankind. The Olympian Jupiter enthroned in the Parthenon expressed in ivory and gold the awful majesty of the Greek idea of the King of the Gods; the bronze statue of Minerva on the Acropolis was a magnificent symbol of the protection of the patron Goddess of Athens to the mariners who steer their ships by her helmet and spear. But these are all dwarfs in com-parison to our symbol. Greater than the monument in St. Paul's Cathedral commemorating the victories of Wellington upon land; greater than the monuments upon this very battlefield where lay buried the shackles of nearly four millions of men. Greater than these is our symbol—the fruit of political equality, of intelligence and virtue, of private sovereignty and public duty: it is the free, true, harmonious man of America. America. Ah! what a name! To-day we stand a nation that has uprooted slavery; a nation that has crushed anarchy; a nation that has overcome bankruptcy. How we rejoice in our principles of government! How they represent to the world the best results of liberty. De-mocracy is our nation's symbol. Manhood is the symbol of our people. Manhood is the Gibraltar of our Eepublic. Manhood, that which no ancient nation has ever fostered. Walk thoughtfully, kind friends, among the nations of to-day. You are tramping upon the fallen graves of centuries. Why have they gone? They died, not of old age but from the results of injustice and wrong. They died for want of manhood. Na-tional power is nothing. Universities are nothing. Colleges are nothing without manhood. Can America be added to this long list of republics. Can she thus betray herself ? Assuredly not. 'Winner of Junior Oratorical contest. 24 THE MEKCUBY. Search the creation round and where can you find a country that represents so sublime a view as America in equality. What noble institutions! What a comprehensive policy! What a wise equalization of every political advantage! ISTo fairer prospect of success could be presented. This is a land where competition is free. This is a republic which Mammon shall not rule. This is a nation where anarchy shall not sway. Equal rights and common opportunities have been the spurs of ambition and the motors of success. The American asks for a fair field and he becomes a Eoosevelt or a Lincoln. "Our only path is duty, our lamp is truth, our goal is victory." Who, then, are the truest Americans of our country to-day? Not the man who allows the glitter of gold to blind him; not the man who stands back and sees the liberty and happiness of thou-sands of women and children sacrificed upon the altars of Mam-mon, not he who corrupts the legislature. But he who has chosen a high ideal. Our country's appeal to-day goes forth to the humblest citizen. She has thrust upon everyone the most sacred privilege that she can give to man,—the privilege of sharing in the government and guarding her welfare. She asks of him in return to live a heroic life. No victory can be lasting, no reform can be permanent, unless the citizen back of it is just and virtu-ous. For the noblest ideal we look to Him above. He it was who taught this principle of equality. Was it not He who taught that man is worth more than money. Was it not this ideal that builded the foundations of free government as broad and as deep as this continent. Was it not this that stayed the tide on this heroic field. Such must be the active ideal of the American to-day. "Eight is right—since God is God, And right the day must win. To doubt would be disloyalty, To falter, would be sin." As Antaeus in battle renewed his strength whenever he touched his Mother Earth, so shall this Eepublic live, as long as its citi-zens follow and imitate the examples of our makers of the con-stitution and the Prince of Peace. THE MERCURY. 25 Assuredly we have reason to look into the future with hope. A hope not built upon the shadow of a glorious past, but rather upon the integrity of the average American citizen. A hope built upon the principles of equality and justice. May our citizens march clown the ages with the symbol of liberty and with the Bible for their guide in morals and conduct, let them as they lead the grand procession to that land beyond where shall be the union of all mankind, exclaim: "Forever float that standard sheet, Where breathes the foevbut falls before us, With freedom's soil beneath our feet And freedom's banner streaming o'er us." AN INDIAN SOLILOQUY. 1911. T was a beautiful night, such as is seldom seen, even in the warm summer months, in the valley of the majestic Susquehanna. The sun had set over an hour ago with a clear sky and the western horizon, formed by the dis-tant mountain tops, was still a shade brighter than the rest of the heavenly dome. Not a zephyr was stirring, not even on tha bosom of the broad river, whose surface was as calm and placid as a sea of glass. One by one the stars were beginning to peep from the heavens and smile upon the drowsy earth. Far away in the east, over the top of the mountain like a great silver ball sus-pended from the lofty home of the gods, hung the moon in all her beauty, shedding upon the earth a soft mellow light. To add to the beauty of the scene, far to the north could be heard the soft rippling of the stream, as it rushed between the rocks at the falls. The water-gods seemed to be doing their best to excel all na-ture, and to the ear of the silent listener, the noise of the waters bore something of the divine in nature. Such was the scene be- 26 THE MERCURY. fore Splashing Water as he lay upon the ground, before the old wigwam. Splashing Water was the son of the chief of the Wiconisco In-dians. Long ago his father's braves had intruded upon the hunt-ing grounds of the great Susquehannas, who claimed all the land bordering upon the great river which still bears their name. The Susquehannas resented the intrusion, but Splashing Water's father, after counselling with all his warriors, decided to make good his claim with the arrow and the tomahawk. Preparations for war were made and one dark night when all was ready, the Wiconisco braves stole forth from their camp to meet the Susque-hannas in deadly conflict. Early in the morning, long before the face of the Great Spirit began to light up the eastern sky, the battle was fought. The Wiconiscos were defeated. Twenty of their braves fell by the arrows of the enemy, but by far the great-est loss to the whole tribe was that of Splashing Water. Splash-ing Water, the pride of the camp, was captured and taken far away to the great camp of the Susquehannas on the Island of the Bald Eagle. That was many moons ago and tonight as he lay before the wigwam of his guard, he pictured to himself the sight of his father's camp. "It is true," thought he, "this camp is much bigger and this tribe is much stronger than my father's, and then too, they have the Great Eiver, but still I would rather be home on the great mountain." "What are they doing at home," he wondered, "perhaps they are planning how to come and free me from these awful men." He then pictured his father's camp. There were the wigwams of the braves arranged in order around the clear, cool spring and the great trees casting their soft shadows over the ground. There were the camp-fires, just dying out and around them lay the forms of many sleeping warriors. "How fine it would be to be there," thought he. Here he glanced around and noticed that the fires of his cap-tors were also dying out. Here and there among the wigwams the form of a dusky warrior moved about, but otherwise all was quiet, responding to the beautiful night the Great Spirit had given. "A little longer," thought Splashing Water," and they will all be asleep. Then why can't I escape?" He decided to THE MERCURY. 27 wait, for he saw that his guard, who was lying near him, was be-ginning to doze. In about an hour everything was quiet. Not a moving figure could be seen, and Splashing Water decided that now was the time to make a dash for home. Cautiously raising himself, he crept to the entrance of his guard's wigwam. All was still within. He crept a few steps farther and felt about for the bow and quiver of his guard. He grasped the bow in his hand and quietly hung the quiver over his shoulder. Peering out of the entrance, he made sure that the track was clear, then slowly crept forth in the direction of the shore, stopping every few paces, and straining every nerve to hear the faintest sound of alarm. But not a sound did he hear. Finally he arrived in the clump of willow trees overhang-ing the shore, under whose protection the bark canoes of his cap-tors were moored. Quietly creeping into the nearest one he grasped a pole and gently pushed it from the shore. When the boat was far enough from shore to be controlled by the current, he lay flat on the bottom of it and allowed it to drift down stream, in order that he might not make the least noise. When he had drifted for some time, he arose to his feet, grasped the pole and pushed the frail canoe to the shore with great speed. "Good-bye to the Island of the Bald Eagle," thought Splashing Water as he leaped upon the shore and plunged forward under cover of the thick forest. He traveled all night, and at the first signs of dawn drew near to the camp of his father. Great was the rejoicing as the fires of the tribe were kindled, amid the talk and laughter of the braves and squaws, when into the camp strode the athletic form of Splashing Water, the pride of the Wiconiscos. I H E HE RC U RV Entered at the Postoffice at Gettysburg as second-class Matter. VOL. XVII GETTYSBURG, PA., OCTOBER, 1909 No. 5 Editor in-Chief SAMUEL FAUSOLD, 'IO. Exchange Editor G. E. BOWERSOX, 'io Business Manager PAUL S. MILLER, 'IO Ass't Bus. Managers ROY R. ALLEN, 'II RUFUS N. WENRICK, 'II Assistant Editor RALPH E. RUDISILL, 'IO Associate Editors E. J. BOWMAN, 'II C. M. DAVIS, 'II Advisory Board PROF. G. F. SANDERS, A. M. PROF. P. M. BIKLE, PH. D. PROF. C. J. GRIMM, PH. D. Published each month, from October to June inclusive, by the joint literary Societies of Pennsylvania (Gettysburg) College. Subscription price, one dollar a year in advance ; single copies 15 cents. Notice to discontinue sending THE MERCURY to any address must be ac-companied by all arrearages. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE MERCURY, GETTYSBURG, PA. EDITORIALS. IN this, the first number of the MEBCUEY, since the opening of college, we take the opportunity of impressing upon the student body the importance of the liter-ary societies. The literary so-cieties hold out to every man at Gettysburg a golden opportunity for self-development. True it is, the class room is the place for in-tellectual training, but the liter-ary societies are a most useful adjunct for the training of a dif- THE MERCURY. ferent sort, though of no less importance, is here received. No col-lege man who cannot express his thoughts to the best possible advantage, measures up to the standard which the world sets up for him. To meet this demand for correct expression of thought is the purpose of the literary societies. For certain reasons, how-ever, during the past year, the college community has been very indifferent to literary work. The various phases of college life were emphasized to such a degree, that apparently the work of the societies was excluded and consequently literary spirit was very low. Now at the opening of the new collegiate year let us firmly resolve that this shall not be the case in the future. Let us go to work and strive to raise the standard up to its old mark. To the new men, we would say, join a literary society early in your course. We do not presume to dictate which society you should join. Each one of the societies needs you, and your so-ciety will be for you just what you help to make it. But what-ever else you do, join one of the literary societies. However, when you have joined, fall to work. No society will do you any good whatever, unless you work for it. Let us all, both old men and new, work for the glory of Phrena and Philo and strive to make this a banner year in literary work at Gettysburg. IT is a terrible thought that the "very glory of our civilization is the danger of our times." In the utilization of all the agencies of nature in every line of development, in the multiplication of the sources of wealth and prosperity, this country is unparalleled, and yet every element of progress carries with it the agencies of destruction. Along with the best of benefits march dangerous evils. For "vice and immorality sweep over this land like black clouds." Simply turn to the politicians of New York and we see them attacking the Governor, thus making it hard for young men to do right and easy for them to do wrong. After we have been launched into the world to win our way as best we can, the State takes no further action than to provide for a policeman to arrest us if we go astray. And then there is before us the saloon, pool-room and gambling den to invite us as participants. We have to but ask ourselves, how many men have fallen to such a degradation and answer by referring to Sing Sing where 30 THE MERCURY. seventy per cent, of the prisoners are college and university grad-uates. Why have such men of splendid opportunities fallen to such a state? We find it is because they have never endeavored to cultivate their morals or to strive for manliness. It seems to be the tendency of college men to be pusillanimous and discourage rather than encourage the aspirants to an exalted character, to taunt him with assertions hard for a sensitive boy to bear, as to his rusticity and state of being unsophisticated. How often does one learn too late that liberty with friends causes ruin, that in-dulgence is only to burst the restraints of the Ten Command-ments, the Golden Eule and the teachings of home. In this day of twentieth century hustle—in this CULTURE age Qj! fgygj-igh haste, culture has trouble to hold its own. Culture which means a liberal education, broad-minded-ness and refinement, is rivalled by our modern all-pervading lust for gold. Disregarding morality and final destin\r, what shall you do? Shall you spend your life in hot pursuit of the almighty dollar or seek those indefinable yet so easily recognized qualities, the sum total of which constitutes culture. This is the question so often confronting the young man just out of High School. He necessarily ponders, "Shall I take a purely technical course preparing me for one line of work or shall I take a general college course with the view of developing the all-around man. The temptation to follow the first alternative is hard to over-come. This fact is exemplified in men in the business world who are experts in their own departments of work, yet are lamentably ignorant as to all other subjects. These men do not have a true sense of values. They do not have the right perspective of life. They too often spend their whole lives in the pursuit of dollars for the dollar's sake and cannot enjoy what we call the higher things, because of lack of culture. As an illustration, these one-sided men can not enjoy music because they do not understand music. This fact fortifies the truism that a man gets out of a thing what he puts in it. TUP: MERCURY. 31 A man should be true to himself. If a man is true to himself, he will find time to develop his aesthetic and moral natures. Thus he can enjoy life in the full and besides the busy hours spent in attaining a livelihood can snatch a few moments from his busy life to enjoy nature and all her beauties. No matter what your profession will be, build upon the solid foundation of a collegiate course. This will insure knowledge, efficiency and cul-ture. DON'T forget the Bloomhardt literary prizes to be awarded next spring. These prizes will be awarded on the basis of literary merit. Get busy! Use your literary talent. Thus help your-self and immediately help us retain the high standard of the MERCURY. STUDENTS patronize our advertisers! The MERCURY adver-tisers are friends of the college and of you. Show your appre-ciation by helping them, even as they help us. A BOOK REVIEWS. HE Testing of Diana Mallory, by Mrs. Humphrey Ward. —Philo. Here is an interesting picture of English life. The authoress depicts the political and social life of England as few novelists can. We are led by easy stages to a realization of England's greatness as an empire and learn something of the domestic problems which concern her. To be sure, a love tale is the binding thread of the story. Diana Mallory is a true heroine. We love her from start to finish— sympathize with her in her troubles and rejoice with her in her joys. The other characters of the story are representative of every phase of English life. The Englishman in his favorite past-time—hunting—is seen hot on the chase and the parliamen-tarian playing with might and main the uncertain but always in- 32 THE MERCURY. teresting game of politics engages our rapt attention. Incident-ally we are given a picture of beautiful Italy and interesting glimpses of India and other parts of the world are obtained. The Diva's Ruby, by P. Marion Crawford. . Philo-—is a narra-tion of the winning of Diva, an English primadonna, by Win. Van Torp, an American cowboy millionaire. The scene is laid chiefly upon the continent and in London. However we are first introduced to a little Tartar city in Central Asia from which comes the ruby which gives the book its title. The book portrays the moving of that master passion, love, showing the terrible con-flict which takes place in the hearts of both men and women, the conflict between true love and the obligations of honor. The characters are of a high type except where the oriental thirst for revenge betrays itself in the person of Baraka. The plot is com-plex in that it centers about three characters instead of the or-dinary one or two. The style is clear but retarded by unimport-ant details. Moreover the language used by the various charac-ters is not altogether in harmony with themselves as the writer portrays them. We find very little difference between the con-versation of the learned Greek scholar, Logotheti, and the rough, uncultured American financier, Van Torp. All things consid-ered, it deserves to stand among the modern works of fiction. PATRONIZE OUR ADVERTISERS. I•N this Drama of Tour Year's Course, Play your part without dad's horse ; This to do is up to you With just a little tact between each yearly act, In some domain take a stroll And sell ALUMINUM for next year's Role (roll). Every summer hundreds of students raake BIG MONEY selling Aluminum Cooking Uteusils. For particulars address LOUIS HETZEL, Gettysburg College, GETTVSBURB, PA. THE STEWART & STEEN CO., COLLEGE ENGRAVERS, 1024 Arch Street, PHILADELPHIA. MAKERS OF INVITATIONS, PROGRAMS, MENUS, VISITING CARDS, DANCE CARDS, MONOGRAMS, CLASS AND FRATERNITY STATIONERY. P. S. MILLER, 'TO, Representative, Who has a full line of samples. kl^H, EDUCATION The times an 1 the Schools demand that the best things shall be done and in the best manner. Watermans@)FountamPen accomplishes everything that can be required of a good writing in-strument. Made to last for years of service and give its owner the satisfaction which comes with owning "the best." W From all dealers. The Globe trade-mark is our guarantee *~—^-^ school SI. Bo.lon 209 Sl.lc Si ChU."> Q V 742 Morkel Si-. San Franci*co. 1.10 5t. Jemci Si. Montreal 12 Cold«n L*n«. London GR. do Hono^-e Paris PATRONIZE OUR ADVERTISERS. FUfJJVTTU^E Mattresses, Bed Springs, Iron Beds, Picture Frames, Repair Work done promptly. Under-taking a specialty. - Telephone No. 97. H. B. BENDER. 37 Baltimore Street, Gettysburg, Pa EDGAR C. TAWNEY BAKER West Middle Street. J. B. WINEMAN, DEALER IN CHOICE FAMILY GROCERIES, PROVISIONS AND FRUITS, BOARDING CLUBS A SPECIALTY. L. WEIGAND, DEALER IN FRESH AND CURED MEATS OF ALL KINDS-Boarding Clubs a Specialty. Sou^p's f^estaupant, No. 7 Chambersburg Street. J PATRONIZE OUR ADVERTISERS. EMIL ZOTHE, College Emblems, Engraver, Designer and Manufacturing Jeweler, 722 Chestnut St, Philadelphia. Specialties: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, Stick Pins and Athletic Prizes. All Goods ordered through G. F. Kieffer. Charles S. Mumper, DEADER IN FURNITURE, PICTURE FRAMES OF ALL SORTS REPAIR WORK DONE PROMPTLY I will also BUY or EXCHANGE any SECOND-HAND FURNITURE No. 4 Chambersburg street, Gettysburg, Pa. OHLER BRO.'S RESTAURANT, First National Bank Bld'g. The place to eat the best Ice Cream. QUICK LUNCH and Oysters in season. D. J. Swartz, DEALER IN COUNTRY PRODUCE, GROCERIES, CIGARS AND TOBACCO. GETTYSBURG. J. i MUMPER Your Photographer, If not, why not? 41 Baltimore St., Gettysburg. FLEMMING X BAIR'S LIVERY, Baltimore Street, First Square, Gettysburg-, Pa. Competent Guides for all parts of the Battlefield. Arrange-ments by telegram or letter. Lock Bock 257. PATRONIZE OUR ADVERTISERS. WINDSOR HOTEL, W. T. BEDBAKEE, Manager. Midway between Broad St. Station and Beading Terminal on Filbert St. A convenient and homelike place to stay while in the city shopping. An excellent restaurant where good service combines with low prices. BOOMS $1.00 PEE DAY AND UP. The only moderate priced hotel of reputation and consequence in PHILADELPHIA. The Modern Steam Laundry . . OF YORK . . Offers the COLLEGE STUDENTS first-class work at Special Low Prices. E. C. STOUPFER, Local Agt. C. D. SMITH, Prop. The Baltimore Medical College Preliminary Fall Course begins September ist. Regular Winter Course begins September 20th. Liberal teaching facilities ; Modern college buildings ; Comfortable lecture hall and amphitheatres ; Large and complete equipped laboratories; Capacious hospital and dispensary; Lying-in department for teaching clinical obstetrics ; Large clinics. Send for catalogue. Address DAVID STREETT, M. D., Dean, N. E. Cor. Madison St., and Linden Ave., Baltimore, Md. COMPILER IMPRINT ON JOB WORK MEANS TASTY WORK CAREFULLY DONE. MENU CARDS WINDOW POSTERS LETTER HEADS ENVELOPES DANCE CARDS TICKETS Programs of all kinds. Everything the College Man wants in Paper and Ink. Specially designed work. Latest Effects in Paper, done in Colors along lines of College Men's Associations. Catalog and Book work. The Gettysbutg Compiler will keep old and new students in touch with town and college life.
The Mercury April, 1909 HELP THOSE WHO HELP US. The Intercollegiate Bureau of Academic Costume. Cotrell & Leonard, ALBANY, N. Y. Makers of CAPS AND GOWNS To Gettysburg College, Lafayette, Lebigh. Diokinson, State College, Univ. of Penn sylvanin, Harvard, Yale, Princeton, Wellealey, Bryn Mawr and the others. Class Contracts a Specialty. Correct Hoods x Degrees The College Man's Opportunity. We offer the Surest Means of finding your right place. Hundreds of good positions open in business, in teaching and in technical work. Offices in 12 cities. Write us to-day. THK J\mJtTIOJ\"Al, ORGJJYMZJITtOJV OJt BIlJIMjy BKOJKER8. Commonwealth Trust Building, Philadelphia, Pa. HOTEL GETTYSBURG, Headquarters for BANQUETS. Electric Lights, Steam Heat, All Conveniences. Free Bus to and from station. Convenient for Commencement Visitors. RATES $2.00 PER DAY. £vvery CL'biac'h.ecL Job,ii P. fcfatftity Proprietor. L ETREILINO Successor to BKCKER & Co,, DEALERS IN All kinds of Fresh and Smoked Meats Chambersburg St., Gettysburg, Pa. nGETTYSBURG COLLEGE Gettysburg, Pa. LIBRARY WE RECOMMEND THESE FIRMS. Established 1S67 by Allen Walton. ALLEN K. WALTON, Pres. and Treas. ROBT. J. WALTON, Supt. HUMMELSTOWN BROWN STONE COMPANY QUARRYMEN and Manufacturers of BUILDING STONE, SAWED FLAGGING and TILE. Waltonville, Dauphin Co., Pa. CONTRACTORS FOR ALL KINDS OF CUT STONE WORK. Te egrapb and Express Address, Brownstone, Pa. Parties visit ing quarrjes will leave cars at Brownstone Station on the P. & R. R. R. For Artistic Photographs —GO TO T{PTOJ\[ The Leader in PHOTO FASHIONS Frames and Passapartouts Made to Order. D. J. REILE, Clothing, Gent's Furnishings Sole Agent for the CRAWFORD SHOES, 13-15 Ohambersburj* St. Come and Have a Good Shave or Hair Cut —AT— HARRY B. SEFTON'S BARBER SHOP 35 Baltimore St. Barber's Supplies a Specialty. Also choice line of Cigars. Shoes Repaired CHAS. HARTDAGEN, Middle St., Opp. Court House, GUARANTEE ALL WORK TIE GETTYSBURG DEPARTMENT STOR Successors to the L- M. Alleman Hardware Co., Manufacturer's Agent and Jobber of HARDWARE, OILS, PAINTS AND OUEENSWARE, GETTYSBURG, PA~ The only Jobbing House in Adams County. PATRONIZE OUR ADVERTISERS. fcftftaa *««»»»»*«»* 6»ftiR.?s5ft*««ft»ftftftSt»a#aaaaftaaaff ft « » ft ft it « ft f«t ft St a *»* ft ft a** « aa*a* a * «»»« »« »a !» ft ft ft ft « « ft « ft •5 fftt ft ft ft » * SelLgjmc)1! ARE GETTYSBURG'S MOST RELIABLE And show their appreciation of your patronage by giving you full value for your money, and closest attention to the wants of every customer. »*« ft ft ft ft ft ft f«t ft « ft « ft ft ft ft • ft ft ft ft fftt a» « ft « « » ft « ft « «« »« «a *a« a« » * Give Them * » aa« « a a ft »* « **•****• e&ft'>r-$««ft0 *»#«».£« «stft* aafta«ft$$a* A « »«*«#» Your Patronage PATRONIZE OUR ADVERTISERS. KS'friftKsfetygjifrsiSi'gsj'g!^.^ A Special Proposition Is open for the first person ID au> com-munity who will deal with us for a Piano or Organ. WEAVER ORGANS AND PIANOS have no question mark to the quality. ■a I* MAIL THIS COUPON TO OS. Send me special proposition for the purchase of a Piano. Name Address_ WEAVER OR". *N AND PIANO CO., MANUFACTURERS, YORK, PA , U S A. KiKiKiKiKii^
