Suchergebnisse

Issue 28.6 of the Review for Religious, 1969. ; EDITOR R. F. Smith, S.J. ASSOCIATE EDITORS Everett A. Diederich, S.J. Augustine G. Ellard. S.J. ASSISTANT EDITOR John L. Treloar, S.J. QUESTIONS AND ANSWERS EDITOR Joseph F. Gallen, S.J. Correspondence with the editor, the associate editors, and the assistant editor,.as well as books for review, should be sent to I~VIEW FOR RELIGIOUS; 612 Humboldt Building; 539 North Grand Boulevard; Saint Louis, Missouri 631o3. Questions for answering should be sent to Joseph F. Gallen, S.J.; St. Joseph's Church; 32~ Willings Alley; Philadelphia, Pennsylvania + + + REVIEW FOR RELIGIOUS Edited with ecclesiastical approval by faculty members of the School of Dt, imty of Saint Louis University, the editorial offices being located at 612 Humboldt Building, .539 North Grand Boulevard, Saint Lores, Missouri 63103. Owned by the Missouri Province Edu-cational Institute. Published bimonthly and copyright (~) 1969by REVIEW FOg REmnlous at 428 East Preston Street; Baltimore, Mary-land 21202. Printed in U.S.A. Second class postage paid at Baltimore, Maryland and at additional mailing offices. Single copies: $1.00. Subscription U.S.A. and Canada: $5.00 a year, $9.00 for two years; other countries: $.5.50 a year, $10.00 for two years. Orders should indicate whether they are for new or renewal subscriptions and should be accompanied by check or money order paya-ble to REVIEW FOR RELIGIOUS in U.S.A. currency only. Pay no money to persons claiming to represent REVIEW FOR RELIGIOUS. Change of address requests should include former address. Renewals and new subscriptions, where accom-panied by a remittance, should be sent to REVIEW FOR RELIGIOUS; P. O. BOX 671; Baltimore, Maryland 21203. Changes of address, business correspondence, and orders not accompanied by a remittance should be sent to REVIEW RELIGIOUS ; 428 East Preston Street; Baltimore, Maryland 21202. Manuscripts, editorial cor-respondence, and books for review should be sent to REVIEW FOR RELIGIOUS; 612 Humboldt Building; 539 North Grand Boulevard; Saint Louis, Missouri 63103. Questions for answering should be sent to the address of the Questions and Answers editor. NOVEMBER 1969 VOLUME 28 NUMBER 6 BROTHERS THOMAS MORE, C.F.X:, AND LEO RYAN, C.S.V. Development: A New Challenge to Religious In a majority of the articles written these days in religious journals, the emphasis has been largely on areas which are of great concern for those seeking ways to achieve renewal and adaptation in the religious life. As a result, new and valuable insights have been gained in such areas as government, the evangelical counsels, prayer, community, personal responsibility, the aposto-late, secularization, and formation. There is, however, one significant movement which has yet to be fully treated in journals written for re-ligious. And because this movement could elicit from the religious families in the Church a response corre-sponding to that which characterized the great move-ments in the past, we want to draw the attention of religious to this phenomenon so that it" can become a + growing part of the literature on renewal and adapta- + tion. This movement can best be described as development. Because development is still more or less in its infancy stage, only gradually emerging into a full-blown move-ment in society and in the Church, it is not our in-tention to give here a definition of the term. Instead, we want to describe a number of events and programs which will illustrate not only the potential dynamism of de-velopment but also the implications which it has for religious institutes. On January 6, 1967, Paul VI issued the motu proprio Catholicam Christi Ecclesiam setting up the Pontifical Justice and Peace Commission. The objective of this Commission would be "to arouse the people of God to 869 Thomas More, C.F.X., is superior general of the Xa-verian Brother~; Antonio Bosio 5; 00161 Rome, Italy. Leo Ryan, C.$.V., is general councilor of the Viatorian Fath-ers and Brothers; Via Sierra Nevada 60; 00144 Rome, Italy. VOLUME 2B, 1969 + 4. 4. Brothers More and Ryan REVIEW FOR RELIGIOUS full awareness of its mission at the present time, in order on the one hand, to promote the progress of poor nations and encourage international social justice, and on the other, to help underdeveloped nations to work for their own development." 1 Shortly after establishing this new curial organ, Paul VI issued his famous encyclical, Populorum progressio, which is the charter of the Pontifical Commission and its basic text. The call of the encyclical is to all the Church, which is to be educated, stimulated, and in-spired to action by it. Cardinal Maurice Gilroy of Quebec, president of the Pontifical Commission, and Monsignor Joseph Gremil-lion, its secretary, set about the arduous task of travel-ing throughout the world to create national commis-sions for justice and peace witkin bishops' corr[erences. After this work had been completed, the commission turned to the Union of Superiors General in Rome to solicit its support. Monsignor Joseph Gremillion per-sonally addressed the Union, urging it to establish con-tact with the Commission and to take an active role in the promotion of the aims of development within all the religious families of the Church. in May, 1968, the Union unanimously approved the writers of this article as its official liaison with the Pontifical Commis-sion. Now that the liaison committee has been in existence for one year, it is in a position to discern a number of trends which indicate the response religious institutes will make to development in the immediate future. The remainder of this paper will be devoted to an elabora-tion of these trends and a brief description of the more important programs from which these trends have is-sued. At the present time we see four trends in development which have significant implications for religious insti-tutes. It is very dear now that development has an ecumenical character. Second, because of the nature of development, religious institutes will be looking for- 1Father. Arthur McCormack makes the following clarification: "The name Justice and Peace must be understood in the following way: Justice means social justice within and between nations so that every human being should have conditions of life in keeping with his human dignity, which will enable him to progress towards a fully human development--to the fullness of a more abundant life~ and enable him also to make his contribution to building a new and better world. Peace is to be understood, not in the sense of main-raining peace or working for peace in the political or diplomatic sense, but in the sense of building peace--the new name for peace is development--producing the conditions that are fundamental for peace, a more just, humane, better world in accordance with para. 76 of the Encyclical, Populorum Progressio" ("The Pontifical Com-mission Justice and Peace," World Justice, v. 8 (1967), pp. 435-55). ward to training specialists in planning, sociology, tech-nology, and social justice. Towards this end, some re-ligious institutes are establishing within their general administration a secretariat for development, Third, there is a growing spirit of collaboration within re-ligious institutes, since it is evident that no religious family can tackle the problems with its own resources. Finally, there is a search for a new theology of develop-ment. 1. Ecumenical Character oI Development In the spring of 1968, the Pontifical Commission of Justice and Peace, the Catholic .Rural Life Society, under the direction of Monsignor Luigi Liguitti, SEDOS, FERES, and ISS2 sponsored a two-day seminar on the Church in developing countries at the theologate of the Oblates of Mary, Rome. This seminar was arranged specifically for superiors general and their curias to acquaint them with development. However, interest in the meeting was so great that it turned out to be a cross-section of some of the most important European bodies having a Third World orientation. At the meet-ing were representatives from several Roman Congrega-tions, the German mission-sponsoring agencies Adveniat and Misereor, Caritas Internationalis, Protestant ~6b-servers, sociologists, and a number of developing organi-zations from Italy, France, Germany, Belgium, and Hol-land. The Catholic-Protestant team under the direction of Canon Houtart (FERES) and Professor Egbert de Vries (ISS) gave the audience a report of their three-year Ford-funded study of the Churches' work in the four developing countries of India, Brazil, Indonesia, and the Cameroons, in the areas of education, medicine, and social work.3 But of far greater importance than any of the socio-logical findings of the three-year study of FERES-ISS was the ecumenical character of the study and the seminar. The meeting was tangible evidence of the growing spirit of collaboration between the Catholic Church and the World Council of Churches, especially in an area which was once the most sensitive one in ~SEDOS (Servizio di Documentazione e Studi) is a cooperative documentation and research venture on the part of about thirty superiors general in Rome. FERES (Federation Internationale des Instituts Catholiques de Recherches Socio-religieuses) is the inter-nationally well-known research center in Brussels. ISS (Institute for Social Studies) is the Protestant counterpart of FERES and is lo-cated at The Hague. 8 A report of this seminar has been published by SEDOS under the title, The Church in Developing Countries;.Via dei Verbiti, 1; Rome, Italy. ÷ ÷ Development VOLUME 28, 1969 871 4" 4" Brothers More and Ryan REVIEW FOR RELIGIOUS the past--the developing countries. It is not surprising, then, that one of the most important conclusions ac-cepted by the superiors general was that cooperation between the different denominations be extended. Moving quickly from theory to action, the superiors general of several congregations devoted to medicine shortly after the seminar entered into discussions with the Christian Medical Commission, a semi-auton-omous organism related to the World Council of Churches. As a result of a number of meetings between Mr. J. McGilvray of the Executive Committee of the CMC, Geneva, and these religious congregations, the CMC Executive Committee reached the important con-sensus this past March that five Roman Catholic con-sultants would be appointed to the Commission after nomination by the Secretariat for the Promotion of Christian Unity. These consultants were present at the Commission's general assembly in August of this year. A third example of ecumenical cooperation in de-velopment is of far greater significance, since it was mounted on a larger international stage. In 1967 the World Council of Churches and the Pontifical Commission of Justice and Peace formed the E~ploratory Committee on Society, Development and Peace (SODEPAX) as an experimental instrument for ecumenical collaboration. Father George H. Dunne, S.J., formerly of Georgetown University, was appointed by Dr. Eugene Carson Blake and Cardinal Maurice Roy as joint secretary of this committee. SODEPAX held a conference in April, 1968 on world cooperation for development in Beirut, Lebanon, to which it invited sixty specialists from all over the world. The participants were Protestants, Orthodox, Catholics, observer-consultants from intergovernmen-tal bodies, and two participants from the Muslim com-munity of Lebanon.4 The conference was the first attempt on the part of the World Council of Churches and the Roman Catholic Church to jointly study and plan the involve-ment of the Christian bodies for the betterment of society. It is a concrete example of the way churches will unite their moral forces towards achieving human dig-nity and world peace. One of the conclusions of the meeting states this objective in terms which make an appeal to all religious: This Report has suggested many ways in which the Churches, acting together, can foster development programs both in ¯ A report of this conference has been published under the title, World Development, the Challenge to the Churches; Publications Department; The Ecumenical Center; 150 Route de Ferney; Geneva, Switzerland. the advanced and developing countries. Joint action for de-velopment will serve basic Christian aims. To work for devel-opment is to express in particular measures the aspiration for brotherhood and human dignity for every individual. And it can also be a significant contribution toward a more orderly and peaceful world. Development can gradually reduce the gross imbalances which promote instability; working together can encourage a wider sense of community among mankind; and the strengthening of international agencies will create structures for common effort and order. These three examples of ecumenical collaboration in the field of development are growing evidences of the need for all religious institutes to work together with other Christian bodies to concert their actions for play-ing their part in the long task of building a more stable international order of well-being and peace for the whole human family. This ecumenical spirit should be built into the thinking and planning of general and provincial chapters, constitutions, formation programs, and the apostolic work of religious families. It should also be the concern of national conferences of re-ligious institutes. The work is of too vast proportions to be left to the interest of those few religious who have up until now been involved in development. 2. Specialists and International Vocation The second trend in development in religious com-munities is the deployment of personnel to act as specialists in the Third World, along with the estab-lishment within general curias of a secretariat for de-velopment. Shortly after the seminar on the Church in develop-ing countries, Misereor approached the superiors general with an offer to provide funds for the training of some specialists who would assist bishops' conferences in de-veloping countries in setting up offices of trained experts in planning. The offer came as a result of the dis-cussions at the seminar concerning the lack of the skills of planning for the proper deployment of dwin-dling personnel, the retooling of personnel for meeting the new needs of the day, and the necessity for co-operating with governments in national planning. The time had come, it was agreed, for religious com-munities to become deeply involved in this modern approach and to train experts who would have com-petency as well as apostolic zeal. After many months of discussions with the superiors general, Misereor agreed early this year to provide funds for the training of highly qualified development experts for the countries of Indonesia, East Africa, and the Congo. Other countries would be added as the pool of experts becomes larger. As the agreement was finally 4, 4, Development VOLUME 28, 1969 873 Brothers More ¯ and Ryan REVIEW FOR ~ELIGIOUS worked out, the funds are in the form of a scholarship for 'the trairiing of experts in the fields of social ac-tion, science, communication, cooperatives, trade unions, medicine, agriculture, and technology. These experts would be seconded to central advisory and coordinat-ing bodies in the selected countries and would devote themselves specifically to the analysis of the problems, the planning of a strategy, and the coordination of pro-grams with national planning. This new type of service would be rendered by the religious ~ommunities only at the invitation of interested bishops' conferences of one of the three countries. This proposal clearly indicates that as the religious communities become more involved in social action, they will need more experts in this field. It also be-comes increasingly clear that religious congregations will now turn their efforts towards promoting and edu-cating a corps of highly qualified men and women who will act not for their individual communities alone but in teams for ihe good o[ society. This task force con-cept of highly competent religious from different in-stitutes could be the most dramatic response of religious congregations to the challenges provided in the Third World. From what we have just said, it is evident that re-ligious will have to respond more promptly and in-telligently to what we would call the apostolate of internationalism. To act as specialists in the Third World, to become globally involved in development, re-llgious will be entering more actively into what Barbara Ward calls our planetary community, a community which. cuts across all the lines and barriers of nations and races. In such a community, religious ought to feel very much at home, especially since the vision of all founders of religious communities extended beyond the hori-zons of a particular country or culture. That spirit which inspired founders to send their men and women to meet the needs of mankind in all parts of the world must now impel their followers to send trained and competent personnel to participate in international bodies which are working to achieve the humaniza-tion' of mankind. This apostolic thrust could be as dramatic and far-reaching as the missionary journey of Francis Xavier to the Indies. There are a number of religious currently engaged in this international apostblate. Those we have met or know of are: Father John Schutte, S.V.D., who was recently appointed by Pope Paul as assistant to Mon-signor Joseph Gremillion, Secretary of the Pontifical Commission of Justice and Peace; Father Arthur Mc- Cormack, M.H.M., special consultant to the same Com-mission; Father Philip Land, S.J., Gregorian University, Rome; Father George H. Dunne, s.J., SODEPAX Joint Secretary, Geneva; Father Thomas F. Stransky, C.S.P., Secretariat for Promotion of Christian Unity; Mother Jane Gates, Superior General of the Medical Missionary Sisters, who is working with the World Council of Churches in the field of medicine; and Father Theodore M. Hesburgh, C.S.C. The first indication we have of a religious institute becoming serious about development and the promo-tion of the international apostolate is the derision of Father Pedro Arrupe, superior general of the Jesuits, to establish a secretariat for development within the curia of his general administration. Father Francis Ivern has been appointed by Father Arrupe to head this secretariat. Similar offices could be set up in many of the larger congregations of men and women. In the case of smaller units, it is quite possible that interested and competent religious could be, as a matter of policy, trained to take their place in general curias. Others could be as-signed to work on task forces, national bishops' con-ferences, international or national research centers, na-tional conferences of religious, and the pontifical or the national conferences of justice and peace. 3. Spirit of Collaboration It is quite evident from what has been said above that there is growing within religious congregations and institutes a greater spirit of collaboration to make the response called for by Populorum progressio and the objectives of the Pontifical Commission of Justice and Peace. Since the work of development is of such gigantic proportions, no one rellgious institute can unilaterally plan its involvement in it. No one individual religious, or even a cadre of them, can shoulder the heavy re-sponsibility of this new apostolate. It must be the work of all religious, or the efforts for the humanization of mankind will be considerably weakened. One model of collaboration already exists in Rome. It is an organization to which we have already re-ferred many times, namely, SEDOS. This voluntary organization of a number of superiors general, formed only six years ago on the initiative of a few missionary congregations, has in a short time given proof of the results that can flow ~om the spirit of collaboration. Within a span of just one year, for imtance, SEDOS has held a seminar on development, a symposium on the theology of development and mission, and a con-÷ ÷ ÷ Developme~ VOLUME 28, 1969 875 Brotmheurl s. RM~oarne REVIEW FOR.RELIGIOUS terence on intermediate technology. As noted already, it has worked out an agreement with Misereor to finance the education of a number of specialists for developing countries. It is also actively engaged in es-tablishing guidelines for a mutual exchange of ideas between the World Council of Churches and medical missionary congregations in the field of medicine. SEDOS is unique in a number of ways. Its member-ship consists of both men and women religious. Its ex-ecutive secretary is Father Benjamin Tonna, a secular priest from Malta, who is a professional sociologist. The director is Miss Joan Overboss, a multilingual expert from Holland. But its uniqueness lies principally in its spirit of co-operation among the superiors general in facing the new problems evolving from the Third World. Since there was no structure among religious institutes or in any Roman curial congregation to help religious fami-lies prepare themselves for their involvement in the work of development, superiors general united their forces to establish a documentation and research center which would enable them to convert from a family business to a modern and efficient concern. Thus, for the first time in the Church's history, religious congre-gations have banded together at the highest level to make their contribution in an area in which the Church in recent years has focused its principal at-tention. This same spirit of collaboration is evident in such countries as the Congo and Indonesia, where religious are working together with bishops' conferences in es-tablishing planning secretariats. Quite recently we read an appeal by the East African conference of religious to its membership to turn itself to the question of de-velopment and to form a task force that would assist the bishops' conferences in establishing a secretariat for development. If religious congregations are to involve themselves in this apostolate, this spirit of cooperation must con-tinue to grow. Many religious want to see their in-stitutes take decisive measures to execute the social objectives of Populorum progressio and to work actively to achieve the goals of the Pontifical Commission of Justice and Peace. The younger generation of religious also want to become actively engaged in working to create conditions within and between nations that are in keeping with the human dignity of man. But they need some concrete programs to give them direction. As a step towards establishing some programs, con-ferences of religious and individual institutes could give attention to the following suggestions made by the Pontifical Commission of Justice and Peace at the end of its first plenary meeting of March, 1967: 1. That Bishops' Conferences, teaching orders and all those concerned with education should be encouraged to include the teaching of international social justice in the curricula of schools, seminaries, universities and all institutions of learn-ing. 2. That retreats, sermons and specifically religious instruc-tion should emphasize the discussion of world justice, ~. That such curricula should be, where possible and suit-able, worked out on an ecumenical basis. 4. That competent study groups, again when suitable on an ecumenical basis, should continue the work of elaborating a doctrine of world-wide development and justice. 5. That lay groups of all kinds be invited to include world justice in their programs of adult education and, when com-petent to do so, assist the Commission in suggesting programs for the mass media. 4. A New Theology ot Development A concern very often expressed at the seminar on de-velopment alluded to above was that what was needed was an honest exchange of views on the theological foundation of development. In fact, one of the prin-cipal resolutions of the seminar asked the Congregation for Evangelization to put the theology of development on its agenda for its next meeting and for eventual presentation to the Holy Father as agenda for the next Synod of Bishops. Another resolution requested a sym-p. osium on mission and development. These two actions reveal that a theology of develop-ment has become a matter of urgency for religious. So long as the effort of missionaries was expended 'within the limits of a parish or a diocese, no special problem presented itself. But today the organization of develop-ment has become a much more complex affair; it has assumed the dimensions of whole nations, of entire continents, of the planetary community itself. While such a task calls for specialists, the ordinary missionaries run the danger of no longer seeing and understanding the role they are called on to play in the task of de-velopment. They stand, then, in perplexity when faced with the contradictory opinions of theologians. If some theolo-gians insist on the irreplaceable character of the proc-lamation of God's word and of the sacramental ministry, missionaries taken up with the tasks of development be-cause of the demands of the situations in which they find themselves and the concrete needs they daily encounter are troubled by an uneasy conscience. If other theologians stress the primary role of development, then those mis-sionaries whose tasks are those which belong to the more + + + Developmem VOLUME 28, Z969 8?7 traditional patterns of the apostolate begin to question the value of what they are doing. It was in response to this perplexity that the superiors general of SEDOS held a mission theology symposium in Rome this past April. Theologians from Europe and other parts of the world were invited to tackle this prob-lem first among themselves, and second in open discus-sions with the generals and their staffs.~ This symposium's importance lies in the fact that it has brought before religious congregations the theologi-cal dimensions of development, while adding to the growing literature on tlfis subject. This hard confronta-tion with the realities of development is a hopeful sign of growth within the Church and religious institutes. And instead of standing before the reality with perplex-ity and bewilderment, religious institutes, with their sense of global dedication, ought to be in the vanguard of working out a new theology of development. This mission theology symposium should set the pace for all religious families of the church. It has been our intention in this paper to draw the attention of religious to the phenomenon of develop-ment so that it can become a growing part of the litera-ture on renewal and adaptation. As a contribution to this literature on renewal, we have pointed out four major trends we have noted over the past year in the field of development as they affect religious institutes. The contribution religious can make to development, we are convinced, is enormous. The single attempts being made here and there must spring into a massive effort that will engage religious in a venture that has taken the center stage of the Church. If development is the new word for peace, it is a new challenge to religious. ~ Preparations are being made for the publication of the pro-ceedings of this symposium in various languages. The English edi-tion will be published by Maryknoll Publications. Brothers More and R~an REVIEW FOR RELIGIOUS JAMES A. CLARK Placing U. S. Personnel in Latin America Once a bishop or provincial decides to give manpower assistance to Latin America, he quickly discovers the dif-ficulties of attempting to find the wisest way to assign priests, brothers, or nuns to projects in Latin America. Since few authorities can agree on proper priorities for such placements, a superior is wise to recognize im-mediately that optimum, effective assignment of per-sonnel throughout Latin America represents an unat-tainable goal. In the past, assignment of American religious in the southern half of the hemisphere resulted from acciden-tal factors. The high ratio of Americans in Peru derived from the efforts of a zealous nuncio who welcomed them warmly. The large numbers of Americans in Guatemala result from a statistic that indicated that Guatemala had the worst proportion of priests to peo.ple of any Latin American country. Bewildered superiors anxious to respond to appeals of the Vatican to send missionaries to Latin America seized on this fact as a reason to send their subjects to Guatemala. Localized concentrations of Americans usually can be traced to a friendship begun at the Vatican Council between North and Latin Ameri-can Church leaders or through the bonds of a religious community existing in both halves of the hemisphere. The complexity of properly placing people in Latin America appears as a new problem because previously the allocating of workers to missionary lands did not require any accommodation with a structured Church in the foreign situation as is the case now in Latin America. One locale appeared as needy and worthwhile as another for apostolic laborers. The presence of a viable and strong Church in Latin America demands :extreme delicacy in interposing foreigners to serve that Church. Yet the need is so general and widespread in Latin America that from a spiritual point of view it has be- 4- ÷ James A. Clark is a staff member of the apostolic delegation at The Manor House in Rockcliffe Park; Oto tawa 2, Canada. VOLUME 28, 1969 879 come impossible for even the indigenous Church to ar-rive at a generally satisfactory set of realistic and valid preferences. Priorities which have aided in the distribution of financial grants are applicable in part to the appoint-ment of people even. though this latter commodity, people, raises mnch more profound questions since it is so much more precious and scarce in Latin America. This dilemma especially concerns diocesan priests be-cause the international 'religious communities already have a functioning system for distribution of their mem-bers. This arrangement, made under the auspices of the Holy See, has served for generations and enables provincials to provide staff for missionary areas without an agonizing analysis in each case. Those communities without Latin American branches and bishops entering the field for the first time find the subject distressingly difficult. The. Most Reverend Marcos McGrath, Second Vice- .President of the Bishops' Council for Latin America (GELAM), has encouraged even the religious communi-ties to refuse to cling to traditional apostolates and to become open to new forms of ministry: Priorities of needs in the churches of Latin America can be determined most effectively when undertaken by a national episcopal conference. Deciding who comes first is a difficult exercise in the spirit of collegiality because each bishop would like to see his diocese at the top of the list. But it is a necessary exercise and is of great assistance to those from abroad who want to know what the bishops as a whole think about the needs of their country. A listing of priorities may indeed be prepared, by a special committee named by the local bishops. Such an arrangement has been requested in some instances by various organizations of assistance. CELAM's continental sec-retariat of the Latin American bishops may indicate some gen-eral priorities of needs through its specialized departments. ÷ ÷ REVIEW FOR RELIGIOUS Several complex plans have been proposed to resolve the problem of placement. The secretariat of the U.S. Bishops' Committee for Latin America once devised a coordinating committee of ten expert advisers to counsel bishops on the proper method of allocating personnel for Latin America. However since the ten could not agree among themselves on how to achieve best results the committee never met and the plan died. The secretariat received requests from most of the ecclesiastical jurisdictions in Latin America (more than 600) and circulated these to bishops and superiors of religious houses. However, no attempt to provide criteria for selecting one petition over another ever appeared. Standard policy urged superiors to.visit potential recipi- ¯ ent areas personally, a rather unrealistic suggestion for harried superiors already overstocked with requests for their manpower. Naturally, bishops prefer to retain jurisdiction over their priests. For this reason the concept of a military ordinariate type structure to recruit, train, and appoint personnel in Latin America failed to receive widespread acceptance, since experience .with military chaplains alerted bishops to the fear of losing control of their sub-jects for the major portion of their ministerial lives. Several prominent churchmen, support attempts to permit diocesan priests to serve in a religious community on the missions through a temporary connection with a religious order. Only diocesan priests who have lived for any length of time in the house of a religious society can foresee the difficulties of this plan. In spite of abundant good will on the part of all involved there is no escaping the feeling on the part of the secular priest that he is a "junior" or "non-incorporated" subject, without status and without the possibility of participation in decision making sessions. Likewise, this association causes the priest to lose identity both at home and abroad as a diocesan priest serving temporarily on the missions. The entry of diocesan priests with previous parish ex-perience into missionary areas revealed the value of these men over those who went directly to the missions upon ordination without any experience in a normal parish situation to use as a barometer for their missionary en-deavors. A diocese-to-diocese setup is not workable because one diocese in the States cannot properly provide for train-ing, support, leave time, illness, vacations, and so forth of overseas staff. Yet a method must be found which preserves the interest of the home diocese which usually provides the financial wherewithal enabling the Latin American mission to function. Other proposals include appointing men for a time to a national conference of bishaps in a given country, in-cardinating priests temporarily into a Latin American diocese, or assigning them to the U.S. Bishops' Com-mittee for Latin America, which, in conjunction with the U.S. and Latin American bishops involved, could arrange for training and distribution of priests. Two countries have established national offices to deal with this issue, and bishops assigning men to either Chile or Brazil need only refer to the national offices for ad-vice. Several methods of providing diocesan priests to Latin America have sprung up among the 76 dioceses involved in this effort. 24 dioceses merely permitted priests to go to Latin America. 17 assumed responsibility to support the volunteer priests during their term of Latin Ameri- 4- 4- 4- Latin America can service but they make no provisions for the assign-ment of these priests. 34 accept the task of supporting a parish or several parishes in Latin America. In Boston, Richard Cardinal Cushing founded in 1958 a society to bring these diocesan priests together. Currently this St. James (the Cardinal's middle name) Society counts slightly more than 100 members from 30 dioceses in the U.S. and several European countries. This corps pro-vides pastoral services to a half million people spread across Peru, Ecuador, and Bolivia. It represents the best vehicle currently available for sending diocesan priests to Latin America. A similar organization for pooling nuns going to Latin America received attention at an inter-American meeting of Bishops at Georgetown University in 1959 but has failed to be implemented. In attempting to establish priorities, the national conferences of Bishops in Latin America have proved to be a boon although usually the primatial archbishop in a country tends to see his own needs first and with good reason for he usually presides over the largest metropoli-tan portion of that country. But rural bishops complain about the criteria when they witness most foreign ar-rivals remaining in the capital city. Both CELAM and the Pontifical Commission for Latin America have sought to provide a solution in this sensitive area but without success, as most attempts at coordination cause disputes over the choice of one diocese over another as beneficiary of American clerics. Originally the Pontifical Commission offered the facili-ties of the nunciatures throughout Latin America as clearing houses, but a.fear of Roman control of the en-tire movement impelled both donor and petitioner dioceses to bypass quietly any Commission services. As a former nuncio in Panama, the late Archbishop Paul Bernier commented on this question during his tenure on the Canadian Bishops' Commission for Latin America: lames A. Clark REVIEW FOR'RELIGIOUS I think there is a strong feeling against forming a society of any kind. Most of the bishops, if I understand well, insist on having and keeping an effort of the secular clergy as such with no affiliation, neither to the diocese ad quam nor to any particular religious or semi-religious society but to keep all of them [the priests] incardinated in the diocese a qua. If they don't want to stay there for more than five years, or if for any other reason they cannot remain, they come back to their own diocese just as if they were never out of it. I think that in Canada at least the impression of the bishops would be rather contrary to affiliating or incorporating our diocesan ~nd secular priests to any particular society. Most bishops would be willing, however, to send according to their abilities one or two, five or ten priests, to some form of, not a society, but a responsible organization which in the last analysis would be in the hands of the Episcopal Committee for that. Whoever accepts responsibility for such appointments will have need of some priorities or guidelines since the priestly requirements of Latin America could not be fulfilled if every priest in. the United States went to Latin America. Some principles to follow in this area would include the following points. The i~rst choice to be made is a selection of a category of work for a religious volunteey, that is, shall I send my priest (or brother or sister) to work as a catechist, teacher, parish worker, or what? The departments of CELAM indicate the critical apostolates which normally will have first call on foreign services: education, medi-cine, social service, relief, charity, seminary/vocational work, catechetics, student/university apostolates, and service to laborers. Next the superior must choose a geographical classifi-cation, that is, shall I send him (her) to serve on the con-tinental level with CELAM, or on the regional or na-tional level with the conferences of bishops, or to the diocesan and local level. Foreigners often function best in posts removed from the intimate personal relation-ship of priest-to-parishioner which reqmres sensitive cul-tural perception. Usually their North American organi-zational talents achieve widest impact on a broader scale at the continental, regional, or diocesan levels. Also a decision must be made as to whether to send personnel to the rural or urban locations. Many Mary-knollers in Latin America have regretted the decision made many years ago to spread Society members across the mountain ranges. The impact of an individual is broader in the cities. On the other hand Cardinal Cush-ing says that the revolution in Latin America will be born in the mountains and the Church ought to be there. At one time it was thought preferable to assign North Americans to dioceses with North American bishops at the helm. This principle has been subsequently disre-garded since it leads to a danger of creating a church within a church, one foreign and one native. The monster parishes which have arisen in Latin America as a resuh of abundant American material and personnel aid have become a source of distress for Latin Americans and embarrassment for North Americans. Parish A flooded with American assistance can only re-flect poorly on parish B which is struggling along with local resources only. OccasionaIIy a choice arises between placing people in projects underwritten by private industry or govern-÷ ÷ ÷ Latin America VOLUM~ 28~ 1969 883 4- 4- REVIEW FOR,RELIGIOUS 884 ments, for example, a company hospital or a state nor-mal school. These opportunities sometimes permit the assure, ption of responsibilities which would otherwise be financially prohibitive; on the other hand, alliance with a government or industrial concern can be severely det-rimental to the Church image and impact. .One essential requirement demands that the project given help be integrated into the local church structure. For this reason each local request must be approved by the national conference of bishops to insure that it co-ordinates with the national pastoral plan. From the viewpoint of the candidate to be sent to Latin America, if he or she speaks one of the languages of Latin America or has studied or served in a particular country naturally it is logical to assign the person to that place. All attempts to satisfy reasonable personal preferences will reduce the inevitable cultural shock suffered by v, olunteers. A first principle of sending people into Latin America is that they be sent as members of a team effort and never individually. The ability of the subject offering his services will sometimes be the final determinant of assignment; a seminary professor will not serve best in a slum parish nor will a Trappist normally function well in a mass communications program. Due to the profound social division in Latin America there is a need to predetermine whether personnel are to be placed in projects serving the wealthy or the im-poverished. In the latter case a realistic plan for external financing will normally be required. Projects which provide some hope of eventual self-sufficiency in regard to their staffing needs should be selected rather than those which will require permanent foreign workers. Realistic approaches to provide new solutions to basic religious problems of Latin America deserve special con-sideration. For examples, the novel approach to slum parish work of Father Andres Godin, a Canadian Oblate, in Lima, Peru; or that of American Oblate Edmund Leising who has developed a remarkable program in Brazil for promoting parish self-support through Ameri-can fund raising procedures; or the renowned apostolate of Father Leo Mahon in San Miguelito parish in Pan-ama who has discovered an entirely new process for parish effectiveness. These offer novel and successful approaches to stubborn problems. Similar examples of projects managed by Latin American priests themselves could be cited. Most superiors have the background to recognize that adequate and detailed financial arrangements must be agreed upon in advance by both sides to prevent animos-ity from developing on obscure financial responsibilities. The overall plan an agency presents ought to be ex-amined carefully to learn if it is realistically conceived. Experience in Latin America reveals that ill.constructed, idealistic proposals soon collapse. Those of us familiar with the problem of positioning personnel in Latin America are aware of the difficulties superiors face in this field. Hopefully some of the above remarks will assist the ongoing dialogue in this area and be of some assistance to those who seek to serve the Church by releasing people for work on the only Catholic continent of the globe. + + ÷ Latin America VOLUME 28, 1969 885 JOSEPH F. GALLEN, S.J. Comments on tl e Instruction on Formation Joseph F. Gallen, S.J., writes from St. Joseph's Church; $21 Willings Alley; Philadelphia, Penn-sylvania 19106. REVIEW FOR RELIGIOUS Prepostulancy Nothing is said in the Instruction on a prepostulancy period. Number 4 states that it would be worthwhile to consider whether the practice of going directly to the novitiate from such places as aspirancies, apostolic schools, or minor seminaries should be continued or whether an interval of probation should be had to develop the human and emotional maturity of the candidate. In the case of those obliged to a postulancy by canon 539, § 1, this development can be taken care of during the postulancy, which can last up to two years and also be made while residing outside any house of the in-stitute (n. 12). There is nothing in the Instruction for or against such places as aspirancies but, as is clear from what was said above, number 4 presumes that they will continue to exist. Postulancy (nn. 4; 10-2; 33) Importance. "Hence it follows that all institutes, even those that do not prescribe the postulancy, must at-tach great importance to this preparation for the novice-ship" (n. 4). Purpose. This is to judge the suitability and aptitude of the candidate; to give a preparation that will enable the noviceship to be made more fruitfully; to provide a gradual transition from secular to religious life; and to verify and complete, if necessary, the religious knowledge of the candidate (nn. 11-2). "Tentative" in number 11 of the Vatican English translation is not in the Latin text and "to formulate a. judgment" is to form a judgment. Power of general chapter. In institutes in which the postulancy is of obligation by common law (in insti-tutes of perpetual vows: all women but in those of men only lay brothers) or by the constitutions, the gen-eral chapter may keep in mind, for a better adaptation of the postulancy~ the following norms (n. 12): Duration. In institutes in which the postulancy is not obligatory by common or constitutional law, the general chapter may determine its nature and duration, which can vary for different candidates but should not be too brief nor ordinarily longer than two years. In institutes in which the postulancy is obligatory from common law, it must last at least six full months (c. 589, § I), and this minimum time is more probably retained in the Instruction; but the general chapters of these institutes may also follow the two-year limit, the principle that the time may vary for different candi-dates, and probably that the minimum time may be less than six months (n. 12). 1 do not think the right of canon 539, § 2, to prolong the postulancy for six months extends to a postulancy of two years. A postu-lancy longer than two years would not be very rea-sonable, especially since it can be varied within that time for the individual. Place. Preferably not in the novitiate house, and it can be profitable for it to be made wholly or in part outside a house of the institute (n. 12). The postulancy may therefore be so organized that the postulants con-tinue to reside in their homes or in such another place as a college. See also numbers 4 and 11. The latter speaks of a "gradual transition from lay life to that proper to the noviceship." Director. The postulants, wherever the postulancy is made, are to be under the direction of qualified re-ligious, between whom and the master of novices there is to be sedulous cooperation (n. 12). Dross. The determination of the dress of the postu-lants appertains to the general chapter (n. 33). How-ever, canon 540, § 2, had required simply that the dress of the postulants be modest and different from that of the novices. It could therefore have been secular but modest; special and uniform, but this was not neces-sary; religious, but different from that of the novices. Noviceship (nn. 4-5; 13-33) Maturity requisite Ior beginning noviceship (n. 4). The noviceship should begin when the candidate is aware of God's call and has reached that degree of human and spiritual maturity which will allow him to decide to respond to this call with sufficient and proper knowledge and responsibility: "Most of the difficulties encountered today in the formation of novices are usually due to the fact that when they were admitted they did not have the required maturity., it must ÷ ÷ ÷ Formation VOLUME 28, 1969 887 ÷ ÷ ÷ $. F. Gallen, S.l. REVIEW FOR RELIGIOUS 888 be affirmed that the age required for admission to the noviceship should be higher than heretofore" (n. 4). Place. The noviceship for validity must be made in a house legitimately designated for this purpose (n. 15) by the superior general with the consent of his council and according to the constitutions (n. 16). The superior general with the consent of his council and after consultation with the interested provincial may in a case of necessity permit also many novitiates in the same province (n. 17). When the small number of novices is not sufficient to promote community life, the superior general should, if possible, establish the novitiate in a community of the institute capable of aiding the formation of such a small group of novices (n. 18). To better meet some demands of their formation, the superior general may authorize that the group of novices be transferred during certain periods to another house of the institute designated by himself (n. 16). In particular and exceptional cases, the superior gen-eral with the consent of his council may permit that a candidate validly make his noviceship in a house of the institute other than the novitiate house, under the direction of a qualified religious acting as a master of novices (n. 19). Duration. For validity the noviceship must last for twelve months (n. 21). A continuous or interrupted absence from the noviti-ate group and house that exceeds three months ren-ders the noviceship invalid (ft. 22). In lesser absences the higher superior, after consulting the novice master and considering the reason for the absence, may in individual cases command an extension of the noviceship and determine its length, and this matter may also be determined by the constitutions (n. 22). Formative activity periods outside the novitiate house must be added to the required twelve months, nor may they be begun before a novice has spent three months in the novitiate (if the contrary is done, the noviceship be-gins only on the completion of the formative activity period) and must be so arranged that the novice spends a minimum of six continuous months in the novitiate, re-turns there at least a month before the first vows or other temporary commitment, and the time of the whole novice-ship extended in this manner may not exceed two years (n. 24). The noviceship amplified by such formative activity periods may not exceed two years, but this does not abrogate the right given to higher superiors in canon 571, § 2, to prolong the noviceship up to six months in a doubt about the suitability of a candidate. Such a prolongation is permitted in a noviceship of two years without formative activity periods. A higher superior for a just cause may permit first profession or commitment to be anticipated but not beyond fifteen days (n. 26). Formative activity periods. The general chapter by at least a two-thirds vote may experimentally enact, in keeping with the nature of the institute, one or more periods of formative activity outside the novitiate house, the number to be determined in practice accord-ing to the judgment of the master of novices with the consent of the higher superior, for the formation of the novices or, in some cases, for a better judgment of their aptitude for the life of the institute. Such periods may be used for one, several, or the entire group of novices. If possible a novice should not be assigned alone to these periods. In these periods the novices are under the direction of the master of novices (nn. 23, 25). "It must be emphasized that this formative activ-ity, which complements novitiate teaching, is not in-tended to provide the novices with the technical or professional training required for certain apostolic ac-tivities, training which will be afforded to them later on, but rather to help them, in the very midst of these activities, to better discover the exigencies of their vocation as religious and how to remain.faithful to them" (n. 5; see also n. 25). Separation of novices. There must be some separation between the novices and the professed religious, with whom, however, and with other communities, the novices may have contact according to the judgment of the master of novices. It appertains to the general chapter to decide, according to the nature of the institute and particular circumstances, what contacts may be had between the novices and the professed of the institute (n. 28). The use of the term "professed re-ligious" in the second sentence makes it sufficiently clear that there is no prohibition of contact between the novices and the postulants, as might be feared from the word "members" in the other two sentences of number 28. Studies during the noviceship. The general chapter may permit or command certain studies during the nov-iceship for the better formation of the novices, but doctri-nal studies should be directed to the knowledge and love of God and to the development of a more profound life of faith. From the twelve months of noviceship of number 21 all studies, even theological and philosophi-cal, made for obtaining diplomas or for acquiring a formation directed to preparation for fulfilling future Formation VOLUME 28, 1969 889 REVIEW FOR RELIGIOUS 890 duties are forbidden (n. 29). Provided doctrinal studies are directed to the spiritual life, as prescribed in the first sentence, it is probably not forbidden to receive credits for such studies when these can be had but the studies are not to be directed to the attaining of credits. There is no doubt that the prescription on doctrinal studies in this first sentence also applies only to the twelve months of noviceship of number 21, as is also true of the canonical legislation in canon 565, § 3, on this point, "even though the Latin text says "during the time of the noviceship," not "during the regular novitiate year," as in the English translation. The latter also has "all formal study programs" in the second paragraph whereas the Latin reads "all studies." Dress o] the novices. It appertains to the general chapter to determine the dress of the novices (n. 33). Number 33 speaks of the "habit of the novices and of other candidates for the religious life." It certainly had not been the practice nor is there any tendency to give a religious habit to postulants, and the meaning here of "habit" is "dress." No limitation is placed on the power of the general chapter to determine the dress of the novices and postulants. Canon 557 commands the wear-ing of the habit during the whole time of the noviceship, but it has also been maintained that the noviceship is an uncertain time and that the habit, to retain all its significance, should not be given to the novices. Noviceship lot another class. Unless the constitutions determine otherwise, a noviceship made for one class is valid for another (n. 27). The constitutions may de-termine the conditions regulating a transfer from one class to another (n. 27), Novice master. The novices are under the direction of the novice master who may seek the aid of other skilled helpers (n. 30). This is to be kept in mind with regard to a formation team. See also numbers 5, 12, 15, 23, 31, 32. Temporary Bond (nn. 2, 6-9; 34-8) A different temporary bond may be established and ]or all. Number 34 gives a faculty, not a precept, but in general language: "The General Chapter, by a two-thirds majority, may decide to replace temporary vows with some other kind of commitment as, for example, a promise made to the institute." The same general lan-guage is found in numbers 2, 6, 10, 24,' 37-8. The pos-sibility of the extension to all in the probation after the noviceship is not certainly excluded by other num-bers of the Instruction. A dil~erent bond should be introduced only a]ter most careful thought. The reasons are (1) number 34 demands a two-thirds vote of the general chapter to in-troduce a different bond and (2) number 7 explidtly re-quires such careful thought: "No institute should de-cide to use the faculty granted by this Instruction to replace temporary vows by some other form of commit-ment without having clearly perceived and weighed the reasons for and the nature of this change." A different bond in fairness, prudence, and proper regard [or sound spirituality should be introduced only [or those in whom the special immaturity exists. The reasons are (1) by vows a special consecration is had according to number 2: "Thus it is that religious pro-fession is an act of religion ~nd a special consecration whereby a person dedicates himself to God." (2) Be-cause according to number 7 temporary vows are com-pletely in harmony with the greater response to God so important at the beginning of the religious life and also enable the candidate to make the consecration proper to the religious state: "For him who has heeded the call of Jesus to leave everything to follow Him there can be no question of how important it is to respond generously and wholeheartedly to this call £rom the very outset of his religious life; the making of temporary vows is completely in harmony with this requirement. For, while still retaining its probationary character by the fact that it is temporary, the profession of first vows makes the young religious share in the consecration proper to the religious state." (3) Because immaturity is the sole reason given (n. 7) for substituting another temporary commitment: "In fact, more fre-quently now than in the past, a certain number [quidam] of young candidates come to the end of their novitiate without having acquired the religious ma-turity sufficient to bind themselves immediately by re-ligious vows, although no prudent doubt can be raised regarding their generosity or their authentic vocation to the religious state. This hesitancy in pronbuncing vows is frequently accompanied by a great awareness of the exigencies and the importance of the perpetual religious profession to which they aspire and wish to prepare themselves." (4) Possibly also because the desire for the different commitment was true only of some institutes (n. 7): "Thus it has seemed desirable in a certain num-ber o[ institutes that at the end of their noviceship the novices should be able to bind themselves by a temporary commitment different from vows, yet answering their twofold desire to give themselves to God and the institute and to pledge themselves to a fuller preparation for perpetual profession." Since the Instruction describes temporary vows as a consecration that is special, proper to the religious state, and in harmony with the greater ÷ ÷ ÷ VOLUME 28. 1969 89! + ÷ .~. Fo Gallen, $J. REVIEW FOR RELIGIOUS 89~> response to God, it at least seems unfair, imprudent, and without regard for sound spirituality to deprive a novice of temporary vows when he has all the quali-ties requisite for making them, that is, when he is not affected by the special immaturity described in number 7. ¯ Some observations on this immaturity. Is this im-maturity proper to the young or is it the emotionalism that is today found in many older religious, and which the young often manifest only after continuous contact with such older religious? Isn't there a movement at this moment in the United States to give the vote to those who are eighteen years of age because the young are now more politically mature? In more than thirty states it has been the law that a girl of eighteen may marry without the consent of her parents. Is there any widespread tendency at present to change this very general law because of the immaturity of the ~young? Don't some hold that the greater physical development of modern youth argues to a greater psychological de-velopment? Does one frequently and without indoctri-nation encounter a novice who is judged to have a certain religious vocation (see also c. 571, § 2) but is too immature to take temporary vows? What factual and ob-jective investigations were made in the United States to prove the existence of such immaturity? Isn't it true that such immaturity would occur with regard to the temporary vow of chastity, not of poverty or obedience? Prescinding now from the obligation of the different commitment, don't the commandments of God still bind such a candidate and under serious sin in a violation of chastity? The simplest and most appropriate different com-mitment would be a promise to the institute to observe poverty, chastity, and obedience because (1) neither the form nor the object of the different commitment is determined in the Instruction (see n. 34) but (2) in numbers 7 and 35 the Instruction at least says it is fitting that the dit~erent commitment should in some way refer to the exercise of the three evangelical counsels, for example in number 7: "Whatever form such a temporary commitment may take, it is in keeping, with fidelity to a genuine religious vocation that it should in some way be based on the requirements of the three evangelical counsels." and (3) more directly and even categorically in number 13 the Instruction apparently says that the novice is to make profession of the evangeli-cal counsels at the end of the noviceship by temporary vows or other temporary commitment: ".that a novice.may implement the evangelical counsels of chastity, poverty, and obedience, the profession of which 'either by vows or by other sacred bonds that are like vows in their purpose' he will later make." This number of the Instruction is talking of a novice and therefore o[ the first consecration, which can be either vows or another temporary commitment. There is no alternative for the profession of perpetual vows. Other forms and objects of commitment are possible. The form and object of members in the strict sense of secular institutes is: "By making profession before God of celibacy and perfect chastity, which shall be confirmed by vow, oath, or consecration binding in conscience, according to the constitutions; by a vow or promise of obedience.by a vow or promise of poverty." (Provida Mater Ecclesia, February 2, 1947, Art. III). Some of the different forms of commitments in societies of common life without public vows are annual private vows of poverty, chastity, and obedience and the service of the poor; private perpetual vows of poverty, chastity, and obedience; promise of fidelity to the observance of the rule and constitutions; perpetual promise of observ-ance of common life and poverty; perpetual agreement to obey the rule of the institute; perpetual oath of perseverance and obedience; and perpetual oath and promise of perseverance and obedience,x The societies of common life more £requently encountered are the Daughters of Charity of St. Vincent de Paul, Eudists, Josephites, Maryknoll Missionaries, Oratorians, Pallot-tine Fathers, Paulists, Precigus Blood Fathers, Sulpicians, Vincentians, and White Fathers. Is one who makes a di1~erent temporary commitment in a state of perfection, in the religious state, a re-ligious, and a member of his institute? This is at least a very basic question and with wide implications. The negative arguments are that the Instruction nowhere says that one who makes a different temporary commit-ment is a religious and that canon 488, 7°, demands public vows to constitute a religious. On the other hand (1) vows are required only by canon law, not by divine law or the nature of the matter,2 to constitute a re-ligious, and the Instruction derogates from this canon law, as will be seen from the following arguments: (2) number 36 states absolutely that the subject is united with his institute and absolutely that he is obliged to observe its law; (3) the Instruction throughout does not differentiate between such a commitment and temporary vows (see nn. 2, 6, 10, 24, 34, 37-8); (4) num-ber 10 states explicitly that the temporary commitment is not the noviceship. If an entirely new state were being 1 See also Beste, lntroductio in Codicem, 497; Guti~rrez, Gora-mentarium pro religiosis, 38 (1959), 312-3. =See Goyeneche, De religiosis, 10-11; Guti~rrez, op.cit., 29 (1050), 72-3. ÷ ÷ ÷ VOU, JME 25, 89~ REV;EW FOR RELIGIOUS introduced distinct from that of the noviceship and temporary vows, this should have been dearly stated in the Instruction. (5) The probationary periods can last for thirteen years. This seems in itself to be un-reasonable if the subject does not become a member of the institute until the end of such time. The professed of temporary vows are members by first profession. The present canon law does not permit a duration of tempo-rary vows longer than six years, and canon 642, § 2, likens a professed of six years of temporary vows to one of perpetual vows. (6) During this prolonged time the institute would not be held in the case of such a subject to the norms of dismissal for professed but could dismiss him almost in the manner of a novice, whereas the pro-fessed of temporary vows would have also a right of sus-pensive recourse against his dismissal. Nor would canon 643, § 2, on the charitable subsidy apply, nor canon 646 on an automatic dismissal. (7) There would be an evident distinction in the rights and obligations of these subjects and the professed of temporary vows even though both would be in the same factual state of proba-tion. It is true, as number 7 states, tl~at "the profesz sion of first vows., makes the candidate share in the consecration proper to the religious state." Such a consecration, however, is required only by canon or human law, which can therefore enact that other suitable forms of commitment would also constitute a candidate in the religious state and make him a re-ligious, as also because such a candidate is always des-tined for this proper consecration in perpetual profes-sion. Religious women are nuns and their institutes are religious orders even though no one in fact has solemn vows provided at least some are destined for solemn vows from the particular law of the institute. Public vows would also remain proper to the religious state and to religious institutes since they are not had either in societies of common life nor in secular institutes. I therefore believe that the subject in a different temporary commitment is in a state of perfection, in the religious state, is a religious, and a member of his institute, but the question should be authoritatively serried by the Holy See. In the contrary opinion, those in a different temporary commitment are in a state that is neither noviceship nor profession, one also for which we have no parallel, and consequently a state of deep obscurity at least juridically. Determination o~ details b) the general chapter (n. 36). In virtue of canon 543 only a higher superior is competent to admit to the noviceship and to any re-ligious profession. The same canon demands a vote of the council or chapter for admission to the novice- ship, first temporary, and perpetual professions. The gen-eral chapter should require the deliberative vote for admission to the first temporary commitment and pre-scribe for renewals and prolongation of. such a com-mitment the same vote as is enacted in the constitutions for these acts with regard to temporary profession. The same policy should be observed concerning the superior competent for permitting an anticipated renewal of the temporary commitment, for exclusion from renewal or from the profession of perpetual vows (c. 637), and for the vote of the council in this case. The superior general with at least the advice of his council should be given the faculty of consenting to the dissolution of the com-mitment by the subject, to so consent to the request of the subject at any time during a commitment, who can then be immediately admitted to temporary vows, and with the consent of his council from the institute. Reception of ment is not necessary because it (c. 1308, § 1), and the consent of to dismiss a subject the different commit-is not a public vow the institute was suf-ficiently given and expressed in the admission to the commitment or its renewal. The general chapter could prescribe reception since such a repeated consent of the institute is not contrary to common law. The formula of the vows will have to be changed for a different commitment, for example, a promise will be to the institute, not to God as is a vow. Even if the new com-mitment does not have obedience as its express object and is therefore not productive of another obligation of obedience, superiors, as the head of the institute or of its parts, possess at least the same authority that they have over a novice and, if the Holy See decides that a different commitment is on the same juridical level as temporary vows, they possess the same authority as over a professed but without the added title to exact obedi-ence from the vow (c. 501, § 1; 502). Ganons whose application is obscure. The applica-tion of the following canons to those in a different temporary commitment should also be decided by the Holy See: responsibility for debts, 536, §§ 2-3; canonical examination, 552; dowry, 547-51; making of cession and disposition regarding personal patrimony and a civilly valid will, 569; retreat before first profession, 571, § 3; profession of a novice in danger of death. Requisites for a valid profession, exclusive of recep-tion, the necessity of three years of temporary vows, and understanding the derogations regarding a valid novice-ship in the Instruction, 572; age for profession, 573; deliberative vote for first profession, 575, § 2; written declaration of profession, 576, § 2; no intervals between renewals or perpetual profession, 577, § 1; 575, § 1; ÷ ÷ Formation VOLUME 28, 1969 895 ~. F. Gallen, S.]. REVIEW FOR RELIGIOUS 896 enjoyment of the same indulgences, privileges, spiritual favors, and suffrages, obligation of observing rules and constitutions, active and passive voice and computation of time for obtaining either, 578; illiceity and invalidity of acts contrary to the vows, 579. Acquisition of property by a professed of simple vows, change of cession and disposition, 580; renuncia-tion of personal patrimony, 581; 583, 1°; change of will, 583; 2°. Common obligations of clerics in canons 124-42, 592; obligation of common life, 594; obligation of wear-ing habit, 596; cloister, 597 ft.; religious duties, 595; right of exempt correspondence, 611; enjoyment of privileges of first order by nuns, 613, § 2; enjoyment of clerical privileges of canons 119-23, 614. Transfer to another religious institute or monastery, 632-5; 544, § 5; right of professed of temporary vows to leave at the end of a temporary profession, 637; ex-claustration, 638-9; effects of secularization, 640-3; compensation may not be sought for services given to the institute, 643, § 1; charitable subsidy, 643, § 2; laws on fugitives, 644, § 3; 645; 2386; automatic dismissal, 646; dismissal of a professed of temporary vows, 647-8; provisional return to secular life, 653. Six professed constitute a formal house, 488, 5°; precedence from first profession breaking a tie in elec-tions, 101, § 1, 1°; first profession as date of computing eligibility for office, 504; 559, §§ 1-2; prohibition of being members of third orders secular, 704; prohibi-tion of being a sponsor in baptism and confirmation, 766, 4°; 796, 3°; special jurisdiction necegsary for the confessions of religious women, 876; funerals of religious, 1221; 1124, 2°; permission for writings, 1386, § 1; punish-able for violations of common life, 2389. Obligation o[ observing the evangelical counsels. If the Holy See decides that a different temporary com-mitment is on the same juridical level as the profession of temporary vows, the evangelical counsels must be observed at least with the same obligation as the con-stitutions, no matter what be the object of the different temporary commitment because (1) not only does num-ber 36 impose after the new commitment "the obliga-tion of observing the Rule, constitutions and other regulations of the institute" and therefore a fortiori also the obligation of observing the evangelical coun-sels as more essential and important for a state of complete Christian perfection but also and more pro-foundly because (2) the observance of the evangelical counsels is necessary from the nature of a state of per-fection, as can be seen from the following direct and clear statements of only three Popes and Vatican II: "The religious orders, as everyone knows, have their origin and raison d'etre in those sublime evangelical counsels, of which our divine Redeemer spoke, for the course of all time, to those who desire to attain Christian perfection" (Leo XIII, December 23, 1900). "When the only-begotten Son of God came into the world to re-deem the human race, he gave the precepts of spiritual life by which all men were to be directed to their appointed end; in addition, he taught that all those who wished to follow more closely in His footsteps should embrace and follow the evangelical counsels" (Pius XI, March 19, 1924). "It is true that by the apostolic constitution Provida Mater Ecclesia we declared that the form of life, which is followed by secular institutes, is also to be accepted as a state of perfection publicly recognized, because the members are bound in some way to the observance of the evangelical counsels" (Pius XII, July 13, 1952).3 Vatican II affirmed: "Thus, although the religious state constituted by the profession of the evangelical counsels does not belong to the hierarchical structure of the Church, nevertheless it belongs in-separably to her life and holiness." 4 Moral obligation of a new temporary commitment. It might seem that a general chapter could also completely determine this (see n. 36), but number 34 gives a promise to the institute as an example of such a com-mitment. We are to presume words in such a document are being used in their proper sense, and in such a sense a promise produces a moral obligation. In a merely private promise to God or man, the one making the promise can oblige himself only to a light obliga-tion in light matter but in serious matter he can assume either a light or a grave obligation. May a general chapter, therefore, define the moral obligation of the new temporary commitment, for example, a promise to the institute, as only light? It could do so if it is decided by the Holy See that such a commitment is not on the same juridical level as temporary vows. Could it do so if the level is the same? Such a definition is not excluded by the nature of a commitment or promise purely in itself nor by the explicit wording of the Instruction. The light obligation can also be urged from the reason for permitting a different commitment, that is, the immaturity of a candidate. It would not 8Courtois, The States of Perfection, Dublin: 1961, M. H. Gill and Son, nn. 33, 130, 403, 474; see also Schaefer, De religiosis, n. 125; Beste, op.cit., 328; Padri Claretdani, II diritto dei religiosi, n. 3; Fanfani, II diritto delle religiose, n. 2; Bastien, Directoire canonique, nn. 9, 14; Creusen, Religious Men and Women in Church Law, nn. 4-5; Guti~rrez, ibid., 63-4, 67. ' Abbott-Gallagher, The Document~ of Vatican II, 75. 4" 4" 4" Formation VOLUME 28, 1969 89~ ]. F. Gallen, $.$. REVIEW FOR RELIGIOUS seem very practical to enact that such a candidate does not have to take the added serious obligation of a re-ligious vow if he must assume the added serious obli-gation of another form of commitment. On the opposite side it can be well maintained from the nature of the matter that it would be incongruous for the funda-mental obligations of a permanent state of life to be only light. Above all there is a reply given by the Sacred Congregation of Religious, May 19, 1949, in an entirely parallel case and in general language to the effect that the bonds assumed by the members of secular insti-tutes cannot be light in their general nature.~ The pur-pose and nature of secular institutes are given as the reason for this doctrine. A secular institute is an apos-tolic state of complete Christian perfection, and the reasoning of the Sacred Congregation appears to me to apply, at least equally, if not afortiori, to religious in-stitutes. In effect this would mean, in the promise we have advocated to the institute to observe poverty, chastity, and obedience, the same light or serious obliga-tion that is had in the religious vows. The document reads: 1. The obligations which are contracted by members in the strict sense (Art. III, §§ £ and 3) for the full pursuit of the juridical state of perfection in secular institutes (Art. III, § 2), if they are to correspond to the purpose and nature of the institute, cannot be light in their general nature and under every respect (ex genere suo atque ex omni parte). 2. On the other hand, the bonds on which this state of perfection rests, are considered so to oblige in conscience that the obligations thus produced must be called grave in their general nature (ex genere suo). 3. In individual cases, an obligation must be considered grave only when its matter must be considered as certainly grave according to the constitutions and the common teaching regarding equal or similar bonds. Moreov,er, according to the well-known rule of law (Reg. 30 in VI°), 'In obscure matters, one is obliged to Iollow only the least obligation," it cannot be affirmed in a doubtful case that an obligation is grave or more grave, for example, on the ground that an obligation arises from or is reinforced by the formal virtue of religion. 4. Just what is the nature of the bonds assumed in individual institutes and what is the precise mode of obligation---e.g., in addition to justice and fidelity, is there also and, if so, to what degree, an obligation from the virtue of religion--must be learned from the constitutions, which should give an accurate presentation of the matter, and from the formula of consecra-tion or incorporation in which the bonds are expressed. 5. Even when it is certain that there is a formal obligation arising from the virtue of religion, since there is question of vows or bonds which, although they are not fully private, nevertheless, in law, cannot be called public in the strict and specific sense and do not effect a public consecration of the' "Bouscaren-O'Connor, Canon Law Digest /or Religious, 167-8; see also Commentarium pro religiosis, 28 (1949): Larraona, 199-200; Fuertes, 292-8. person, the malice of sacrilege must not be attributed to their violation. Duration oI probation after the noviceship. The gen-eral chapter is to determine this but it is to be no less than three nor longer than nine years (n. 37). I find it difficult to see why a period longer than five years should be generally prescribed (n. 6). The total possible probationary period, that is, 2 years of postulancy, 2 of noviceship, and 9 of temporary commitment, can thus be 13 years. This would ordinarily mean perpetual profes-sion at the youngest only at the age of 30 or 31 years. Would we advise marriage only at 30 or 317 The gen-eral chapter may permit a prolongation in individual cases of a prescribed time, e.g., five years, up to the full nine years or may limit the power of prolonging, e.g., to only one year (n. 37). Precise length of dil~erent commitment. This may be made in the one act for the full length of the interval before perpetual profession, for example, five years; or for a briefer period, for example, three years, to be re-newed for two years on its expiration or to be followed by temporary vows (n. 34). The provision of canon 577, § 2, of permitting a renewal of temporary vows to be an-ticipated but not by more than a month may be also applied to the renewal of a different form of temporary commitment. Such an anticipation is permissible £rom the nature of a commitment and is not excluded by the Instruction. Must also a di~erent temporary commitment be ac-companied by the intention of renewing and of admit-ting to a renewal on its expiration? If the decision of the Holy See is that the juridical level of temporary vows and other temporary commitments is the same, the answer is in the affirmative. The explanation of the necessity of this intention in temporary vows has been the following. The religious life has ever and now de-mands stability or permanence. From its concept it is a state of life in the same way as the clerical or married state. A state of life is something that contains the note of stability or permanence. The exact permanence re-quired is defined by the Church as follows: solemn vows or simple perpetual vows are sufficient but not neces-sary; the minimum requisite is simple temporary vows. Therefore, an institute in which all the members make only annual professions of poverty, chastity, and obedi-ence fulfills this requisite. The Church further requires that temporary vows be renewed on their expiration (c. 488, 1°). This implies an intention on the part of both the religious making temporary profession and the superior admitting to this profession that, iI no obstacle ÷ ÷ ÷ Formation VOLUME 28, 1969 899 ]. F. Gallery, REVIEW FOR RELIGIOUS 900 occurs in the meantime, the vows will be renewed on their expiration. It is evident that the same necessity of this intention and its explanation apply to a different temporary commitment since the necessity of the inten-tion is required not from vows as such but from the fact that the religious state is 'a state of life and demands stability.6 Lastly, such an intention is required in secular institutes, in which the bond can be vow, oath, consecra-tion, or promise: "The bond by which the secular insti-tute and its members in the strict sense are to be united must be: 1o Stable, according to the constitutions, either perpetual or temporary but to be renewed at its expira-tion (c. 488, 1°) . ,, 7 ConIusion on temporary vows. Tkis is the appropriate place to mention the extensive confusion that has existed on temporary vows in this whole matter of a different commitment. Many talked as if a temporary vow were a most unusual and even a contradictory thing. Evidently they did not know that temporary vows were mentioned in canon law (c. 131.1) as also in practically any manual of moral theology and in canonical works that included the treatment of the vows. It was also frequently stated that the intention of renewing and of admitting to renewal on their expiration was a contra-diction of the temporary duration of such vows. This again was ignorance. The intention was not and could not have been absolute, which would have been clearly contrary to the probationary nature of the period of temporary vows. It was a conditional intention to renew the vows i[ no obstacle intervened in the meantime, S and this obstacle, if not always, would practically always have been the discovery by the institute or the subject that he or she had no vocation. There was almost an equal number of statements that a temporary profession was invalid if at the time a religious had the intention of not renewing or a superior of not admitting to a renewal on the expiration of a temporary profession. Canon 572 does not list such an intention among the requisites for a valid religious profession. Canon 488, 1°, does not append an invalidating clause to the necessity of this intention as required by canon 11. A requirement for liceity only will also sufficiently fulfill the required stability. An invalidating law according to canon 15 does not exist in a doubt of law, and there is certainly a doubt o See Larraona, op. cit., 2 (1921), 137, 209; 28 (1949), 205; Schaefer, op.ciL, n. 128; Jone, Commentarium in Codicem iuris canonici, I, 387; Padri Clarettiani, op.cit., nn. 3, 6; Vermeersch-Creusen, Epitome iuris canonici, I, n. 580; Goyeneche, op.cit., 9-10; De Carlo, Jus religiosorum, n. 2. ~ Provida Mater Ecclesia, Bouscaren-O'Connor, op.cit., 151. aSee Larraona, op.cit.o 2 (1921), 209 and note 81; 28 (1949)~ 205; Guti~rrez, ibid., 90. of law in the present caseP There was also a great deal of talk merely about promises, as if a vow were not a promise. Nor was there too much knowledge of sanctity of life and of the relation of the evangelical counsels and of vows to this sanctity. Sacred orders may not be conferred belore perpetual profession (n. 37; c. 964, 4°). For a just reason a higher superior may permit that a first profession be made outside the novitiate house (n. 20). The Instruction does not mention the commitment presumably because it is held that the prescription on place of canon 574, §1 applies only to vows. Readmission of one who legitimately left either after completing temporary vows or other commitment or a[ter being [reed from either. He may be readmitted by the superior general with the consent of his council, who is not obliged to prescribe another noviceship, nor an-other postulancy (c. 640, § 2), but is obliged to enjoin a previous period of probation and also a period of tem-porary vows or other commitment not less than a year nor less than the time that remained to be spent in this temporary probation before perpetual profession when the subject left. The superior general may prescribe a longer period of temporary vows or other commitment (n. 38). Immediate preparation for perpetual proIession and similar periods during tbmporary vows or other commit-ment. It is desirable that perpetual profession should be preceded by a sufficiently long immediate preparation something in the manner of a second noviceship. The duration and other aspects are to be determined by the general chapter (nn. 9, 35). It is also desirable that periods of withdrawing to prayer, meditation, and study be established during the time of temporary vows or other commitment (n. 25). Section IlL Application of the special norms. The par-ticular provisions axe called norms because they have been enacted for experimentation (VII). They are in effect from January 6, 1969 (VII). The norms and direc-tives of the Instruction appertain only to religious in-stitutes; other institutes of common life may but are not obliged to follow them (n. 3). Common law (canon law, laws enacted after the Code of Canon Law, laws of Vatican II, and postconciliar laws) remains in effect un-less derogated by this Instruction (I). The faculties granted by this Instruction may in no way be delegated g See Schaefer, op.cit., n. 128; Jone, op.cit., 387; Guti~rrez, ibid., note 65; Vermeersch, Periodica, 31 (1932), 122 ft.; Goyeneche, Corn. mentarium tyro religiosis, 16 (1935), 315-6; Vidal, De religiosis, n. 9, holds for invalidity. 4- 4- ÷ VOLUME 901 ~. F. Gallen, $.]. 902 to another (II), but they may be used by those who legiti-mately take the place of the superior general when there is no superior general or he is legitimately prevented from acting (IV). The same principle is true of the vicars of other higher superiors since they are actually exercising the office of the higher superior when accord-ing to the constitutions they take the place of a higher superior, such as a provincial, in the vacancy of the office, in his absence, or when he is otherwise impeded from fulfilling the duties of his office. There is nothing of such importance in the faculties granted in the Instruc-tion to higher superiors that would merit the exclusion of vicars from the exercise of such faculties. An abbot at the head of a monastic congregation is also to be understood under the name of superior general in this Instruction (III). In the case of nuns dedicated exclu-sively to the contemplative life, special norms shall be inserted into the constitutions and submitted for ap-proval, but the norms in numbers 22, 26-7 may be ap-plied to them (V). I[ the special general chapter has already been held, the superior general and his council acting collegially,x° after a careful study of all circumstances, are to decide whether a general chapter should be convoked to deliber-ate on the faculties granted to it or whether it would be preferable to await the next general chapter (VI). If they decide against the above convocation but also that the use of the faculties granted to the general chapter is urgent for the good of the institute, they, again acting collegially, have the power of putting all or some of the same faculties in use until the next gen-eral chapter provided they have previously consulted all other higher superiors and their councils and have ob-tained their two-thirds affirmative vote. These other higher superiors should have it at heart to consult previ-ously the professed of perpetual vows. In institutes with no provinces, the superior general must consult the l~rofessed of perpetual vows and obtain the affirmative vote of two-thirds OgI). The following appertain to the general chapter: with a two-thirds vote: to introduce periods of formative ac-tivity in the noviceship (n. 23) and a different tempo-rary commitment (n. 34); with the vote prescribed by the constitutions: to make determinations for the pos-tulancy (n. 12); to decide on the permissible contacts of the novices (n. 28); to permit or command studies during the noviceship (n. 29); to determine the dress of the novices and other candidates (n. 33); to determine the duration of the probation between the noviceship See REVIEW FOR RELIGIOUS, 19 (1960), 131-2. and perpetual profession and other aspects of the same probation (nn. 35-6-7); and experimentally to enact other matters that imply a change in the constitutions, for example, in numbers 16, 22, and 27. The following appertain to the superior general: with the consent of his council: the institution of a novitiate (n. 16) and of many novitiates in the same province, having consulted the interested provincial (n. 17); the making of the noviceship in a house that is not a noviti-ate house (n. 19); the readmission of one who legiti-mately left either after completing temporary vows or other commitment or after being freed from either (n. 38); alone: to permit the group of novices to reside for a time in another house designated by him (n. 16); to per-mit a small group of novices to make their noviceship in a house more suitable for community life (n. 18); with the council acting collegially: to decide on the calling of a general chapter to implement the Instruction or to permit, without a general chapter, the use of the facul-ties granted in the Instruction, after consulting all other higher superiors and their councils and having obtained the affirmative vote of two-thirds of them or of the pro-fessed of perpetual vows when the institute does not have provinces (VI). The following appertain to higher superiors: alone: to permit first profession outside the novitiate house (n: 20); to permit that first profession be anticipated but not beyond fifteen days (n. 26); after consulting the master of novices: to decide on a supplying of absence of a novice of less than three months (n. 22); and it is rec-ommended that higher superiors below the superior general previously consult the professed of perpetual vows on the use of faculties of the Instruction without having a general chapter (VI). Spiritual principles of the Instruction. In the intro-duction to the Instruction, the Sacred Congregation for Religious and Secular Institutes stated that the reason Vatican II gave no small measure of attention to reli-gious was that the Church might have a greater abun-dance of spiritual strength and be better prepared to proclaim the message of salvation to the men of our age; quoted Lumen gentium, numbers 44-5, to the effect that the state of the evangelical counsels appertains to the sanctity of the Church and that the practice of these counsels is uniquely effective for the perfection of the love of God and of the neighbor; spoke of the duty of religious institutes to renew their spiritual, evangelical, and apostolic lives; recalled that no loss was to be per-mitted in the basic values of the religious life; and de-clared the necessity of defining again the principal as-pects of this life. Formation VO'LUME 28, 1969 9O3 I. F. Ga//en,~$.l. REVIEW FOR REI.~G~OU$ 90; In the first section, which treats of principles and criteria, the Sacred Congregation reaffirmed that pro-fession of the evangelical counsels is a total consecration of one's person to God; that both from the teaching of the Church and the nature of this consecration the vow of obedience appertains to the essence of religious pro-fession; that by this consecration the religious exercises the perfection of apostolic charity, even though the apostolate is not the primary purpose of religious pro-fession; and that it may not be said that the nature of religious profession is to be changed or its proper de-mands lessened. The Sacred Congregation stated that the noviceship retains its irreplaceable role in formation; that novices are to be taught the cohesive unity that should link contemplation and apostolic activity; and that this unity is one of the fundamental and primary values of apostolic institutes. The achievement of this unity requires a~proper un-derstanding of the realities of the supernatural life and of the paths leading to a deepening of union with God in the unity of the one supernatural love for God and for man, finding expression at times in the solitude of inti-mate communing with the Lord and at others in the generous giving of self to apostolic activity. Young reli-gious must be taught that this unity, so eagerly sought and toward which all life tends in order to find its full development, cannot be attained on the level of activity alone, or even be psychologically experienced, for it resides in that divine love which is the bond of perfec-tion and which surpasses all understanding. The attainment of this unity, which cannot be achieved without long exercise of self-denial or without persevering efforts toward purity of intention in action, demands in those institutes faithful compliance with the law inherent in the spiritual life itself, which con-sists in arranging a proper balance of periods set aside for solitude with God and others devoted to various activities and to the human contacts which these in-volve (n. 5). The Sacred Congregation maintained that suitable maturity was required that the religious state be a means of perfection and not a burden too heavy to carry, as also the desirability that the perpetual con-secration to God of perpetual vows be preceded by a sufficiently long immediate preparation spent in recol-lection and prayer that could be like a second novice-ship. The second section of the Instruction is on special or particular norms and contains the following spiritual ideas and principles. The novices are to develop that union with Christ which is to be the source of all their apostolic activity; conformably to the teaching of our Lord in the gospel, the formation of the noviceship con-sists especially in initiating the novices gradually into detachment from everything not connected with the kingdom of God; that they learn to practice humility, obedience, poverty, to be instant in prayer, to maintain union with God, along with a soul receptive to the inspirations of the Holy Spirit, and to be mutually and spiritually helpful to one another in a sincere and un-feigned charity; they are to study and meditate on Holy Scripture; to be formed in the spiritual doctrine and practice required for the development of a supernatural life, union with God, and the understanding of the re-ligious state; they are to be initiated into the liturgical life and the spiritual discipline proper to their own in-stitute; they are to be given the occasions for striving to preserve faithful union with God in the active life; for the novices there is to be a balancing of periods of ac-tivity and of those given to recollection in prayer, medi-tation, and study to stimulate them to remain faithful to it throughout life, and a similar balancing is desirable during the years of formation before perpetual profes-sion. The Instruction reaffirmed the principle of the spiritual life and of Perfectae caritatis, number 8, that apostolic activity must have its source in intimate union with Christ and that therefore all the members should seek God only and above all, and unite contemplation by which they adhere to Him in mind and heart with apostolic love, in which they are associated with the work of redemption and strive to spread the kingdom of God; that novices are likewise to be formed in purity of intention and love for God and man; to learn to use this world as if they did not use it; realize that devotion to God and man demands a humble control of self; culti-vate the necessary human and spiritual balancing of the times given to the apostolate and the service of men and of the properly prolonged periods, in solitude or in com-munity, dedicated to prayer and to the meditative read-ing of the Sacred Scriptures. By fidelity to this most necessary and important program in all such institutes, the novices will gradually develop a peaceful union with God, which comes from conformity to the will of God. They must learn to discern the divine inspirations in the duties of their state, especially those of justice and charity. A mutual confidence, docility, and openness are to be fostered between superiors, the master of novices, and the novices that the master may be able to direct the generosity of the novices to a complete gift of themselves to God and lead them gradually to discern in the mys-tery of Christ crucified the demands of true religious + + + Formation VOLUME 28, 1969 905 obedience, and in this manner inspire them to an active and responsible obedience. The Instruction affirms with sufficient emphasis that the religious s~ate is different from secular institutes and from the state of the laity. ~. F. Gall~, $.1. REVIEW FOR RELIGIOUS SISTER MARY PATRICIA NORTON A New Form Community oJ Religious Government The custom that has been traditionally followed in women's religious communities of focusing all authority, responsibility, and decision-making in one person at the local, regional, and generalate level has, we believe, been a custom that grew up as a result of historical circumstances. When some of the original women's re-ligious communities were founded, there was a com-paratively small number of the members that were well educated. There has, of course, always been a local, regional, and general council to assist and advise the superior; but in actual practice the superior has gen-erally led an overburdened existence, weighed down by the responsibility of major decisions. Since the founding of the early communities, the pic-ture has changed dramatically. The rank and file sisters are no longer uneducated followers. Vatican Council II has told us that the Holy Spirit breathes up ~rom below, that is, He speaks and points out the way through the person of each and every member of the community. In the summer of 1967, the 48 Maryknoll Sisters working in Korea, considering the problems of the past, the directions of the future, and the urgings of Vatican Council II (that "all members of the community have a share in the welfare of the whole community and a responsibility for it"--~om the Decree on Ap-propriate Renewal o[ Religious Life, n. 14), began to draw up a new plan for regional government. This plan was to provide for sharing more broadly the burdens of responsibility, participation of every member in the decision-making and planning of community affairs, and to foster in each member a mature spirit of initiative and involvement. The experiment is at present under way with three elected members now jointly sharing the responsibilities that had previously belonged to the regional superior. 4, 4, Siste~ Patricia Norton is missioned at the Maryknoll Hospital; P.O. Box 77; Pusan, Korea. VOLUME 28, 1969 907 REVIEW FOR RELIGIOU$ (Note: The work of the Maryknoll Sisters in Korea is designated as a regional unit.) No one of these is superior to the others in authority or responsibility. Each one is responsible in the area that has been allotted to her: Personnel, Administration-finance, and Planning-research respectively. These three sisters are known as the Regional Team. Although each one has her area of responsibility, she does not bear this burden alone. Each of these team members has a corresponding committee of 4 regular members and one alternate member. Each committee meets once a month and the results of these meetings constitute the agenda for the meeting of the Regional Team (the three team leaders). The Regional Team also aims at meeting monthly as high priority has been placed on the value of close and frequent communications. It is felt that real participation of each and every mem-ber of the region is dependent on the thoroughness of these communications. In addition to the monthly meetings of both team and committees, good communications are fostered by availa-bility of the minutes of the Regional Team, of each of the three committees, and the publication of the agenda before each meeting. With the publishing of the agenda, each sister is invited to respond with her ideas, sugges-tions, objections, and so forth to any item on the agenda. This is one technique to insure participation by every individual. Furthermore, all those sisters who are neither mem-bers of the team nor of one of the committees become members of an interest area. The latter means that the sister has indicated her interest in one of the areas, follows the activities of that committee in par-ticular, and is ready at any time to fully participate. The Maryknoll Sisters are divided among six houses in Korea. In the event that one of these houses does not have a particular committee member, one of the in-terest area members acts as contact person for that house. Planning for this experiment began in early Fall of 1967. It was formally inaugurated at a regionwide work-shop in October of that year. Since that time it has undergone several evaluations resulting in both minor and major changes. What so far have been the advantages and disad-vantages in regard to this experiment? Some of the disadvantages: ---outsiders who have contacts with the Maryknoll Sisters do not understand it; --it is expensive (train travel and postage) and time consuming; ---it deprives the other sisters of that leisure they used to have while the superior did all the work. Some of the advantages: --it takes the heavy, burden from the shoulders of one person and spreads it" out over the shoulders of all; --it provides for the utilization of the ideas, inspira-tions, and talents of each person rather than just two or three; --it provides for decisions to be made at the level at which they are carried out; --it helps to uncover and develop leadership qualities in a wider spectrum O[ persons; ---it allows for a more truly Christian li[e [or each sister as a completely participating person, con-scious of her own role of responsibility for the success or failure of Maryknoll works in Korea; ---it cuts down dissatisfaction and provides a channel for rectifying any dissatis[actions that may occur. The comment was made by one observer: "It deprives the religious of that necessary sacrifice involved in obedience to a superior." Those who have been living ¯ this experiment would strongly differ. Obedience is not a vanished thing. It is merely the focus that has changed. Decisions are made through group-to-group or individ-ual- to-group dialogue and the individual remains open and ready to obey the results of this dialogue. It is now two years since the initial idea for this type of government was discussed. Since that time there have been many pros and cons, many wrinkles to be ironed out. It has been said by informed sources that such an arrangement Without ultimate responsibility resting in one person can never be a success. The Maryknoll Sisters are willing to concede that this may be true. But they are not willing to concede without an earnest trial. ÷ ÷ ÷ VOLUME 28, 1969 9O9 WILLIAM A. HINNEBUSCH, O.P. Origins and Development oJ Religious Orders William A. Hin-nebusch, O.P., teaches ecclesiastical history at the Do-minican House of Studies; 487 Michi-gan Avenue, Waahington, D.C. REVIEW FOR RELIGIOUS 910 An# attentive study of the origins and history of reli-gious orders reveals that there are two primary currents in religious life--contemplative and apostolic. Vatican II gave clear expression to this fact when it called on the members of every community to "combine contem-plation with apostolic love." It went on to say: "By the former they adhere to God in mind and heart; by the latter they strive to associate themselves with the work of redemption and to spread the Kingdom of God" (PC, 5). The orders1 founded before the 16th century, with the possible exception of the military orders, recognized clearly the contemplative element in their lives. Many of them, however, gave minimum recognition to the apos-tolic element, if we use the word "apostolic" in its pres-ent- day meaning, but not if we understand it as they did. In their thinking, the religious life was the Apos-tolic life. It reproduced and perpetuated the way of living learned by the Apostles from Christ and taught by them to the primitive Church of Jerusalem. Since it was lived by the "Twelve," the Apostolic life included preaching and the other works of the ministry. The pas-sage describing the choice of the seven deacons in the Acts of the Apostles clearly delineates the double ele-ment in the Apostolic life and underlines the contem-plative spirit of the Apostles. The deacons were to wait on tables; the Apostles were to be free to devote them-selves "to prayer and the ministry of the word" (Acts 6:~4~). ¯ This is the text of an address given to the annual meeting of United States major superiors of men religious held in June, 1968, at Mundelein, Illinois. x I use the words, "order," "monasticism," and their derivatives in a wide sense to include all forms of the religious life. In its strict sense "monasticism" applies only to the monks and does not extend to the friars and the clerks regular. There were, however, exceptions to the general rule that monks did not engage in the ministry. An Eastern current of monasticism, influenced by John Chrysostom, viewed missionary work as a legitimate activity of the monk; and, as we shall see, many Western monks shared this conviction. Nevertheless, missionary activity did not become an integral part of monasticism. Even after most monks became priests, they considered their vocation to lie within the monastery where they could contemplate and dedicate themselves to the service of God. Since the clergy did not embrace the religious life, with the ex-ception of those of Eusebius of Vercelli and Augustine of Hippo, the ministerial element remained generally absent from the religious life until the development of the canons regular. In itself the life of the monks was exclusively contemplative. "Tradition assigns no other end to the life of a monk than to 'seek God' or 'to live for God alone,' an ideal that can be attained only by life of penance and .prayer. The first and fundamental manifestation of such a vocation is a real separation from the world." Yet in the thinking of the monks and of the friars, who integrated apostolic activity into the religious life, their prayer, contemplation, and example were mighty forces working for the upbuilding of the Body of Christ. Foundation o[ Monasticism Though other Scriptural elements contributed to the origin of monasticism, the concept of the Apostolic life was the decisive force. This truth has been demon-strated by historians who have been studying this point for over half a century; it has recently been dis-cussed scripturally by Heinz Schiirmann, professor of New Testament exegesis at Erfurt. The historians show how the life of the Apostles and the primitive Christians influenced the origins and growth of monasticism; Schiirmann makes clear that the constitutive elements of the religious life were taught to and demanded of the Apostles by Christ. Religious life is rooted in the key Biblical texts that record the calling and formation of the Apostles. These passages determine the character of the Apostolic office and the relationship of the Apostles to Jesus. They are to be with Him, listen to Him, and follow Him. His call is rigorous and imperious. He demands commitment without reserve. Negatively, this requires a complete break with one's previous life: family, wife, home, and oc-cupation; positively, it establishes the Apostles in a state of total availability. Abandoning their possessions, their means of livelihood and, like the lily and raven, trusting completely in divine providence, they follow Christ, + ÷ ÷ Religious Orders VOLUME 28, 1969 9]] W. A. Hinnebusch, 0~. REVIEW FOR RELIGIOUS 912 putting themselves in a student-teacher, servant-master relationship to Him. All .the features of their new life with Him are already conveyed in brief in Mark's ac-count of their call: And going up a mountain, he called to him men of his own choosing, and they came to him. And he appointed twelve that they might be with him and that he might send them forth to preach (3:13-5). In this text, too, we find the first s~atement of the contemplative and apostolic elements that reappear in the religious life. They are "to be with him." Here is the contemplative element. They are "with him," devoting themselves to the "one thing necessary"--listening to His word. Yet in hearing and learning .they are made ready so "that he might send them forth to preach." As Schiirmann summarizes it: First they hear and learn, then they teach and act: "Preaching isonly one part of their life and its follows from the other." The Apostles enter irrevocably into a community of life with Jesus. They share His life and destiny: eat with Him, walk the dusty roads with Him, serve the people with Him, undergo His trials, conflicts, persecu-tions. They must be ready to hate and even to lose their lives for His sake. He wants total obedience, one based on their "faith in Him who calls and proposes the word of God in an entirely unique fashion. Their following of Christ becomes understandable only as a permanent state of profession of faith., fit] opens up a new pos-sibility of existence, a new manner of being-in-the-world, a new 'state' of life." Though the Apostles take no vows, their life is that of the three counsels. Christ imposes no greater moral de-mands on them than on all the other believers, but they alone live this close community life with Him. Not all who declare for Christ are chosen by Him to follow Him in this intimate, permanent way. Obviously Mary, Martha, and Lazarus do not. Others asked to be ad-mitted into the group of disciples but were not accepted. Mark (5:18-19) describes one case: As Jesus was getting into the boat, the man who had been afflicted by the devil began to entreat him that he might re-main with him. And he did not allow him, but said to him, "Go home to thy relatives, and tell them all that the Lord has done for thee, and how he has had mercy on thee." (See also Mt 11:28, Mk 3:35, Lk 12:8-9, 10:38-42, 9:61-2.) Being with Christ constantly, hearing His word, com-pletely obedient to His wishes, separated from family, home, and occupation, the Apostles enter a new form of existence that signifies. The prime purpose of their spe-cialized following is to declare themselves openly for Him, so that all might come to believe in Him. In a strikingly visible way their intimate following pro-claims to the Jewish world that the one thing necessary is to hear the word of Christ and to keep it. Their visi-ble, stable following becomes a sign to the world. Only after they have made this permanent commitment are they sent out to preach and to act. At every step in monastic history, whether in its ori-gins, renewals, or creation of new forms, the Apostolic life taught by Christ to the Twelve, and by them to the primitive Christian community of Jerusalem, was the leading and most powerful influence. The Gospel texts and those in the Acts of the Apostles that describe the primitive community were decisive in creating the con-cept of monasticism and in fashioning its life and usages. In the Jerusalem community we find fraternal unanim-ity, common ownership of possessions, fidelity to the teachings of Christ, common public prayer, intense pri-vate prayer. The following passages embody all these features: Now the multitude of the believers were of one heart and soul, and not one of them said anything he possessed was his own, but they had all things in common (Acts 4:32). And they continued steadfastly in the teaching of the apostles, and in the communion of the breaking of bread and in the prayers. And all who believed were together and held all things in common. And continuing daily with one accord in the temple, and breaking bread in. their houses, they took their food with gladness and simplicity of heart, praising God and being in favor with all people (Acts 2:42-7; see also 1:14, 3:1, 6:4,34; Mt 10:gff). The ministry of the word, evangelical preaching of salvation, was c~irried out by the Apostles (Mk 6:6-13; Acts 6:4), a mission that entailed indefatigable journey-ing (Mt 10:7if; Mk 6:6-13; Acts 6:4). Only the pre-dominately lay character of early monasticism delayed the full realization of the ministerial mendicant orders. For centuries monks examined and lovingly scruti-nized the texts. The power that they exercised over monastic founders is illustrated by the passage where Athanasius describes the origin of Antony's vocation in his Life of Antony: As he was walking along on his way to Church, he col-lected his thoughts and reflected how the Apostles left every-thing and followed the Savior; also how the people in Acts sold what they had and laid it at the feet of the Apostles for distribution among the needy; and what great hope is laid up in Heaven for such as these. With these thoughts in his mind he entered the church. And it so happened that the Gospel was being read at that moment and he heard the passage in which the Lord says to the rich man: "If thou wilt be perfect, ¯ go sell all that thou hast, and give it to the poor; and come, follow me and thou shalt have treasures in heaven," 4- 4- Religious Orders VOLUME 28~ 1969 W. A. Hinnebusch, O.P. REVIEW FOR RELIGIOUS As though God had been speaking directly to him, An-tony left the church, sold what he had, gave it to the poor, and went into the desert. During subsequent centuries the Scriptures lost none of their influence over monasticism. The Apostolic texts led to much more than the abandonment of riches and fleeing the world; they provided a complete program of life in community. Explaining the origins of monasti-cism about 1122 A.D., Abbot William of Saint-Thierry shows how the meditation of hundreds of years had sys-tematized the Scriptural influence: We come to this spiritual sbciety of which the Apostle Paul spoke to the Philippians (2:1-5; 3:17) in praise of the regular discipline and of the sublime joy of brothers living together in unanimity. To do justice to this discipline it is necessary to return to its beginning in the time of the Apostles, since it was the Apostles themselves who instituted it as their own way of life, according to the teaching of the Lord. Unless it was the grace of the Holy Spirit which gave them power from above to live together in such a way that all would have but one heart and one soul, so that everything would be held in common, and all would be continually in the temple in a spirit of harmony. Animated by a great !ove for this form of life instituted by the Apostles, certain men wished no longer to have any other house or any other lodging than the hbuse of God, the house of prayer. All that they did they did according to a common program, under a common rule. In the name of the Lord they lived together, possessing nothing of their own, not even their bodily strength, nor were they even masters of their own will. They lay down to sleep at the same time, they rose up together, they prayed, they sang Psalms, they studied together. They showed the fixed and changeless will of being obedient to their superiors and of being entirely submissive to them. They kept their needs to a minimum and lived with very little; they had poor clothes, a mean diet, and limited everything according to a very precise rule. Influence o[ Cassian Soon after Antony went into the desert, the influence of the Scriptures on monastic origins was enhanced by a misconception of Eusebius and Jerome, who mistakenly believed that the Apostolic life of the primitive Jerusa-lem community was followed in Alexandria, Rome, and other centers. Writing a century later, Cassian developed this misconception and found in it th~ explanation of the rise of monasticism: The conversion of the Gentiles forced an abandonment of the Apostolic way by the ma-jority of Christians, even by the clergy. More zealous souls refused to give it up and founded communities to perpetuate it. This theory was very fruitful in its effects when it was coupled with the example of Antony and Pachomius, the founder of the cenobitic life, who were inspired by the Scriptures alone. This fusion constituted a powerful op- erative force in the development of monasticism for many centuries. Scarcely any monastic 'author was read so continuously as Cassian. As late as the thirteenth cen-tury, St. Dominic was reading his Conferences. Con-stantly read and reread, Cassian's books [ashioned the medieval--and our ownnmonastic life. The Holy Spirit at Work in the Church The truth underlying Cassian's error is the almost simultaneous appearance of the religious life everywhere that the Church took root. The origin of the monastic life was a spontaneous manifestation of the Holy Spirit impelling Christians to live the life of the counsels taught by Jesus. Antony was merely the first to emerge, thanks to Athanasius, from the anonymity that conceals the virgins, celibates, and ascetics who preceded him. The impetus of the Spirit is seen particularly in the early acceptance of the virginal life by both men and women as a prime means of following the Master. From the end of the first century there are references to ascetics who lived continently "in honor of the flesh of Christ." After the third century virgins were looked upon as "the most illustrious portion of the flock of Christ" and were considered the spouses of Christ. Perfect continence, to-gether with voluntary poverty and austerity of life, was a constitutive element of the ascetical life that began to develop in the second century. Though these ascetics lived in their homes, sometimes holy women, widows, and virgins formed small communities that were marked by considerable personal freedom. The general reverence of the Church for chastity when Antony became a hermit about 300 A.D. accounts in large measure for the immediate wide diffusion of the eremitic and cenobitic forms of monasticism throughout the Christian world. The dynamic power of the Holy Spirit has been con-stantly operative during the history of the religious life. Here again there is a link with the early community of Jerusalem. These Christians, as we find their record in Acts, were very conscious of the action of the Spirit in their lives and apostolic works. Theirs was a life lived in the ~lan of the Spirit, as Vicaire remarks. ImmediateIy after describing the primitive community, the Acts of the Apostles goes on to say: "And great grace was upon them all" (4:33). This grace made itself visible even by miracles: "And many wonders and signs were done through the apostles" (2:43). When William of Saint-Thierry, whom I quoted a few pages back, described monastic origins, he manifested the awareness the monks had that the charismatic power of the Spirit was at work among them. In William's think-ing it was the "grace of the Holy Spirit which gave [the ÷ ÷ 4. Religious Orders VOLUME 28, 1969 W. A o Hinnebusch~ O.P. REVIEW FOR RELIGIOUS Apostles] power from above to live together in such a way that all would have but one heart and one soul, so that everything would be held in common . '~ Cen-turies before, Gregory the Great, writing his Dialogues within fifty years of the death of Benedict, described the great patriarch of Western monasticism as the ideal "man of God," the spiritual father who was entirely under the guidance of the Holy Spirit. The attention paid to the miracles worked by the founders and great figtires of monastic history is not merely a thoughtless emphasis on the secondary but was motivated by. the belief that the true monk, living in community, possesses an extraordinary grace for radiat-ing sanctity and contributing to the upbuilding of the B6dy of Christ. He can even receive from the Spirit the power of working miracles. The present-day interest in the charismatic character of the religious life and the charismatic founders is a legitimate, more explicit, recognition of the power of the Spirit working through all the years of monastic history. His role in the religious life deserves more attention and should awaken in us a great hope in the future of the religious life. Antony the Hermit Monasticism entered the pages of history close to the year 300 A.D. when Antony, the great hermit, gave away his possessions and retired to the Egyptian desert. The holiness and ordered discipline of his life, characterized by solitary contemplation and a severe but lofty and well-balanced asceticism soon brought other hermits to him for direction. Great colonies of solitaries arose under Antony's direction, especially at Pispir, where he lived, and at Nitria and Scete. These disciples lived alone like their master. Antony found so many imitators because of his moral greatness at a time of growing wickedness in the contemporary world. When Constantine ended the per-secutions and began to favor Christianity, the consequent lowering of the moral level of Christian life stimulated the development of a powerful ascetical movement, in-spired by the Gospels, on the ~ringes of the populated world. Antony became the model of the movement, especially after the appearance of his Life, written by Athanasius in 357 A.D., a year after Antony died. Gre-gory of Nazianzen called it "a rule of monastic life in the form of a narrative." Athanasius, who had known Antony personally and had seen him often, considered "the life of Antony an ideal pattern of the ascetical life." He intended to hold up Antony as the exemplar of the consecrated life and induce his readers to imitate what they saw. The work enjoyed a~tonishing success and was shortly translated into various languages. Antony, earnestly desiring to die the death of a martyr, went to Alexandria in 311 A.D., when the persecution of Maximin Daja broke out, to minister to the confessors in the mines and prisons, not thinking it justified to turn himself over to the authorities. When his hopes were dis-appointed, Antony returned to his desert cell where "he was a daily martyr to his conscience, ever fighting the battles of the faith. For he practiced a zealous and more intense ascetic life." With this short passage Athanasius enriched monasticism at its very birth with a positive view of asceticism and the renunciations involved in the life of the counsels. Antony's life in the desert was a substitute martyrdom and the monk the successor to the . martyr, a concept that remains alive to this day. Pachomius the Cenobite The weakness of the ei:emitical life lay in the minimal opportunity for practicing charity. Pachomius remedied this defect when he formed a genuine fellowship based on the communal charity inherent in Christianity. He composed the first monastic Rule, in it establishing the economic and spiritual bases for the common life and providing for community government. A younger con-temporary of Antony, Pachomius first served an appren-ticeship under the hermit Palaemon. Then about the year 320 A.D. he established a monastery at Tabennisi on the right bank of the Nile. Other monasteries soon followed, so that when he died, nine for men and two for women were under his guidance. These foundations were large settlements of monks who were organized into smaller groups according to the kind of agricultural work they did or the crafts they practiced. They lived a disciplined life, practiced individual poverty and de-tachment in essential matters, supported themselves by remunerative work, gathered for prayers morning and evening, and observed the three counsels, though they took no vows. Numerous biographies testify to the esteem in which Pachomius was held and the extent of his in- ~uence. Basil the Great The eremitical and cenobitic types of monasticism spread quickly both in East and West. Basil the Great, who benefited from the experience of the previous half century bf monastic experience, became the lawgiver of Eastern monasticism when he wrote his Longer R

Issue 24.3 of the Review for Religious, 1965. ; Counseling and Religious Life by Vincent S. Conigliaro, M.D. 337 Mortification by William J. Rewak, S.J. 363 Mary and the Protestant Mind by Elsie Gibson 383 The Mass and Religious Life by Jean Galot, S.J. 399 Devotion to the Sacred Heart by Anton Morgenroth, C.S.Sp. 418 Priest as Mediator ~ by Andrew Weigert, S.J. 429 Religious Life by Sister Elaine Marie, S.L. 436 Election: Choice of Faith .by Carl F. Starkloff, S.J. 444 Our Old Testament Fathers by John Navone, S.J. 455 Poems 461 Survey of Roman Documents 463 Views, News, Previews 467 Questiom and Auswers 473 Book Reviews 478 VINCENT S. CONIGLIARO, M.D. Counseling and Other Psychological Aspects of Religious Counseling,* a technique and a philosophy of treat-ment and human relatedness, is a topic of importance to both psychoanalysts and religious persons, both in a general and in a specific context: in a general context, because both psychoanalysts and religious persons work with human beings and are committed to a profession of service; and in a specific context, because religious sisters may be affected by mental problems as often as other individuals. Thus, in reflecting on counseling in the religious life one cannot help reflecting also on the problems making counseling necessary, the problems, in other words, about which one administers counseling; and on the factors behind these problems, that is, why these problems occur in the first place. Members of religious orders have been the victims of diverse, benevolent and malevolent, prejudices for cen-turies. One problem with prejudice is that sooner or later its victim comes to believe the prejudice himself and begins to think, feel, and act along the prejudiced stereotypes culture and/or society set up for him; this is why prejudice is always detrimental. As an example, one may think of just one of the many prejudices that have been formulated against the American negro: the prejudice whereby the negro is "good-natured," "basi-cally lazy," "clownish," a. jocular Amos or Andy. Even- # This paper was derived from a talk given by the writer on No-vember 9, 1964, at the Maryknoll Mother House; Ossining, New York; the paper was sent to the REvmw in December, 1964. 4- Vincent Conigli-aro, M.D., a prac-tising psychoana-lyst and member of the faculty of Ford-ham University, ihas offices at 104 East 40th Street; New York 17, New York. VOLUME 24, 1965 337 + ÷ ÷ Vincent $. Conigliaro, M.D. REVIEW FOR RELIGIOUS 338 tually, some negroes began to believe the stereotype themselves and behaved as if they could only be an ineffectual nice-guy Amos or a scheming, shrewd Andy-- or the other way around--I could never tell the two apart. Among the many prejudices formed about Catholic religious orders, there is one that proclaims that "mem-bers of Catholic religious orders are, by the very fact of being that, singularly immune from mental disorders"; or the opposite one, announcing that "members of Catholic religious orders are, by the very fact of being that, singularly prone to become mentally sick." Both prejudices of course are just that, pre-judgments, based on little factual evidence and substantiated by super-ficial experimentations. The facts actually suggest that (a) members of Catholic religious orders do not become mentally ill significantly more often or significantly less often than members of other religious orders; when they do become ill more often, this relates more to circumstantial problems (that is, poor screening of applicants) than to essential fea-tures of religious life; (b) members of religious orders do not become mentally ill significantly more often or less often than members of other tightly organized, rigidly structured organizations, for instance the Army; (c) neither the essential nor the accidental characteristics of religious life make, per se, a significant difference in the incidence of mental disease among the members of Catholic religious orders; (d) the occasional severity in degree of mental illness encountered among members of Catholic religious orders is not related to the essential or accidental characteristics of religious life, but to socio-cultural characteristics at large (for instance the socio-cultural concept that "to have a mental illness is dis-graceful"; treatment, thus, is sought too late, when the illness has been given the time to become severe); and (e) that the intrinsic and extrinsic features of religious life will be, psychologically, an asset or a liability ac-cording to the way each individual reacts to them in terms of life history, heredity, and childhood experi-ences. It may be of interest to examine both prejudices more closely. The first view holds that Catholic religious life is the best guarantee against emotional upsets and claims that members of Catholic religious orders rarely become affected by mental disease. This view is mostly held by members of religious orders; it was frequently expressed to me by the superiors of sisters I have treated or by the priest-counselors I have trained and supervised. The basis of this prejudice is wishful thinking and con-fusion between the natural and supernatural aspects of religious life. This view equates the symptoms of mental illness with the illness itself: ."There are no visible signs of illness; ergo, there is no illness . " I am reminded of an article recently published in a religious journal implying that religious life may actually "cure" neurotic symptoms. The writer of the article first listed some of the traits that may be symptomatic of a neurotic per-sonality, that is, self-centeredness, hypersensitivity, im-maturity; then observed, rightly enough, that religious life is essentially antithetical to such traits: and then concluded that religious life will thus automatically dis-pose of these neurotic traits: religious life, being theo-centered, will dispose of self-centeredness; being giving-hess, will dispose of selfishness; requiring spiritual ma-turity, will dispose of immaturity. One rather suspects that all theocenteredness, givingness, and spiritual ma-turity will do is to veil, temporarily, those neurotic traits they were supposed to have cured. This prejudice, actually, is quite unfair to the re-ligious sister. It suggests that the supernatural aspects of the sister's vocation will sustain not only her soul, which it does, but also her mind, even when natural causes, going all the way back to her childhood, act as a constant irritant; it holds that since she is isolated from the anxieties of the "real world outside," she should have no anxieties from the convent world (which happens to be equally real); and that since she is surrounded by the silence of the cloister, she will not hear the loud clatter of human problems: as if silence, at times, could not be many times louder than the loudest noise. This prejudice also engenders unrealistic attitudes; the religious sister feels supernaturally protected against the frailties of the human mind, and is led to believe that, by sheer virtue of the spiritual direction of her life, whatever factors there were that started operating, years before, toward the development of a psychosis or a neurosis will magically cease to operate. When she ex-periences signs of a mental illness, she feels disillusioned and as if God Himself did not live up to His part in a bargain He had never made; and she feels like a freakish rarity, the only one cursed by an illness that was not supposed to occur, the exception to the rule, thus adding to the anxiety and anguish of a neurosis the painful feeling of being an oddity. In a sister I treated, the latter feeling constituted a very intense symptom that, while mainly determined by a complicated intrapsychic proc-ess, was supported by the prejudiced belief that "reli-gious sisters are not supposed to become mentally ill . " This prejudice creates a problem also in treatment: the sister may be unwilling to unveil her problem to a superior who could take remedial steps; or, once treat- 4- 4- 4- Counseling VOLUME 24, 1965 339 ÷ + ÷ Vincent S. REVIEW FOR RELIGIOUS 340 ment has started, may be little cooperative and may rationalize her resistance to change by believing that "she can only get better through prayer . " In a case I recently worked with, it was the patient's superior who felt sister should not receive psychotherapy and should only help herself with prayers: "Good sisters do not be-come mentally ill . " On the other side of the coin is the prejudice holding, equally erroneously, that members of Catholic religious orders become mentally ill significantly more often than other persons. This view is mostly held by persons who are not in the religious life, are not Catholics, and, fre-quently, not religious. I believe this prejudice is mainly based on hostility; or on a lack of understanding of what is entailed in the religious life. The danger of this view is that already unbalanced members of religious orders lead a life of trepidation based on the neurotic fear that they will become overtly mentally ill (psychotic, "insane") because "everyone says so . " Here, too, this fear is overdetermined and related to an unconscious intra-psychic process; here, too, however, these patients "latch on" to the prejudice to express unconscious needs. In a priest I treated, the idea that he was going to become insane---because everyone he knew believed that "all priests, sooner or later, become insane"--had become a true obsessional idea; it expressed, among other things, his unconscious desire "to become insane" (more exactly, his unconscious drive to lose all controls and inhibitions) and his need to impute the responsibility of his insanity to those who believed that "all priests, sooner or later, become insane . " At the basis of this prejudice is also the fact that the religious life does have features which, in borderline personalities, may tip the balance in the direction of mental illness. A better understanding of these features will help to understand how religious life may contribute to t,he development of a mental illness. I want to make sure that I am well understood on this point. I am not suggesting that religious life may be the cause of mental disorders; I am saying that some features of religious life, when operating on a personality that has been af-fected by specific childhood occurrences, may precipitate, or "trigger," mental illness. This "trigger effect," evi-dently, may be set up just as effectively by college life, army life, marriage, as it can by religious life: once the keg is filled with dynamite, the explosion may be set up just as well by a spark of electricity, a match, or a gradual increase in room temperature. Which features of religious life act as a trigger on what kind of personality-- this is what may be quite important to reflect on. One might start by reflecting on the spiritual essence of religious life. Considering that this journal is widely read among members of religious orders, there is a bit of "carrying coals to Newcastle" in reflecting on this sub-ject at all. It must be remembered, however, that the specialist, knowledgeable as he is on the most minute detail of his specialty, often misses what may be too basic for him to remember. Basic psychiatric and psy-choanalytic concepts have been pointed out to me by friends who were neither psychiatrists nor psychoanalysts; and I myself have been able to point out basic points on music or art to musicians or artist friends of mine. As a lay person, as a "non-specialist" on religious life, I understand religious life as a life of greater growth in greater union with God~ All of us are born with the potentials for greater and greater participation to a transcendental existence in God; but those in the reli-gious life have the greatest chance of achieving the greatest participation. This spiritual participation, how-ever, can only be realized if the personality is sound; and a healthy supernatural life cannot exist without a sound, well-integrated psychic life. The old Latin saying mens sana in corpore sano can indeed be complemented with religio, sana in mente sana. It must be realized that the accidental properties of religious life may appeal to different personalities for different reasons. Just as one may become a psychiatrist or a surgeon for a combination of healthy, unhealthy, conscious, and unconscious reasons--and a good psy-chiatrist is usually one who, finally, is in his profession more for healthy and conscious reasons than for un-healthy and unconscious ones--it is also possible to enter the religious life with a combination of healthy, un-healthy, conscious, and unconscious motivations. Un-balanced personalities, the individuals with the "keg of dynamite" beneath the placid exterior, may enter the religious life attracted not by its spiritual features but by what these persons unconsciously consider useful for their neurotic needs. When the latent neurotic individual has been attracted to the religious life, religious life will indeed have the "trigger effect" mentioned before. Some examples at this point may be helpful. Religious life, through its essence, offers, to the healthy, opportunities for spiritual and existential richness and for the fullest expression of one's personality; to the unhealthy, opportunities for an impoverished, restricted existence (again spiritually and existentially) and for the fullest expression of one's neuroses. Such features of religious life as the vows of chastity, obedience, and poverty, may attract the latent neurotic personality not 4- 4- 4. Counseling VOLUME 24, 1965 ÷ 4. + Vincen£ $. Conigllaro, M.D. REVIEW FOR RELIGIOUS because of their essential spirituality but because of the opportunities they offer for neurotic defenses and neu-rotic acting-out. The healthy religious sister has a greater chance of experiencing the transcendental union with God, not in spite of, but because of her vows; the unhealthy sister uses the vows to express instinctual drives and neurotic defenses. In the latent neurotic, the vow of chastity may be appealing for reasons having little to do with spir-ituality, that is, emotional frigidity, fear of love, fear of sex, homosexual tendencies. The all-female environment may be chosen not in order to be chaste to better serve God but because of fear of closeness to anyone. This sister will be fearful of any and all emotional involve-ments, will stand aloof, and will withdraw from every-one, God included. Similar situations have been found with regard to the vow of obedience. As it was once ex-plained to me by a sister student of mine, this vow is "a listening to the will of God as it is expressed through one's community, environment and, ultimately, supe-rior"; a "dialogue in charity," with the superior as the "master listener" fashioning the dialogue between the sisters and God and evaluating what has been heard as the will of God. The sister who enters the convent with healthy motivations can afford to be obedient: she can see God's will beyond the superior's will; the sister with unresolved authority problems cannot be obedient with-out hostility (and the superior affected by the same problem will tend to abuse her authority and provoke rightful resentments). In the obsessive-compulsive per-sonality, which, under a meekly submissive and ingra-tiatingly passive surface, much anger and rebelliousness are concealed, vows of obedience will have a strong neu-rotic appeal to begin with (unconscious wishes to placate authority~ neurotic resolutions of total passivity and total submission) and will trigger, later, serious conflicts. Sister may role-play complete obedience and submission to the point of making no contributions whatsoever to the community life; she may be passive and overdependent; have no intiative; obey automatically, making no repre-sentations even when representations are called for; and create a mockery of authority and a caricature of obedi-ence by indulging in what has been called "whole obedi-ence" as contrasted to "holy obedience." The vow of poverty, too, essentially beautiful (with no material possessions one can better pursue the knowl-edge of God) may be appealing not for spiritual.reasons but because of unconscious feelings about money, love, and possessions. A sister may enter the religious life because of insecurity and the semi-conscious realization that although in the convent she may not have personal possessions, her basic needs will be adequately met. A sister I treated equated having money and possessions with having evidence of being loved. She created a prob-lem in the community by hoarding things, demanding expensive clothes and privileges, requiring costly medical treatments (and feeling intensely guilty when her demands were acceded to). When she did initiate psy-chiatric treatment, the matter of payments was a monthly crisis. She reacted to the fact that the com-munity was disbursing funds for her health not with realistic gratitude--or realistic concern--but with intense guilt (at the fact that a neurotic fantasy about which she had much ambivalence was being satisfied). If the neurotic needs of the religious are actually met by some of the accidental features of religious life, why, then, is there a conflict? I[ a sister with neurotic feelings about authority enters the religious life to find a better disguise--or a better expression--for these feelings and, in some o~ the accidental features of religious life does meet this opportunity, then, again, why is there a con-flict? One way to understand this is by realizing that human drives are arranged by "polarities": we love and hate, like and dislike, are active and passive, assertive and sub-missive, dependent and independent. In the healthy personality these polar extremes are harmoniously inte-grated and blended in the overall economy of personality, and there is no conflict. In the neurotic personality each polarity, as it were, is treated separately by the executive agency of personality, the ego; and each holds separately and simultaneously prospects of security and insecurity, pleasure and pain. Thus, by being overdependent, one is taken care of, but one's needs for prestige and successful competition are frustrated; and by being over-assertive one fulfills one's needs ~or power and status, but one's need to be loved, cuddled, mothered are frustrated. As an example, a sister with unresolved authority problems enters the convent to placate her superego by total sub-missiveness; this will fulfill the polarity of dependency, passivity, submission; but the opposite polarity, which energizes rebelliousness and independence, will have to be vigorously repressed and will remain frustrated. This will result in a worsening of the authority problem; symptomatologically, there will be dissatisfaction (frustra-tion of one polarity); chronic fatigue (because of the need to divert psychic energy to the task of repressing the polarities of rebelliousness and independence); periodic explosions (during which the polarities energizing sub-mission and passivity are frustrated); feelings of guilt; and so forth . One is reminded of what is found in the neurotic marriage, in which the partners marry one + ÷ ÷ 343 4. Vincent S. Conigllaro, M.D. REVIEW FOR RELIGIOUS 344 another because each offers the other the opportunity for the disguise and the release of unconscious drives. The man with latent homosexual problems marries a frigid, cold woman; the outwardly efficient, "strong" male (the type who exaggerates the outward signs of masculinity because of deep seated feelings of inadequacy) marries a woman who under a calm and restrained exterior is assertive and domineering; a woman with unconscious sexual anxieties marries an impotent male; and so forth . In these cases too, the neurotic bargain is fulfilled and the unconscious expectations which have led to the marriage in the first place are being satisfied: this is why the marriage fails or is beset by severe incompati-bility. I am reminded of a patient in my recent experience, a bright and attractive woman with severely disturbed ideas on sex and much anxiety and guilt about any type of sexual involvement; these feelings were unconsciously rationalized by the conception that sex is "always degrad-ing" and "inherently dirty." She did not marry until the age of thirty-two: the healthy, eligible males who had appeared on the scene up to that time had not been "attractive" enough to her neurotic expectations. She finally met the "right" man: an extremely puritanic, neurotically judgmental individual who consciously visu-alized sex as dirty and degrading; he would subtly "seduce" her into giving in to rather innocent exchanges of affection and would then reject her by sternly lecturing her on the basic depravity of all women. After sixteen months of formal engagement, she married him primarily because she had found in him the external counterpart of her own rigid, punitive superego. It can be easily antic-ipated that this couple's marriage was extremely un-satisfactory. They found each other unbearable; he felt she was shamelessly passionate and "se.xy"; she felt he was sadistically judgmental and critical; and they both acted as though neither had had any idea (in sixteen months of engagementl) of what the other was "really like." The neurotic polarities of each of these individuals were being fulfilled through the neurotic marriage at the expense of intense anxiety, rage, and guilt. In the latent neurotic personality, religious life may trigger neurotic symptoms through some of its accidental features. While the essence of religious life is immutable, its accidental elements, the ways this essence expresses itself, are necessarily mutable and in a state of constant transition and adjustment to changing socio-cultural conditions. The transition itself may be disturbing to the rigid, obsessive personality. A sister I once treated could have functioned satisfactorily only if the Church had gone back to medieval times. A priest once told a colleague of mine, with much anxiety and bitterness: "They are changing my Church, Doctor; they are chang-ing my Church" (in reference to the Ecumenical Council). Some sisters' neurotic structure is such that they only accept meditation and contemplation, to the total exclu-sion of action; and they do this more for neurotic than spiritual reasons. It is also important to realize that religious orders are a world of their own, a society with its own culture (some religious orders even call themselves "societies"). The fact that there are to be rules is inherent in any society; but the religious societies are particularly bound by rules (the etymology of the Word "religious" is "rule-bound"). Some religious societies are very rigidly set up; there may be a rigid ordering of time (the "horarium," the setting down of every hour and activity of one's day from rising to retiring) or a rigid ordering of authority, community rank, behavior (the book of cus-toms). This system of rules may indeed appeal to a rigid personality or to persons with problems about routines, schedules, and time tables. These persons, again, will be attracted not by the spirit behind the rules but by the rules themselves, the scheduling for its own sake, the opportunities thus offered for neurotic defenses or neu-rotic acting out. Religious life indeed may, with its essential or transi-tional features, trigger neurotic symptoms in the latent neurotic personality. It may seem that this point is being belabored. Yet, in reading the religious journals read by most sisters, one finds cause for concern over the explana-tions prevalently given as to the causes o~ mental dis-orders among the religious. While the situation has im-proved considerably in the last fifteen years, there still prevails a lack of awareness of what really should be remedied; and why; and how. Often, we still bark up the wrong tree or beg the issue or believe that sister is neu-rotic simply because she has a difficult superior or because her order is a very rigid one, completely overlooking the fact that most probably these sisters had a neurotic prob-lem to begin with and the environment to which they are now overreacting has only brought the neurotic con-flict to light. I am reminded of a question asked by a group of sisters (and recently published in a religious journal) on the subject of the measures suggested by the Church to reduce tensions among the religious. The answer, as given by a well known and justly respected priest, gives cause to ponder; it suggests that, while the Church has recognized the importance of childhood in the causation of mental disorders, and, at least by implication, the importance of counseling and psychotherapy--these factors (childhood) ÷ ÷ ÷ Counseling VOLUME 24, 1965 345 ÷ ÷ ÷ Vincent S. Conigliaro, M~. REVIEW FOR RELIGIOUS 346 and these measures (counseling and psychotherapy) are, too often, seen as the least important. According to the above source, among the remedies suggested by the Church are, mainly, such remedies as avoidance of a disordered and restless life, a minimum of calm and peace, avoidance of overwork, enactment of the rule of silence (thus the availability of cloisters), vacations and weekly days off, and so forth . All these measures, I suggest, are far from meaningless; but also far from sufficient. All these measures are important; without them there will be anxiety and tension, but there will be anxieties and tensions in spite of them. A restless and disordered life most often is not a cause of mental illness but a symptom, just as the ability to live a joyful and pleasurable life is a manifestation of good mental health, not a cause. I remember a sister I once treated for a severe compulsive character neurosis, with symptoms of depression, scrupulosity, perfectionism, and chronic fatigue. She had been told (innumerable times) to take some days off and have a good vacation; for at least two years her rigid, grandiose, self-punitive personality had prevented her from doing so: there was too much to do and no one could do it as well as she. Sister was not tense because of overwork: she was tense and overworked because of a deeper common cause. When she was finally ordered to take a vacation and have fun, she worked strenuously and grimly at having fun with no benefit whatsoever from either vacation or recreation. Committed Catholics and psychoanalysts will grow equally concerned over the fact that we still too often believe that emotional illness among the religious is caused by such spiritual reasons as spiritual frustration or the feeling of not having attained the vocational ideal of apostolic sanctity. Spiritual frustrations, again, are more often symptoms than causes of mental illness; and to relate them to incomplete spiritual formation, poor spiritual training, and so forth, is often inaccurate. The psychotic sister will not feel better mentally by leading a better spiritual life; she will lead a better spiritual life when she feels better mentally. The sister with an authority problem will not become more obedient solely by forcing herself to become more obedient; and the sister obsessed with impure thoughts will not be able to solve her problem only with prayer. All this does not question the supernatural power of prayer; it simply questions whether the neurotic or psychotic sister can truly pray, or, better, how receptive one is to grace while in a state of severe neurosis or psychosis. The point, at any rate, is that if these sisters were able to be spiritually obedient, religiously fulfilled, prayerful, and so forth, they would not have these mental problems to begin with. Thus it is often a mistake, for a spiritual director or superior, to simply demand of the neurotic sister to pray more, implying that if she does, this will resolve all problems. When sister finds herself unable to do so, she will feel guilty and become more anxious and depressed; or an emotional problem which could have been cleared in a relatively short time (had counseling or psycho-therapy been administered immediately) is treated psy-chiatrically after months of attempts at treating it by supernatural means, and it may be too late. Evidently, the total answer to the mental problems of the religious does not lie only in counseling and psycho-therapy; but the latter should play a larger role than it played up to five or ten years ago and even larger than the role played now, a time in which the Catholic Church has already made so many strides in pastoral counseling,x The mental problem of the religious, I believe, can only be approached through a holistic concept in which supe-riors, sisters, social workers or psychologists, spiritual directors, pastoral counselors, and psychotherapists make available to the disturbed sister all available means to 1 The history and development of the Iona Institute of Pastoral Counseling well exemplifies these strides and the Church's positive attitudes on mental health. In 1959, Dr. Alfred Joyce, a New York psychiatrist and psychoanalyst, offered his services for a program of talks and seminars on pastoral counseling at the St. Francis of Assisi Church and Monastery in New York City. The Franciscan Provincial, Father Celsus Wheeler, O.F.M., and a Franciscan psychologist, Father George Fianagan, O.F.M., Ph.D., supported the program enthusiasti-cally and the following year Dr. Joyce, this writer, Dr. L. Moreault, Mr. F. Peropat and Dr. J. Vaccaro, under the leadership of Dr. Joyce, founded the St. Francis Institute for Pastora! Counseling, a pioneer-ing institute offering a two-year curriculum on the theory and practice of pastoral counseling. With greater and greater support be-ing received from the New York Archdiocese and Francis Cardinal Spellman, and through the dynamic encouragement of Monsignor George Kelley, Director of the Family Life Bureau of the New York Archdiocese, in 1962 the five founders of the St. Francis Institute transferred to Iona College (New Rochelle, New York) and associ-ated themselves to Brother John Egan, Chairman of the Department of Psychology of the College, to form the Iona Institute for Pastoral Counseling, the only institute of its kind in the Eastern United States. Since 1962 the institute, under the leadership of Dr. Joyce, has offered to larger and larger groups of Catholic priests (total enrollment for 1964-1965 was just under one hundred students) a unique, com-prehensive, three-year curriculum of courses and clinical supervision leading to a Master's Degree in Pastoral Counseling. The Institute's program is designed to develop in its students greater awareness of the psychological dimensions of the problems encountered in pas-toral activity; to foster understanding of the conscious and uncon-scious processes operating in a counseling relationship; and, in general, to increase the effectiveness of the Catholic priest's pastoral work. The Institute's program, therefore, is quite consistent with recent directives of the Holy See, that is, directives which have emphasized the need for the development and refinement of the special competencies required for the pastoral ministry in the twentieth century. + + Counseling VOLUME 24, 1965 ÷ ÷ Fin~en~ $. Conigliaro~ M.D. REVIEW FOR RELIGIOUS help herself, including prayer and spiritual self-improve-ment but also including counseling and psychological self-improvement. In a truly holistic approach one would also include preventative concepts and work toward the improvement of the existing screening procedures for the applicants to the religious life, the improvement and modernization of training programs for the religious, and the inclusion in these training programs of psychological considerations (mental hygiene concepts of education, group dynamics of training, and so forth). The latter, I believe, can be done very successfully without com-promising in the least the spiritual and religious con-siderations of training. One can think of counseling and the religious sister in many different ways. One may think of counseling admin-istered by a sister who has been trained in the theory and technique of counseling and who gives counseling to the sisters in her own house; the sister counselor may be the superior or another sister. One may think of counsel-ing administered by a trained sister who practices counseling as part of her own missionary, teaching, nurs-ing, or social work, in which case the counselee may be another sister or a lay person, male or female, adult, adolescent, or child. One may think of counseling in terms of "diagnostic counseling," "motivational counseling" and "therapeutic counseling." Finally, one may think of counseling as a philosophy of life, an existential commit-ment, a philosophy of deeper understanding of human psychology and human motivations, by which the trained sister becomes, in the house where she lives or at her place of work, a very valuable trouble shooter and "sig-nificant figure." One may think in terms of the superior of a house who has had enough training in counseling or psychology to do counseling with the sisters of her own house as soon as a problem arises and before it becomes too serious. This may be a "diagnostic counseling," in which the superior, after two, three, or four interviews, is able to recognize the "danger signals" of mental illness, can differentiate them from the symptoms of a strictly reli-gious or moral problem, and is therefore in the position of advising remedial steps. It may be a "motivational counseling," in which the superior has a number of sessions with the disturbed sister for the purpose of help-ing the sister to recognize the psychogenic nature of the difficulty and preparing her for therapeutic counseling or psychotherapy. It may finally be "therapeutic counseling" in which the superior, by using the technique of counsel-ing, helps the sister to help herself. I am convinced that it is administratively unfeasible for the superior of a community to do counseling with her own sisters; and, it administratively feasible, I am still convinced it would not be advisable therapeutically be-cause of the very nature o[ the superior's status in the community: the fact that she is, by virtue and necessity, identified with "authority" and because of the psycho-dynamic dimensions of being the "mother" superior. Better, then, for another sister to be the "house-counselor"; even in this case, however, it will be helpful it the superior is sympathetic to, and understanding of, the philosophy and the techniques of counseling; it will avoid friction between superior and house counselor and the unbalancing of the group dynamics of a religious community. Incidentally, should there be a "house counselor"? Should counseling be at all administered in the house, within the community, b~ an "insider"? I am convinced there are important advantages to doing so-- at least initially. This is in keeping with modem mental hygiene concepts, that is, the concept of "emotional first aid stations." Industrial psychiatrists have found that optimal results were often obtained by treating situa-tionally triggered emotional crises "on the job." In research on this subject I published a few years ago, I felt that the system of having a full time mental hygiene team on the premises is very advantageous. By having a house counselor, emotional emergencies can be handled on a truly emergency basis; situational and reactive crises can be approached more insightfully and with more perma-nent results. To conduct diagnostic and motivational counseling within the community appears advantageous also from a practical and financial standpoint. Finally, disturbed sisters may flatly refuse to see an outsider (especially lay) counselor or psychotherapist or may co-operate with the outsider only superficially. The presence of a house counselor on the premises and the fact that counseling is being practiced within the house may indeed have a disturbing effect on the group dynamics of a community, at least in some houses. This, however, is more an indication for, than against, the presence of a house counselor. If the community group dynamics can be unbalanced by her presence, then there already are neurotic processes operating under the sur-face. The processes would be triggered anyway by other "irritants"; they might as well be triggered by the house counselor, who can understand and treat group anxieties and individual anxieties. Some of the problems that may be triggered by the house counselor are: anxiety about the sister who is undergoing counseling ("There, but for the grace of God, go I"); resentments about the time she spends with the counselor or the superior (a form of sibling rivalry); anger (and envy) at the apparent fact that she is given ÷ Counseling VOLUME 24~ 1965 ÷ ÷ ÷ Vincent S. Conigliaro, M.D. REVIEW FOR RELIGIOUS 350 special privileges and dispensations (a sister I once treated said about another sister also in treatment: "They are letting her get away with murder . "); and so forth. Some of these problems might perhaps be prevented by utilizing a house counselor from a different house. A Maryknoll superior I recently spoke with suggested that two trained sisters from the same order but from two dit~erent houses could be exchanged between the two houses and be "on call." Parenthetically, I do not believe that one needs to be alarmed at the thought of a nonmedical sister counselor practicing "diagnostic" counseling. Although the formal diagnosis of any dis-order, whether "physical" or "mental," remains within the province of the medical doctor (psychiatrist or medical psychoanalyst), a well trained counselor is quali-fied to evaluate the severity of a mental disorder, formu-late hypotheses as to its course and prognosis, and differ-entiate it from solely moral or religious problems. What one should fear, rather, are the "snap diagnoses" made by untrained individuals in any walk of life: in the case of the religious sister, the diagnosis, "spiritual problem," with the prescription, "prayer, three times a day," for a problem that is mainly emotional in nature and needs counseling (or psychotherapy) as well. I referred above to the "understanding superior." I wonder how many sisters, troubled emotionally and mentally, did not feel, at some point, that it was-"all mother superior's fault., if she only had more under-standing . " I also wonder how many superiors, whose sisters were in the throes of a severe mental problem, did not feel, at some point: ". It's all my fault., if I had only had more understanding . " (I also wonder if some psychiatrists, in treating sisters with emotional problems, have not at times felt that it was ". all mother superior's fault., if she had only had more understanding . "). I believe there is something significant here and worth-while looking into. At times, undoubtedly, the superior is largely respon-sible for a sister's emotional problem as a "trigger factor," as precipitating element. More often, however, the superior is blamed because of the need for scapegoats, be-cause of the psychological tendency to explain difficulties in simple black and white, "good guy, bad guy" terms, and, finally, because of a specific psychological function called "transference." The truth of the matter is that to blame it all on the superior is incorrect; and if it is incorrect, it is also unfair: unfair to the sister, who likes to believe that changing houses will solve all her problems (she will go through one, two transfers to realize, after several cycles of heightened hope and frustrating letdown, that nothing has really changed in her mental status); and unfair to the superior, who will unrealistically blame her-self for her sisters' emotional problems and use this self-condemnation as a nucleus for her own neurosis. The interpersonal relationship of sister--superior is necessarily a very complex one; here, too, we find that in both its essential and accidental characteristics it offers opportunities for spiritual and psychological enrichment to the healthy and for neurotic expressions to the neu-rotic. The superior has full and unquestioned authority, because she represents, supernaturally, the will of God; the healthy sister willfully chooses to submit and defer because she can see the transcendental aspects of her submission and deference; the neurotic sister or superior sees, rather, a symbolic relationship between an omnipo-tent mother-figure and an infantile daughter-figure. Once the relationship has been unconsciously visualized in these symbolic terms, the development of "transferential" reactions is highly likely, because the relationship is already a "transferential" one. "Transference," I believe, explains why the disturbed sister is too ready to put all the blame on the superior or why the superior is ready to put all the blame on herself (or, in opposite cases, on her "insubordinate daughters"). It also explains why everything the superior does, the rewards she administers, the punishments she metes out, the assignments she makes, the time she take to reply to the sisters' mail, even her very traits of personality, become, at times, a matter of life or death for some sisters. ~Vhat is "transference?" Transference is an unrealistic emotional posture which supposedly occurs only in psy-choanalytic psychotherapy but which also develops, in varying degrees of unreality, in other intimate emotional relationships (husband and wife, soldier and N.C.O. on the battle line, pastor and priest, superior and sister, and so forth). In transference, one feels about a contemporary figure not the feelings it deserves because of what this figure realistically is, but the feelings one felt about significant figures from one's childhood, whom the con-temporary figure symbolically represents. In transference, the patient sees his analyst not as what he is but as he saw his own father and/or mother; and feels about his analyst the quality and quantity of feelings appropriate not to the analyst but to his own father and/or mother. Similarly, in transference the sister sees the superior not as the superior objectively is, but as she saw, as a child, her own parents; and her feelings about the superior are not proportionately related to what the superior, objectively, is, does, stands for, but to the feelings the sister had, as a child, about her parents. Transference motivates behavior as well as feelings and thoughts; in transference, the sister will behave, toward 4- 4- 4- ÷ ÷ + Vincent S. Coniglia~o, M.D. REVIEW FOR RELIGIOUS the superior, not realistically but "transferentially," not as sister-to-superior but as daughter-to-mother. Transfer-ence is "remembering through actions and feelings." In psychoanalytic psychotherapy, the development of transference is facilitated by some of the essential and accidental features of the treatment itself and may be fostered by the therapist (a skillful therapist encourages the appropriate quantity and quality of transference and uses it for his patient's benefit). The accidental features of religious life will also encourage transferential relationships and painful, neurotic transferential reac-tions. But, again, not per se, but in direct proportion to the mental health of superior and sister. Such features as the fact that sisters are referred to as "daughters" and superiors are addressed as "mothers". the psycho-logica. 1 message that may be contained in the very word "superior". the reality of the superior's unquestioned authority over the sisters., the vow of obedience., and other accidental features of religious life will not by themselves "infantil-ize" the sister or "mother-ize" the superior; but the sisters will be infantilized (and the superior motherized) who, from the depth of their un-conscious and latent neuroses, had already looked go these features as opportunities for the release of latent neurotic drives. The very fact that there are so many obedient, submissive, and deferent religious sisters who are, at the same time, joyful, vibrant, productive creatures, with attractive, vital, and no less feminine personalities is a living admonishment against believing that the poten-tially infantilizing (to the neurotic) features of religious life must necessarily (that is, also in the healthy) cause transferential relationships and reactions. Whether the superior is a trained counselor or not and whether her qualities of "understanding" will be rightly perceived by sisters wearing or not wearing transference-colored glasses, there can be little doubt that the "understanding" superior will contribute to the pre-vention of emotional crises in her community. Too often one thinks of an understanding superior as someone who smiles, agrees, and gets emotionally involved with her sisters or who is gentle and unassertive and goes around giving realistic or unrealistic reassurances or who shows total approval of whatever neurotic behavior is exhibited on the part of her sisters. This actually is more the stereotype for a neurotic superior than for an under-standing one. I remember a priest counselor whom I once supervised. He was counseling a hostile, resentful, rebellious adoles-cent whose father was rigidly authoritarian and coldly punitive. The counselee acted out his hostility in the counseling situation itself by being.consistently late for his sessions or breaking appointments without previously canceling them. The counselor was extremely "under-standing," remarked about the patient's lateness only casually and gave him a full-session time by cutting into his own rest periods, feebly joked about the cancelations and, to his own great inconvenience, rescheduled make-up appointments, and made sure not to appear in the least annoyed at his patient's erratic behavior. The counselor's conscious rationale for his "understanding" was: "I want him to see that there are understanding people in this world . 1 don't want him to think that everybody is as bad as his father . " In reality his "understanding" covered his own neurotic feelings about hostility and assertion; he neurotically equated justifiable annoyance (at having his schedule continuously disrupted) with irrational rage and rigidly controlled the former to avoid the risk of expressing the latter. Another counselor I supervised managed to convey to his patient his tacit approval of the patient's practically delinquent behavior; in this case the "understanding" dis-guised the counselor's own neurotic rebelliousness and hostility against authority. The giving of unrealistic reassurances (also often seen as a sign of "understanding") may actually be a symptom of neurosis. I remember the case of a sister with a paranoid char-acter neurosis, very intelligent but extremely disagreeable because of her mistrusting, hostile personality. Sister believed the other sisters disliked and resented her be-cause of her scholastic accomplishments; and her superior usually reacted to these complaints by "reassuringly" telling her that when one is very bright one may be resented by those who are less bright, and telling her not to worry, the other sisters really liked her. The con-scious rationale of this "understanding" was: "Sister is too sick to be told that the other sisters do dislike her. and for her arrogance and imperiousness, rather than for her brilliance . " In reality, this "understanding" covered the superior's unconscious fear of the paranoid sister and only resulted in the consolidation and strengthening of sister's hostility and disagreeableness. Real understanding--whether in the knowledgeable superior or in the trained counselor--basically cor-responds to the ability to understand human psychology and, especially, the complexity of human motivations. This understanding, which the counselor obtains from training, the superior can only derive through her own studies, readings, and observation, since in the great majority of cases we are not born endowed with it. "Intui-tive understanding," "horse sense," the "knack of under-standing people," are either an altogether di~erent quality of understanding (the superficial understanding of ÷ ÷ ÷ Counseling VOLUME 24, 1965 353 ÷ ÷ ÷ Vincent S. Coniglidro, M.D. REV|EW FOR RELIG|OUS few, superficial situations) or the major ingredient of often catastrophic "snap diagnoses" (the simplified con-clusions on "what really bothers" our fellow human beings). If this is fully realized, the superior who has little understanding should not blame her constitution, heredity, luck, or intelligence~in most cases she only needs to study, read, and observe. I am not implying that every superior should go to medical school and eventually specialize in psychiatry. I am suggesting, however, that any investment she will make in courses and lectures on human psychology will pay huge dividends in terms of house morale, a smoothly growing community, and her own peace of mind. Actually, it is a wonder that so many superiors, in spite of very little training in human psy-chology, do such a creditable job as leaders of a com-munity. Industry or government would not expect such a performance from untrained leaders of theirs who were to operate under conditions as difficult as most superiors (unisexual environment, closeness of quarters, the ever present possibility of transferential developments and transferential reactions; and so forth). If real understanding is to work--for the house as a whole, for the sisters, and for the superior herself---it must be mature and loving. It must be loving, or there will r~ot be the concern, care, interest motivating one human being to want to understand another (or, at least, to want to apply this u. nderstanding for healing purposes); and it must be mature, or it may be a neurotically motivated understanding in ~which the superior distorts the sister's demands because of unconscious needs to do so or understands these demands rightly but out of proportion to the total picture and more for her own needs than sister's. The positive features and attributes of real understand-ing can best be discussed in reference to counseling and religious counselors. Some of these features will be of great interest also to the superior: the superior who, without being a counselor or without intending to be-come one, wants to achieve, through her own efforts, personal interest, and dedication, real understanding of her sisters. This superior, however, would not be fair to herself if she expected to attain the quality of under-standing of the trained counselor just by following "a few simple rules," listening to the house counselors' "talk-ing shop," or reading a few articles, like this, at best just glossing over a few aspects of counseling theory. Both in real life and in the understanding of human psy-chology, there are no short cuts; and there are no instant substitutes for the understanding that can be derived only from years of studies, readings, and observation. The trained counselor attains a specialized quality of understanding of human psychology. A house counselor, through the time and effort invested in a comprehensive curriculum on theory and technique of counseling, can recognize, diagnose (in the connotation given before), and prognostically evaluate the signs and symptoms of healthy and unhealthy mental functioning. She can determine which patients are an indication for therapeutic counsel-ing and which patients, an indication for motivational counseling, should be referred to a psychotherapist, psy-chiatrist, or psychoanalyst. With the patients with whom she practices therapeutic counseling she knows, after evaluating the patient,s ego strength, environmental conditions within which the patient functions, and the overall circumstances surrounding the counseling rela-tionship, what techniques of counseling to follow and for how long. The counselor knows that human behavior and the symptoms of emotional disturbances are always over-determined (related to multiple causes and factors) and that the more disturbed is behavior, the more distressing a symptom, the more critical a crisis, the less likely it is that just one or two factors are responsible. Consequently, she will not "jump to conclusions," oversimplify, dispense quick, superficial "diagnoses" ("What really bothers you, Sister, is this and that"). She also knows that presenting symptoms and initial complaints are often a disguise for more distressing and intimate problems. Thus she waits beyond the first few sessions before concluding that sister has told her the "whole story" or even the "real story." She knows the inherently devious and implicitly mimetic nature of defense mechanisms; within herself, therefore, in the process of privately evaluating and understanding her counselee's problems, she will not take "no" (or "yes") for an answer, will not accept every-thing at its face value, will try to read between the lines of the counselee's manifest verbalization, will obtain clues from nonverbal communication, and will, in fewer words, constantly try to understand the dynamic motiva-tions, the "why," the "latent,'.' of her counselee's com-munication. (The really understanding superior may well try to remember this. Sister may come to see her to discuss problem "A"; whether sister knows it or not, she may actually be in the superior's office to discuss problems "B" or "C." The patient, knowledgeable, and, especially, un-hurried superior, will help sister to come to the real problem by prolonging the first interview, by non-direc-tive prodding--"is anything else on your mind, Sister?" is much better than "Is this (or that) what is really on your mind, Sisterl" and, especially, by asking sister to come in again "to talk more about problem A or any-thing else that might be on your mind, Sister . ") 4- 4- 4- Counseling + ÷ Vineent S. Conlgliaro, M.D. REVIEW FOR RELIGIOUS 356 The counselor knows that even truly distressing symp-toms may only be a first line of defense the personality uses against even more distressing problems and con-flicts. The counselee of a priest I supervised was literally torn apart by persistent masturbatory behavior con-sistently accompanied by vivid heterosexual fantasies; yet this behavior was only a cover-up for very frighten-ing, still unconscious, homosexual problems. A sister I treated was painfully convinced (and so was her superior) that she had a severe sexual problem as she was mainly obsessed with obscene fantasies and per-secuted by sexual compulsions; after several months (and a dream in which she discovered a knife hidden by stacks of pornographic literature) it became apparent that she was using obscene fantasies also to punish herself for unconscious fantasies of a sadistic nature against the superior (and her mother). Thus the counselor knows better than to prematurely remove symptoms or defenses, lest the problems so disguised come to the fore, thus causing disintegration of the whole personality and psychosis. The counselor knows that the best way to counsel is, often, by the "non-directive, minimal activity" technique. Within this technique the counselor, after having ascertained (with a minimum of activity and direction) the quality and severity of the counselee's problem, assumes an "actively passive" posture. She patiently listens; benevolently and calmly waits out pauses of silence; asks few or no questions; stimulates the counselee's continuity of communication by nonverbal means (nodding, assenting, saying "Uhm-uhm") or, verbally, by repeating the counselee's terminal sentence; echoes and reflects back, in simpler, clearer, more concise phraseology the counselee's utterances, and so forth. With the mildest counseling problems this approach is therapeutic in itself and is both means and end. The counselor becomes the counselee's oral vehicle; and the counselee, just by listening to the counselor's clearer re-formulations of the problem, can see solutions or the roads towards them. With most counseling problems this approach is very valuable as a means to an end, as it provides the counselor with material through which she will be able to help the sister to help herself. (A little tip for the superior: "true" listening, with minimal ac-tivity and direction, will cause the "true" problem to shape itself in its clearest outlines under her very eyes.) An important point, made just in passing before, is the one to the effect that light attempts at premature removal of symptoms can be catastrophic. Freud spoke of "wild psychoanalysis"; in a sense, one can talk of "wild counseling." In "wild counseling," the counselor tells the patient what to do; advises; judges; prescribes courses of action; removes symptoms or eliminates defenses; prods too actively, eliciting too much too soon, all this without knowing enough of his counselee's personality structure and whether the patient can safely ~ollow the prescription or in ignorance of the adaptive and defensive meaning of normal and abnormal be-havior. One of the most important discoveries of psychoanalysis was that psychic disorders have a meaning and represent partly successful attempts at defensive adaptation. Even the most distressing symptoms are a partly successful defense---without the distressing symptom of hysterical mutism, the hysteric would be hced with the more distressing problem of wishing to verbalize highly ex-ceptionable sexual desires; without the embarrassing symptom of "trigger-finger paralysis" (a hysteric condition of soldiers on the battle line), the patient would be ~aced with the more serious problem of wanting to press the trigger of a rifle aimed at his own sergeant; without the torturing symptom of persecutory thinking, the schizophrenic would be faced with the much more painful problem of having homosexual desires. The dis-comfort of hysterical mutism, trigger-finger paralysis, and persecutory ideation are a psychic bargain compared with the discomfort the psychic apparatus would experi-ence were it to face, in raw state, the sexual desires, the murderous aggression, and the homosexuality that mutism, paralysis, and persecutory delusions stand for. Thus, if we remove one line of defense, a more drastic defense will be set up and, with it, a more severe mental illness. I remember the patient who came to the emer-gency room of a city hospital in a wheelchair because of hysterical paralysis of both her legs. A brash and eager young psychiatric interne decided he would omnipotently remove the paralysis by hypnotic suggestion. The patient did walk out of the hospital on her own legs; once home, however, she became severely depressed and attempted suicide. The hysterical paralysis was, to her personality structure, an indispensable prop; deprived of that prop prematurely (that is, without any preliminary work on her ego), her personality could only cave in; the process could only be arrested by the setting up of more primitive defenses (more drastic "props"), for instance, the defense of depression. Counseling can be powerful medicine. Words and advice are to the counselor what scalpel and clamps are to the surgeon. Wrong counsel and ill-timed advice can have disastrous effects. I remember a patient "counseled" into borderline psychosis by her own G.P. A twenty-eight year old girl, beautiful and quite feminine, she had never been 4- ~,ounseling VOLUME 357 ÷ 4. ÷ Vincent $. Conigliaro, M~. REVIEW FOR RELIGIOUS engaged, married, or romantically involved, She had consulted her physician because of ill-defined heart and stomach symptoms, fatigue, sleeplessness, and choking sensations; the physician correctly diagnosed hysteria. In discussing her social life, he was struck by the fact that she never went out with men; he took the explanations she gave (shyness, moral reasons) about her sexual isola-tion at their face value and proceeded to persuade her into going out. After several sessions of "counseling" she reluctantly agreed to go out on a date. Shortly after the first date (and having given in to a very minor physical exchange of affection) she became depressed and with-drawn. Again, the physician accepted the explanations she gave for her depression (moral guilt) at their face value and counseled her to be "more broadminded." She became more depressed and withdrawn and eventually attempted suicide. Several weeks after she had finally en-tered psychotherapy, it was found that at the ages of five and nine she had been sexually molested by a psycho-pathic father. Unconsciously, she had come to associate adult sexuality with the incestuous sexuality experienced at five and nine; and the guilt, horror, and remorse at-tached to the latter had become associated to the former; thus sexuality had to be shunned in all its forms and manifestations. Deprived of her defenses of shyness, ti-midity, and sexual isolation, the patient could only ex-perience severe anxiety, depression, and guilt. The above examples refer to situations in which "wild counseling" was both erroneous from a psychoanalytic point of view and faulty from an ethical and moral standpoint. Yet examples can be given of morally un-exceptionable counseling that is equally "wild" from a psychodynamic point of view. A judgmental and psycho-dynamically imprudent pastoral counselor once strongly advised a young man to give up compulsive masturbation at all costs; the counselee did, at the cost of severe homo-sexual panic and suicidal behavior. A couple was once treated in marital counseling; he was a drug addict, moody, manipulative, exploitative, sadistic, occasionally violent; she, the unnervingly patient and "holy" type of woman who goes through life proudly protesting her humility and vigorously proclaiming her martyrlike good-ness in the face of unbearable male provocations. The counselor did not see that this was a neurotic marriage and that this woman (fully aware of her husband's long record of addiction at the time she had married him) had done so to fulfill her masochistic needs and express her controlling and manipulative polarities in the least obtrusive way. The counselor also failed to realize that this woman had a need to foster her husband's addiction (for example, she used to express astonishment at the fact that her husband always managed to steal the groceries money to buy drugs; in actuality, it was she who would unconsciously "forget" some money [always just the right amount for "a fix"] on her dresser for her husband to steal) and that his addiction was an essential '"prop" to her personality. When the counselor finally persuaded her to separate from her husband, she became severely depressed and became an alcoholic. As indicated before, the counselor should be both mature and loving; without these qualities, the most sophisticated psychological understanding will be basi-cally vitiated; and counseling will remain ineffectual. The psychoanalyst's personal maturity can be assured, in most cases, by the fact that he is demanded to undergo inten-sive personal psychoanalysis before he is o~cially per-mitted to psychoanalyze others; the counselor's maturity can only be assured by rigorous screening procedures at the time he applies for training; constant supervision during training gives the additional opportunity to certify as counselors only those who have demonstrated the needed maturity. Why should the counselor be mature (the quality of "loving," I would like to suggest, is an inevitable by-phenomenon of maturity) is self-evident. The mature and loving counselor practices counseling in terms of his counselee's needs--not his own. He is actively passive and non-directive because he believes in the rationale of this technique--not because he is uninterested or because he wishes to work as little as possible. When he gives active counsel, he does so because he honestly believes that it is right to do s~not because, by so doing, the counselee will love, admire, and respect him or "get off his back.~' The mature counselor responds to his patients realisti-cally and not in terms of neurotic reactions set up in him by the counselee's attitudes, symptoms, or values. He can be acceptant of his counselee's behavior, without condon-ing or approving it. He does not "judge" the counselee's actions; rather, he helps him to understand why he acts this or that way and what results can be anticipated from these actions. In being loving, the mature counselor is also capable o~ the adequate measure of self-love and self-respect, without which, I might suggest, there may be no genuine and consistent love and respect of others. A few examples may be given which will clearly in-dicate the maturity or the immaturity of the counselor. A lay counselor I supervised always managed to ask his counselees very personal questions of a sexual nature not to clarify his views on relevant aspects of his patients' personality but to fulfill, vicariously, neurotic sexual needs of his own. Examples given before (while we were 4- Counseling VOLUME 24, 1965 359 ÷ ÷ + Vincent S. Conlgliaro, M~. REVIEW FOR RELIGIOUS on the subject of the "understanding superior" and "understanding coun.selor") indicated how the counselor (or the superior) responded in terms of their own neurotic needs rather than their patients'. One pastoral counselor's sternly judgmental reaction to the rage exhibited by one of his counselees was less related to the patient's prob-lems with sadism than it was to the counselor's fear of his own hostility. Sometimes the counselor's immaturity first creates problems to the counselor himself which will then be transmitted to the counseling relationship and the counselee. A counselor I once supervised, incapable of mature self-love and self-respect, became very anxious because of his inability to resist his counselees' manipula-tions and dependency. He allowed counselees to contact him at home, at all hours of the day or night; the more dependent they became on him (and the more they in-convenienced and disrupted his family life), the more he resented them and the more he felt he had to "make up" for his hostility by giving in to their manipulations and dependency, thus getting involved in a self-perpetuat-ing vicious circle. Immature~or insufficiently trained--counselors may want to terminate a counseling relationship for a com-bination of '"right," conscious reasons (that is, the pa-tient is too sick and needs psychotherapy) and uncon-scious, "wrong" reasons (that is, hostility set up by the patient's values, attitudes, habits, and so forth). These counselors may feel so guilty, unconsciously, for the "wrong" reasons that they may be unable to recommend termination on the basis of the conscious, "right" reasons. They may present the "right" reasons to their counselees in such ambivalent, confusing fashion that the counselees sense the existence of hidden hostility, perceive the recommendation to terminate as '"rejection," and neu-rotically cling to the relationship: "interminable counsel-ing." On the other hand, an untrained pastor I know (truly and genuinely loving--of others; not enough, per-haps, of himself) often feels he does not have the right to refuse or deny anyone and gets involved in intermi-nable counseling in a different way: the parishioner keeps on coming, once, twice a week, to the rectory, refuses to be referred to a psychiatrist, and clings to the unhappy and helpless priest for years. Sometimes it is a superior who makes herself un-realistically available to her sisters. She is "willing" to practice informal counseling at any time during office hours (and beyond) and is unable to turn down any sister's request for "a few minutes of time." This superior may be taking too literally the Christian, ethical, or professional obligation to make oneself available to those who suffer, forgetting the equally ethical and Christian obligation to be good to oneself. One superior I knew refused no one coming in to see her, no matter how busy she was, how many deadlines she had to meet, and how many unfinished tasks were before her. She made her-self available "so that sister won't feel rejected."; her inner discomfort and tension, however, inevitably diffused to the counseling relationship. She would listen superficially and be exposed to the risk of making super-ficial, premature comments; or, while she "listened," her eyes would dart to the typewriter or steal a glance at the wristwatch; or her hands would tap impatiently by the telephone or tug at the crucifix ("Dear God, help me be patient."). The sisters she "listened" to inevitably received the message and felt just as rejected as if they had been asked to return later. A more self-loving superior will do better (by herself and by the sister) by recognizing her right (and her duty, perhaps, to herself) to tell sister warmly but firmly that she will take just a few minutes right away to discusse the matter of an appointment: which will be given within the day if sister feels the matter is that important, later, if sister feels her problem is not that urgent. I am suggesting, then, that when counselor, superior, pastor have sufficient mature self-love and self-respect (at least enough of it to resist the temptation of making themselves unrealistically, or masochistically, available to others) they will, at the same time, be capable of mature, joyful, and genuine love of others. (Could it be that "love thy neighbor as thyself" really means that one has as much obligation to love oneself as to love one's neighbor? And that this beautiful maxim, read between the lines, suggests that without mature self-Jove there cannot be mature other-love?) ! On the subject of "mature and loving understanding," it may be very appropriate to conclude by briefly reflect-ing on the question of values and counseling. While the counselee's values should have little relevance to the counselor's effectiveness, the same cannot be said of the counselor's values. ("Values" here is meant on a broad ethical and philosophical plane, not only on a religious or moral plane.) At the risk of being considered an incorrigible idealist, I should like to suggest that the effective counselor (like the effective psychotherapist) must be, above all, a decent, good human being. If he is not to be, at best a sterile and antiseptic technician, at worst a manipulator and a hidden persuader, he must be committed to a philosophy of integrity, love and respect of others, self-love and self-respect. The attributes of maturity, loving-ness, and understanding will ulti-mately be inherent and intrinsic in the man's existential ÷ ÷ ÷ Counseling VOLUME 24, 1965 36] integrity and ethical commitment. He cannot be auto-cratic, manipulative, devious outside of office hours, and genuinely permissive, truthful (to himself and his work), and sincere in his office; by the same token, he cannot be weak, manipulable, neurotically self-effacing outside of his office and reasonably assertive, reliable, and helpful during office hours. He need not be "perfect" (whatever this word may connote in his personal weltanschauung), but honest. He need not feel that he must make no mis, takes; all he needs is mental alertness to the mistakes he makes and the emotional courage to recognize them and try to do his best to rectify them. He need not be a self-righteous crusader for love, freedom, and a democratic philosophy of life, but someone who does his best to love, be free, and set others free. I began by noting that "counseling, as a technique and a philosophy of human relatedness., is important to both psychoanalysts and religious persons. (who) both work with human beings and are both committed to a profession of service . " In closing, I should like to suggest that both psychoanalysts (or psychotherapists, counselors, and so forth) and religious persons (or pastoral counselors, house counselors, and so forth), be-cause of the specific quality of their relatedness to the human beings they work with, are alike also in this respect: the measure of their success in their work is, to a large extent, a measure of their existential richness and integrity. ,4" 4. + Vincent $. onigliaro, M.D. REVIEW FOR RELIGIOUS WILLIAM J. REWAK, S.J. Mortification: An Entry inta the Christ-Mystery I. Aversion of Modern Man In the spirit of the Church's aggiornamento, there is a great demand today for authenticity in moral and ascetical theology, a demand for new and valid expres-sions for the old values. A value is a value, after all, not because it is traditional but because it is an authentic expression of my personal relationship to God and to other people. We are aware of, and fear, the crystalliza-tion of the primary Christian experiences. It has often happened that the Church---or more exactly, institutions and individuals within the Church---have bequeathed to succeeding generations rites, methods, and customs with-out any inner ideal and spirit. Such a stagnation of the original value can occur in any human experience: mysticism can degenerate into magic and ritualism; prophecy is always in danger of crumbling into moral-lsm. So the original value, idea, must forever be reex-pressed; it must grow within the historical context and be reinterpreted in the light of changing modes of thought. At the same time, it must keep a strong hold on the primitive experience. It is for this reason we will investigate the New Testament doctrine on mortifica-tion. A theology of mortification is badly needed. The pres-ent doctrine is inadequate, for it has not kept pace with the advancements in Sci'ipture and other branches of theology. At the present, we are reacting against a moral theology that has emphasized sin and progressing towards a positive program of Christian life: doing good in the service of a generous charity. The idea of morti-fication, then, which according to many manuals is practiced either as a punishment for past sins or as a deterrent against future sins must be reappraised,x What ~$ee P. J. Meyer, s.J., Science o] the Saints (~t. Louis: Herder, ÷ ÷ ÷ William J. Re-wak, s.J., is a mem-ber of Regis Col-lege; 3425 Ba~.view Avenue; Wallow-dale, Ontario; Can-ada. VOLUME 24, 1965 4, 4, 4, William ~. Rewak, 5.1. REVIEW FOR REL]G~OUS 564 is objected to is not that sinful man needs mortification, but that theories of mortification seem to bypass Christ and have for their starting point, their raison d'etre, the fact of sin. Every natural philosophy tried to elimi-nate "sin"; the Stoics were concerned with perfection, but only natural perfection. A Christian existential view of sin cannot fall into this trap. Many wish to find their mortification in the daily struggle involved in working for their neighbor, in the apostolate. The absolute value itself of mortification is not always questioned; a blank rejection would be an act of infidelity to the Word of God. What is vehe-mently questioned is selpchosen mortification: corporal punishments, voluntary acts of abnegation of the intel-lect and will, all those acts, freely chosen, which hurt our pride or human respect. Their necessity is question-able in the light of the very real difficulties confronting the apostle in today's pluralistic society, in a world where the general breakdown of morality requires a new and more refined, more soul-searching response in his communication with his neighbor. There is no doubt about it: mortification is the daily fare for the dedi-cated apostle. Why opt for additional, self-chosen acts of mortification? Mortification has too often been identified with ex-traordinary corporal austerities. The ordinary apostle, not given to sackcloth and ashes, hairshirts, dank caves, and bloody lacerations, is sincerely seeking an "ordi-nary" saint. He wants as an example someone who must stay strong and healthy in order to perform manfully, joyfully, and effectively the tasks of a university pro-fessor, a retreat master, or a Catholic businessman. Besides, corporal austerities are currently out of favor as a result of the renewed "theology of matter." We have, it is hoped, at least theoretically banished all traces of Platonism and Jansenism from our books and lectures on spirituality. There is today an emphasis on the sacramentality of matter, an emphasis fostered by the late Teilhard de Chardin. The body, the world of the material and concrete, are all good and will con-tribute in their own specialized way to the glory of the kingdom to be revealed in us. If corporal austerities are to be retained, they must be based on a more solid foundation than the Jansenistic distrust of the ma-terial. 2 1902), pp. 88-91. Father Meyer's primary reason for practicing morti-fication is "as an atonement for past sins"; and it is "still more neces-sary as a preservative from future sins." This obviously needs quali-fication and completion. i We use the terms "Jansenistic" and "Jansenism" because they are readily intelligible to the modem reader. It must be admitted, how-ever, that the use of such terms is more for convenience than for Older spiritual books, books which influenced the ascetical teachers of the first half of this century, are notoriously negative in tone: If we were to count all the miseries of human life, we should never have done. Holy Job says, "The life of man is a per- Detual warfare upon earth, and his days are like the days of a hired servant that labours from sun-rising to sun-set" (Job vii. 1, 2). Several of the old philosophers had such a lively sense of this truth, that some of them said, they could not tell whether to call nature a mother or a step-mother, because she has sub-jected us to so many miseries. Others again used to say, it were better never to be born, or at least to die as soon as we were strict and complete historical accuracy. An explanation is therefore in order. We urge the reader to consult Louis Bouyer, The Spiritual-ity o] the New Testament and the Fathers, trans. Mary P. Ryan (London: Burns and Oates, 196~) for an excellent account of the problem of gnosis in the early Church. Contrary to modern popular belief, Father states, there was a legitimate gnosis sought by St. Paul and by the early fathers; one has only to think of the formulation of the First Epistle to the Corinthians on knowing God even as we are known (1 Cor 13:12; see also Eph 3:19 and Phil 3:7-11). And this is a knowledge which is really an experience of God, in the love of the Spirit. St. Ignatius of Antioch says: "Why do we not all become wise in receiving the gnosis of God, Jesus Christ?" (p. 246). Gnosis for primitive Christianity was an experiential knowledge of the mysteries of the Father's plan for salvation. But at the same time the natural Greek philosophers themselves were seeking ~alvation through a gnosis of their own. These influences came in turn to form Christian gnosis. "Eons or angels descended in endless cascades from a pleroma in which everything is divine, towards a foreign matter in which everything is mired and becomes degenerate. To this fall, which is one with creation itself, is opposed the mission of the Logos, more or less strictly identified with the man Jesus. But since salvation is nothing but the recovery of an con fallen into mat-ter, the incarnation could be only apparent. It must lead, in fact, to a salvation which is not a redemption of the whole of man, but a disengagement in man of what has never ceased to be immortal 'spirit,' that is to say, an escape from the bonds of the body and the world . The cross of the Saviour only frees our soul along with his from the chains of the body" (p. 223). It is immediately apparent that the grandfather of the heretical positions of the Jansenists, Puritans, Albigensians, Manicheans, is Greek Gnosticism--a corrod-ing rationalism which understood nothing of the true Gnosis, the Word of God. It is not the Logos of Hellenistic syncretism that we, as Christians, come to know, but the Word made flesh. This is why so many spiritual writers of the last few centuries have misfired with their ascetical doctrine; they were influenced by the same rationalism that has threatened Christianity from the beginning and is too often the error of Christian "humanism": the adoption of ascetical prac-tices for the purification and reintegration of the purely natural man, with no consideration for the priority of the interpersonal relation-ship between man and God. The early Greek Gnostic sought an apatheia: the calming of all disordered tendencies, rendering him insensible to outside influence. The Christian Gnosdc also sought apatheia, but it was attained through perfect submission to charity. This in no way meant an extinction of the human, "but rather its unification in which everything is taken up and transfigured which is worthy of being so" (p. 274). Christian asceticism must begin from faith, from the Word of God; it must proceed from the Spirit of love speaking within us. + + .I-Mortification VOLUME 24, 1965 365 4. 4. 4. William J. Rewak, SJ. REVIEW FOR RELIGIOUS 366 born; nay, some of them have gone so far as to say, there are but few persons, that would accept of life after having made an experiment of it, that is, if it were possible to make a trial of it beforehand,s If one were to take this seriously, he would have to regret that God ever uttered a fiat. Having disposed of the object, the author turns to the subject: Cast your eyes on yourself, and you will find there motives enough of humility. Do but consider what you were before you were born, what you are since you have been born and what you are like to be after your death. Before your birth, you were a filthy matter unworthy to be named, at present you are a dunghill covered with snow, and in a short time you will be meat for worms.~ An adequate understanding of the Incarnation can surely dispel such gross misconceptions of God's creation. But it is precisely upon such misconceptions that the author--and other authors--have based their arguments for mortification. Little wonder modern man is repelled. An unhappy refrain running through most spiritual manuals of the eighteenth and nineteenth centuries is A bstine et sustine! Refrain and endure,s Cast unwillingly into a flaming abyss of sin where even the apostolate is fraught with unimaginable dangers, mortification alone will lead us to "perfection." And this is perhaps the worst aberration of rationalistic moralism: the use of ascetical practices not for establishing and maintaining a dialogue with God but for the stoical perfection of all the virtues. Most spiritual books of the last century offered detailed instructions on how to develop the virtues of fortitude, for example, or temperance, chastity. And the first means was always mortification--as they understood it. "We must possess more virtues; through them only can we reach our end. Here comes in the aid of self-denial and self-discip-line." 0 Another section of the book explained the ob-stacles to the acquiring of these virtues;7 and a third sec-tion enticed the reader with such titles as "Of the Spiritual and Temporal Advantages Promised to Virtue in this Life, s Rev. F. Lewis, O.P., The Sinner's Guide (Dublin: Richard Coyne, 1825), p. 162. ~ Ibid., p. 271. ~ See, for example, Alphonsus Rodriguez, S.J., Practice o! Perfec-tion and Christian Virtues, trans. Joseph Rickaby, S.J. (London: Manresa Press, 1929), p. 567; and Meyer, Science of the Saints, p. 97. °Moritz Meschler, s.J., Three Fundamental Principles of the Spiritual Life (Westminster: Newman, 1945), p. 80. The author seri-ously calls his book "Christian Asceticism in a Waist-Coat Pocket" (p. v). 7See John Baptist Scaramelli, S.J., The Directorium Asceticum, trans, at St. Bueno's College, North Wales (4 vols.; London: R. and T. Washbourne, 1902), v. 2. This second of four volumes is devoted en-tirely to the manifold obstacles to Christian "virtue" and the means for overcoming them--penance and mortification. and particularly of Twelve Extraordinary Privileges be-longing to it" s or "Some Easy Kinds of Mortification." 9 Such pragmatic spirituality, which is nothing but the victory of reason over animality, lacks a real Christian motive based on Christ's entry into our life through baptism and the sacraments. Fortunately, we have recovered the notion that per-fection is not the piling up of virtues, computer-fashion; it is more fundamental, it is Chrigt-centered. We see Christ as the focal point of all our religious activity, of all our apostolic activity, of all human relations; and when an author bids us go forth from our father's house because "in the shelter of the religious life, separated from the world, from all that might .have occupied your thoughts and your hearts, you live for God alone," 10 we cannot believe him. Or if someone counsels us: "If the religious vocation demands the abandonment of the parental roof, sons and daughters must sacrifice their affections for parents and relatives that they may gain thereby Christ's promise of eternal life," or asserts that friendships are dangerous because "friendship between proper parties that has for object their mutual spiritual advancement is rare and found only among saints," 11 we can hardly take him seriously. The author is too much like those of whom P~guy wrote that "they think they love God because they don't love anyone." Mortification and sacrifice have often been put in opposition to joy. Come, my children, when pain, sacrifice, and duty press heavily upon you, when you experience dryness and disgust, endeavour to make, if you will, a dry and bitter act of love of God . Fervour and sensible devotion is good for small minds; shake off these feminine ways, aspire to something more noble, more vigorous. As for ourselves, we have had not one quarter of an hour's consolation in forty years.~ Hard saying for a generation that is experiencing the ascetical consequences of St. Paul's theology of the Res-urrection. Surely sacrifice and consolation, as authentic expressions of God's Good News, must somehow be re-lated. But most authors of moral guidebooks struggled with this "problem" of pleasure, happiness, consolation, and could not easily reconcile it with Christ's example of suffering. There exists in fact the problem of pleasure. Readily enough ~ Lewis, Sinner's Guide, p. 85. ~ Meyer, Science oJ the Saints, p. 101. 10 P~re de Ravignan, S.J., ConIerences on the Spiritual LiIe, trans. Mrs. Abel Ram (London: Washbourne, 1877), p. 185. Italics mine. ~aMonsignor P. J. Stockman, Manual o] Christian Per]ection (Hollywood, Calif.), p. 611. ~ De Ravignan, ConJerences, p. 191. Mortification VOLUME 24, 196S 367 4. 4. William ]. Rewak, 8.1. REVIEW FOR RELIGIOUS $68 does the concept of pleasure evoke the idea of something which, morally, has little to recommend it, or at the most, something which is to be tolerated. Living in the memory of Christ, the Christian soul with difficulty separates sanctity from suffering. Is it not by the cross that Christ redeemed and sanctified us? How can pleasure, then, be integrated into the moral life? Does this life not seem, on the contrary, to exclude it? Is there a place for pleasure in the context of a life of selbcontrol?18 And the author solves this conundrum by consoling his readers with the distinction that the essence of an act is what determines it and not the pleasure that may sur-round or follow upon it. Pleasure is outside the moral law: if the act is good, the pleasure is good; if the act is bad, the pleasure is bad. It is, he states, permitted to renounce this pleasure for a superior motive; but it is sometimes better to accept it, especially if it leads to virtue; and it may not always be possible to exclude it.14 Such a treatment of pleasure and consolation strikes the modern reader as negative, moralistic, and exces-sively rationalistic. It has not embodied the spirit of St. Paul: "They will forbid marriage, and will enjoin ab-stinence from foods, which God has created to be par-taken of with thanksgiving by the faithful and by those who know the truth. For every creature of God is good and nothing is to be rejected that is accepted with thanksgiving. For it is sanctified by the word of God and prayer:' (1 Tim 4:3-5). One last remark, and this first part will have per-formed its function. Mortification has been strongly identified with the devotions centering around the idea of reparation. We supposedly mortify our flesh to al-leviate the pain of the lash as it struck Christ during His passion; we kneel for hours to repair for the sins which are causing Him pain and sorrow. Sentimentality has conjured up the image of a Sacred Heart, sitting on the banks of the Loire, weeping and bewailing the sins which men are committing. Such misguided devotions can readily develop into dolorism, a perverted anguish which plays on false feelings of guilt; and for the modern psychology-oriented intellectual, this" is territory to be shunned. Mortification, if it is to be Christian, must turn one away from the self and towards Christ and ="I1 existe de fait un probl~me du plaisir. Assez ais~ment le con-cept de plaisir ~voque l'id~e d'une chose moralement peu recom-mandable, d'une tolerance tout au plus. Vivant du souvenir du Christ, l'fime chr~tienne dissocie malais~raent la saintet~ de la soul-france: n'est-ce point par la croix que le Christ vous a rachet~s et sanctifi~s? Peut-on donc integrer le plaisir clans la vie morale? Ne convient-il au contraire de l'en exclure? Peut-on lui assigner une place clans le gouvernement de soi-m~me?" Dora Odon Lottin, Aux sources de notre grandeur morale (Editions de l'Abbaye du Mont Cesar, 1946), p. 32. a~ Ibid., pp. 33-4. man. Sentimentality has no place in the authentic Chris-tian experience of reparation. It is the sum of all these inaccuracies, these exaggera-tions, these inauthentic expressions of Christian asceti-cism, which are causing the current questioning, if not the rejection, of mortification. If we are to retain morti-fication and sacrifice as indispensable e|ements of Chris-tian life, they must be integrated into the scheme of the "Christ-life" of which St. Paul is the outstanding interpreter. We have to make what we mean intelligible to modern Christians so that, as Karl Rahner says, "they will not think that 'sacrifice' is an expression for that misanthropy and secret hatred of life felt by failures who are incapable of courageously enjoying life and this world and the glory of human existence." a~ H. New Testament Doctrine on Mortification We have been using the term "mortification" in its popular sense, meaning all those acts of abnegation, of sacrifice, which are commonly understood as "mortify-ing." It is time now, however, to clarify the meaning of the three words ordinarily used interchangeably as synonyms: abnegation, renouncement, and mortification; and we will present, in the main, Fr. Iren~e Hausherr's distinctions,a6 This analysis will lead us into a further study of the Pauline texts on mortification. The Synoptics have all preserved the saying: "If any-one wishes to come after me, let him deny himself, take up his cross, and follow me." a7 Fr. Hausherr has pointed out that in the Scriptures, when abnegate, "to deny," concerns a duty, there is always the same direct object: oneself. We cannot, strictly speaking, deny ourselves; that is, negate ourselves. We cannot deny what we really are. The abnegation demanded by Christ consists in denying, or not attributing to myself, that which I am not. The great truth about myself is that I am a creature ---or better, a son---of God; negatively speaking, I am not God. This elementary negation constitutes the es-sence of abnegate, of the "denial" of oneself. It is, to be sure, an intellectual judgment on my condition as a creature, a fully free human commitment to adore and praise the God Who has entered my life. But to stop here would enclose us in the same narrow straits of rationalism that hemmed in former ascetical writers. This basic abnegation--the adoration of God---demands that I act as a creature; but it demands primarily that ~ Karl Rahner, S.J., The Christian Commitment, trans. Cecily Hastings (New York: Sheed and Ward, 1963), p. 167. l~Iren~e Hausherr, S.J., "Abnegation, renouncement, mortifica-tion," Christus, v. 22 (1959), pp. 182-95. a7 Mt 16:24. See also Mk 8:34; Lk 9:23. Mortification VOLUME 24, a965 William ]. Rewak, $.1. REVIEW FOR RELIGIOUS 370 my filial relationship to God, which is discerned by faith, take precedence over and therefore exclude the primacy of every purely natural reference to self, and this in consequence of the existential character of the supernatural order of redemption I am now living. Transposed into life, this principle demands acts of mortification. The commandment "to renounce" appears in only one text: "He who does not renounce all that he pos-sesses cannot be my disciple" (Lk 14:33). Christ is here again referring to all men, to whoever wishes to follow Him; it is therefore not a counsel but a command, a Christian duty. Obviously, the degree of embodiment of this renunciation will vary for every person and every state in life. Renunciation for a religious is not the same as renunciation for a layman. Although the specific command, "to renounce," does not appear elsewhere, there are related texts: "If your right eye is an occasion of sin to you, pluck it out . " (Mr 5:29); "If you wish to be perfect, sell all that you possess, give it to the poor, and come, follow me" (Mt 19:21); "And anyone who has left house, or brothers, or sisters, or father, or moth.er, or wife, or children, or lands, for my name's sake, shall receive a hundred-fold and shall possess life everlasting" (Mt 19:29). The first Matthaean text is hypothetical but is uni-versal in its application. The remaining two texts refer to those who have decided to follow the counsels, since "to leave" is not commanded, it is optional. Luke has seemed to use the same logion, but the tone is harsh: anyone comes to me and he does not hate his mother and his son and his brother and his sisters, and himself, he cannot be my disciple" (Lk 14:26). In this context, "to hate" someone is to love him less than God, or better, to discern by faith that love of the Father grounds our love for other men. "To leave" is not a duty (except in the hypothetical case of an occasion of sin); but "to hate" and "to re-nounce" are obligations which fall on every Christian, as they indicate the relation that should exist between a son and a Father. Abnegation, then, refers to the subject: my self-love will be characterized and determined by my love for the Father. Renouncement refers to the persons or things outside the subject: all created things will be loved in the Father and through the Spirit because they are ex-pressions of God's love for me. "The charity of God is poured forth in our hearts by the Holy Spirit who has been given to us" (Rom 5:5). Transposed into life, both of these principles demand acts of mortification. It is St. Paul who uses the word "mortification," and the first text we wish to examine is Col 3:5: "Therefore, mortify your members which are on earth." Some have understood this text literally to refer to punishment of the physical body. The Greek word for mortify, nekro-sate, does mean "to cause to die"; but St. Paul is not asking for the physical amputation of our members, he has too great a respect for the body: "Learn how to possess your vessel [body] in holiness and honor" (1 Th 4:4). But neither should the word be weakened to merely mean "suffer," for this, too, would have no precedent in Pauline doctrine. The word "members," then, can-not refer to our physical members; and in the context of the passage, there is an interpretation given to the word. Appearing in apposition to "members" are: "im-morality, uncleanness, lust, evil desire, and covetousness (which is a form of idol worship)" (Col 3:5). What we must put to death, what we must "mortify," are the dis-ordered affections which proceed from blunted self-love, a self-love not grounded in the Father's love, in Paul's terminology, the "flesh," sarx. Now the works of the flesh [sarx] are manifest, which are immorality, uncleanness, licentiousness, idolatry, witchcrafts, enmities, contentions, jealousies, angers, quarrels, factions, par-ties, envies, murders, drunkenness, carouslngs and such like . And they who belong to Christ have crucified their flesh with its passions and desires (Gal 5:19-21,24). The effects of selfish egoism destroy the beauty and the harmony of the Christian person. All these sins which Paul enumerates set a man against his neighbor, against God, even against himself. We must "crucify" the source of this disorder, our "flesh," in order that we may "walk in the Spirit" (Gal 5:16). Mortifying the flesh will produce the "fruit of the Spirit: charity, joy, peace, patience, kindness, goodness, faith, modesty, continency" (Gal 5: 22-3). The primacy of the spirit of charity in our lives is evidence that we have "risen with Christ": If you have risen with Christ, seek the things that are above, where Christ is seated at the right hand of God. Mind the things that are above, not the things that are on earth. For you have died and your life is hidden with Christ in God. When Christ, your life, shall appear, then you too will appear with him in glory. ThereIore, mortify your members . " (Col 3:1-5). Paul is inviting us to the state of mortification, in the interests of our resurrected life. "If by the spirit you put to death the deeds of the flesh, you will live" (Rom 8:13). Egdism must be mortified and sensuality curbed; then we live in the full supernatural sense. And here we begin to touch upon a basic Pauline theme. For Paul, the fundamental law of the spiritual life is a dying and a living with Christ. This occurs sacra-÷ ÷ ÷ Mortifwatlon VOLUME 24, 1965 371 4, SJ. REVIEW FOR RELIGIOUS 372 mentally in baptism and it is of this he speaks to the Colossians. Perhaps his most explicit statement is in the epistle to the Romans: Do you not know that all we who have been baptized into Christ Jesus have been baptized into his death? For we were buried with him by means 6f baptism into death, in order that, just as Christ has arisen from the dead through the glory of the Father, so we also may walk in newness of life" (Rom 6:3-4). The spiritual life is union with Christ; but this is a fellowship with His death and life. We die and rise again sacramentally in baptism, an invisible action which must be fully manifested and made effective in our daily lives. The sacramental, ontological change we undergo in baptism must have a corresponding effect on our moral and ascetical conduct,is Only in this way, by uniting ourselves sacramentally and ascetically to Christ's earthly activity of suffering, can we obtain a freedom from sin and our final resurrection: For his sake, I have suffered the loss of all things, and I count them as dung that I may gain Christ and be found in him not having a justice of my own which is from the Law, but that which is from faith in Christ, the justice from God based upon faith; so that I may know him and the power of his resurrection and the fellowship of his suffering: become like to him in death, in the hope that somehow I may attain to the resurrection from the dead (Phil 3:8-11). Fr. F. X. Durrwell states: These texts do not say that the remission of sin is gained in virtue of the merit acquired in the past by that death---one must not water down the reality of a single word of Scripture on the ground of reason being unable to cope with it; they say that it is gained in a communion in that immolationTM. Only by entering completely into the mystery of Christ, by uniting our sufferings to His in such a way that they are no longer our sufferings but Christ's--"l bear the marks of the Lord Jesus Christ in my body" (Gal 6:lT)-~can we truly become a "new creation" (Gal fi:lS) and enter upon the glorious life awaiting us. And so a radical transformation has already taken place at baptism: "As many of you as have been baptized in Christ have put on Christ" (Gal 3:27); "You were heretofore darkness but now light" (Eph 5:8); "The law of the spirit of life, in Christ Jesus, hath delivered me from the law of sin and death" (Rom 8:2). In the Chris-tian life, however, there is a vast difference between establishing a beachhead and the full experience of ~ Concerning this Pauline theme, see Alfred Wikenhauser, Pauline Mysticism (New York: Herder and Herder, 1960), pp. 149-56; and F. X. Dun'well, In the Redeeming Christ (New York: Sheed and Ward, 1964), pp. 84-90. ~ Durrwell, In the Redeeming Christ, p. 85. victory--the pleroma. In principle, Christ's death and resurrection and our sacramental participation in it have destroyed the inevitable domination of "the lusts of the flesh" (Gal 5:16); but the possibility of sin remains. The Christian life is a life of struggle, as Paul knew so well from his own personal experience and fa'om his ex-periences with the imperfections of the early Christian communities. But Christian suffering, the appropriation in our own person of the passion and death of Christ, must reflect the same motive that inspired the exinanitio: the redemp-tion of man and of the universe. "For we the living are constantly being handed over to death for Jesus' sake, that the life also of Jesus may be made manifest in our mortal flesh. Thus death is at work in us, but life in you" (2 Cor 4:11-2). Only to the extent that what is exclusively natural in us dies can the life of Christ become manifest in us in the form of apostolic activity. The death of the apostle is the necessary condition for the life of the Church and her members. And every Christian is an apostle. Only to the extent that we "bear about in our body the dying of Jesus" (2 Cot 4:I0) can we effectively continue the redemption by applying its saving activity to men. And here we reach the basic reason for all mortification: it is an entry into the mystery of Christ, a communion in His suffering, for the purpose of prolonging His re-demption in the world through the Church. His activity in Jerusalem two thousand years ago was not ineffica-cious for the present age; He effected the transforma-tion at that point in time, but He continues it in His glorified state through the members of His Church who recapitulate in their lives His redeeming experience. "Therefore I pray you not to be disheartened at my tribulations for you, for they are your glory" (Eph 3:13). The most important statement of this theme appears in Col 1:24: "I rejoice now in the sufferings I bear for your sake, and what is lacking of the sufferings of Christ I fill up in my flesh for his body which is the Church." Paul does not mean, of course, that he must supply by his sacrifices the defects in the sufferings of the historical Christ. Interpreting "the sufferings of Christ," Fr. Benoit says they are, in general, the tribula-tions of the apostolic life;2° while Fr. Wikenhauser ap-plies them more personally, stating they are Paul's own sufferings.21 These interpretations do not do injustice to Paul's thought; as he says elsewhere, "the sufferings ~o Pierre Benoit, "L'Epitre aux Colossiens," Bible de Jdrusalem (Paris: Cerf, 1959), p. 60, footnote (b). m Wikenhauser, Pauline Mysticism, p. 161. ÷ ÷ Mortification VOLUME 37~ of Christ abound in us" (2 Cor 1:5), meaning his own sufferings. At any rate, all reputable scholars agree with the general tenor of the text: Paul, and all Christians, must express in their lives Christ's passion and death for the salvation of the members of the Mystical Body, the Church. Quite simply, "they live no longer for them-selves" (2 Cot 5:15). And this salvation of the Body of Christ is a source of great joy for Paul, a joy that is a participation in the Resurrection: "For our present light affliction, which is for the moment, prepares for us an etei-nal weight of glory that is beyond all measure" (2 Cot 4:17). Com-munion with Christ in His death necessarily means com-munion in His Resurrection, for this too is the moral and ascetical prolongation of baptism. The Resurrection should be lived, as mortification and suffering are lived. The apostle is a man of joy: "For as the sufferings of Christ abound in us, so also through Christ does our comfort abound" (2 Cor 1:15). It is in the letter to the Philippians, written during a harsh and humiliating im-prisonment, that Paul overflows with joy--a word that appears in this epistle eleven times because of the fellowship he experiences with his converts who them-selves have endured suffering for the sake of the gospel: "I have you in my heart, all of you, alike in my chains, and in the defense and confirmation of the gospel, as sharers in my joy" (Phil 1:7). In summary, Paul puts great emphasis on the mystical and sacramental fellowship in Christ that is effected at baptism; but he is equally insistent that Christians must foster in their lives a personal relationship founded on imitation--and this can only be done by re-experienc-ing Christ's life, performing the same redeeming activity He performed. To be one with Him in glory, we must be one with Him in suffering. This is the only way we know, the only way given to us by which we can be saved: "If anyone wishes to come after me, let him deny him-self, take up his cross and follow me" (Mr 16:24). III. Some Conclusions ÷ ÷ + William I. Rewak, Sd. REVIEW FOR RELIGIOUS And what then is mortification? Most basically, it is a state of having died with Christ so that we may live with him, We must make more explicit, however, a dis-tinction which until now has only been implied: St. Paul is speaking primarily about absolute mortification, the state we all must enter as a result of our communion in baptism with Christ. Every Christian is called to this state; and the requirements are the same: the "putting to death" of the disordered inclinations and affections that are ours as a result of original sin.2~ We do not "mortify" the body, properly speaking; we mortify our flesh, sarx, the urge we possess to disassociate our in-terests from God's interests. And we do this that through us the Body of Christ, the Church, may live the Res-urrection more fully. But a problem remains. For this absolute principle of the spiritual life must be appropriated by each Chris-tian and embodied in his daily life. The acts of mortifi-cation, therefore, by which we make St. Paul's principle our constant concern, we term relative mortification. For these acts are always relative, to our state in life, to the inspiration of the Holy Spirit, and to the force of the disordered affections which remain in us. It is this we are concerned with now and it is under this heading we discuss selpchosen, freely imposed mortifica-tion. We live as members of a Church; all our Christian acts are ecclesiological--through, with, and in the struc-ture Christ set up for our sanctification. The existence of sin in any one of its members stops the flow of grace in a particular area and impedes there the growth of the Christ-life. Mortification does serve, then, as punishment for sin and as a deterrent against future sin, as the manuals have pointed out; but sin must be seen in the context of the Mystical Body, of charity: "For you have been called to liberty, brethren; only do not use liberty as an occasion for sensuality, but by charity serve one another" (Gal 5:13). We mortify our disordered affec-tions so that nothing will hinder us from entering into a meaningful dialogue with God and with our neighbor. We must make of our lives a dynamic redemption--a redemption that is continued through our Christian acts of prayer and mortification, in the Church, for mankind. It is in the light of this Christian experience, for example, that we seek the meaning of reparation. Acts directed to reparation are performed principally to further the penetration of the Christ-life in the members of the Church: the Church suffering and the Church militant. They are intended to "repair" the damage done by sin, to heal the wounds which Christ--in His members m St. Ignatius of Loyola insists that a "disordered affection" is an affection which does not take into account the action of God in our life. To mortify this affection, (I) w~ starve it by not allowing it to exercise its influence and (2) we pray that God may change this af-fection. It is obvious how important Ignatius considered both the initiative and the decisive influence of God's action in us; for this reason he puts great emphasis on the necessity of prayer when troubled by "inordinate attachments." See Spiritual Exercises, Nos. 16, 157. ÷ ÷ ÷ Mortit~ation VOLUME Z4, 1965 375 ÷ ÷ William J. Rewak, Sd. REVIEW FOR RELIGIOUS --has suffered, to open the channels of sanctification that we all may live healthy, grace-filled lives. Christ does not suffer, but His members do: the loss of grace, caused by the power of sin. The dialogue must be re-established, and our acts of mortification do effect, in ourselves and in our neighbor, through the mercy of God, the resurgence of the Christ-life. For within the mystery of the Mystical Body, there is room for mutual help--and this in the sphere of grace alone. This re-vealed fact in itself attests to the mysterious character of the organic union of this Body: "For we the living are constantly being handed over to death for Jesus' sake, that the life also of Jesus may be made manifest in our mortal bodies. Thus death is at work in us, but li[e in you" (2 Cor 4:11-2). But many Christians, agreeing with the general nec-essity of mortification, point to the apostolate, as we have indicated, as source enough of that "dying" Paul insists we must undergo for ourselves and our brothers in Christ. Failure in the apostolate, the limitations of our personality in dealing with others, the rejection of love, the inability to be effective--these are real crosses to be borne by every apostle. They point also to the one great abiding mortifica-tion, the acceptance of personal death. Karl Rahner has said: We have only to recall that death, as an act of man, is pre-cisely that event which gathers up the whole of the personal human life of the individual into one consummation. We have only, too, to recall, as Eutychius (A.D. 582) said, that there oc-curs "pragmatically" in death what had occurred mystically at the sacramental heights of Christian experience, in Baptism and in the Eucharist, namely our assimilation to the death of the Lord.~ And the death of the Lord was not an easy one. But self-chosen mortification, we affirm, performs ex-actly the same function, and that is one of the reasons it is so necessary. Just as personal death demands activity on the part of the Christian, so should our mortification, for mortification prepares us for and establishes a begin-ning and an acceptance of our final assimilation to the death of the Lord. Acceptance of suffering, of the crosses meted out to us in our apostolate, has great value; but it does not reach the depths of the personality as our self-chosen acts do. It is easier to accept .the loss of something we hold dear than to throw it away of ourselves. The blame can al-ways be put on circumstance, on someone else, even on God; and this is a consoling thought, for it is hard to ~a Karl Rahner, S.J., On the Theology of Death (New York: Herder and Herder, 1964), p. 77. blame ourselves, to freely commit ourselves to a dying in Christ. Penances imposed from without are .not free from the nonchalance and superficiality of routine. What may pass for a religious act may often be unthinking obedience. As Fr. Rahner says: One has only to have heard something, however little, about depth psychology, repression, substitution, self-deception, etc., to have to agree that thousands of "religious" and "moral" acts can take place in man which are induced by training, imitation, suggestion, mere instruction from without and a "good will" which does not reach to the real kernel of the person; acts which are not really religious acts because they do not stem from that level of personality, supernaturally elevated and ab-solutely individual, whose free fulfillment they must be if they are to signify, before God, the creation of an eternally valid life?' To maturely and effectively create a situation in which I turn back upon myself the hand of penance and deal a death-blow to self-love, is a fearful thing. Self-love is frightened of it; but self-love, inasmuch as it opposes God's interests and plans for me, must be hammered, molded, that a "new man" might appear whose affections are ordered to one end: that the Lord may appear in us. This creation of an act of mortification, then, reaches profound depths; it engages the whole personality, calls for a personal commitment that acceptance of suffering alone cannot command. What St. Paul calIs sarx--"im-morality, uncleanness, lust, evil desire and covetousness" (Col 3:5)---is rooted out only with dogged and ruthless persistence. "This kind can be cast out only by prayer and fasting" (Mk 9:18). Those who would reject all forms of mortification are, unwittingly, Platonists--any of the forms of false Gnosticism--for they make of us angels who do not need to be on the offensive against attacks of the "flesh"; they would not subscribe to a real Incarnation. Freely-chosen acts of mortification do prepare us for death because they anticipate it; but they also prepare us for the moral and physical suffering which we have admitted will be ours in the apostolate. There is no question of will power here: performing ten acts of morti-fication will not make my will ten times stronger than it was. It does increase our faith, our insight into the suffering Christ as He appears in mankind. We cannot make quick improvisations when Christ approaches in the sufferings we have not chosen. If we have begged for the grace of faith--for that is what we do when we "practice" mortification--it will not be lacking when the crosses He has prepared for us appear. To recognize Christ, where He is and who He is, is the fruit of a life of faith; this does not come full-blown from our hearts; it is the result of much hard labor. The Christian Commitment, p. 88. + + Mortification VOLUME 24, 1965 William ~. Rewak, SJ. REVIEW FOR RELIGIOUS Besides, Christ has given us an example. It is surely not a coincidence that before His public life He fasted and prayed in the desert for forty days. This unique and signal attention to the Father for the good of men is our invitation to imitate Christ at this salvific moment of His life. We need not retire to the desert, conceived of as a geographical place. But the inner quiet, the fast-ing, doing battle with each one's personal "devil" re-stores an equilibrium that leaves us docile to the inspira-tions of the Spirit. Some type of solitude is necessary for every Christian, be he a contemplative, a diocesan priest, a lay apostle, or the busy parent of a large family. This solitude will take different forms, dictated by the person's own. spiritual potential, the age he lives in, the labors he must perform as a citizen in a highly complex social and economic structure. But some type of inner quiet seems mandatory for true growth in the Christian spirit: Solitude is a terrible trial, for it serves to crack open and burst apart the shell of our superficial securities. It opens out to us the unknown abyss that we all carry within us. And. soli-tude discloses the fact that these abysses are haunted: it is not only the depths of our own soul, unknown to us, that we dis-cover, but the obscure powers that are as it were lurking there, whose slaves we must inevitably remain as long as we are not aware of them. In truth, this awareness would destroy us, if it were not illuminated by the light of faith. Only Christ,, can open out to us with impunity "the mystery of iniquity, be-cause he alone, in us today as ]or us in the past, can confront it successfully.~ ~Bouyer, Spirituality, p. 313. Apropos of the "flight into the desert," Father Bouyer is at pains to dispel the misconceived notions surrounding the early Christian hermits. They were not inspired by net-Platonic spirituality; on the contrary, he states, there was nothing more evangelical than their primary motivation. Speaking of St. Antony, he says, "Anchoritism did not make Antony a con-templative unconcerned with the fate of his brothers; it made him a spiritual father beyond all others" (p. 315). He quotes the beautiful passage ~rom the Vita of St. Antony where, after twenty years, friends break down the hermit's door in their enthusiasm to be with him and to imitate him. This is what they find: "Antony came out, as one initiated into the mysteries in the secret of the temple and inspired by a divine breath. Thus, for the first time, those who had come saw him. They were lost in wonder: his aspect had remained the same; he was neither fat from lack of physical exercise nor emaciated by his fastings and struggle against the demons, but just as they had known him before his withdrawal. Spiritually pure, he was neither shrunken with regret nor swollen with pleasure; in him neither laughter nor sadness; the multitude did not trouble him, having so many people greeting him gave him no excessive joy: always equal to himself, governed by reason, natural" (p. 314). Antony recognized that solitude allowed him to discover the obscure forces he had within himself and to discover the means to cast these forces out. Solitude was not an end in itself: it was a victory of one Spirit over the others that made him seek it. "Men can no longer tempt him, separate him from God. On the contrary, it is he who now finds himself in a position to guide them, to lead them to God. Here Mortification in the form of a retreat, in the form of fasting, became a part of Christ's plan of the redemp-tion; we can do no better than to make it a part of the role we play in the redemption¯ And this is surely the key: by mortification we enter into the Christ-mystery. We become His Body, resuming in our lives His redemptive acts, pleading with the Father for the salvation of man; for mortification is a language, not a sign. It is a response to a Person who has initiated a dialogue with me through baptism and the sacraments and through His reve~led Word. God's action in history is a word to me now; I can only trespond by placing myself before Him as His son, by per~forming acts which indicate my willingness to accept His love, to treat Him as Father¯ I accept Him as the bes.t part of my life, the whole of my life. This is prayer, of course; and mortification, as a language, is an essent, al part of my prayer life. All of my acts as a Christian. are a prayer, and they all contribute to the consolation I should experience--as a Christian--in formal~ prayer. The formal prayer itself fills the reservoirs of f~ith and love, just as formal, self-chosen acts of moruficatlon do, so that my effectiveness in the Mystical Body, through Christ in me, is increased a hundredfold. My formal mortification will result in lived mortification. I The af-fections become ordered, their false security uhmasked by a judicious use of corporal and spiritual p.enances, and the inmost person is calmly and confidently la~d open to receive God's Word. I It must not be forgotten, however, that theseI acts are relative to my present insertion into the mystery of Christ; and so all must be ruled by an expertl discern-ment of spirits. To codify too carefully pemtentlal prac-tices in the novitiate, for example, destroys the'ir mean-ing and their effectiveness; it stultifies ~nventlveness and I often just creates matter for humorous stones. Young religious, no less than young lay people, must be edu-cated in the reality of sin in their lives, in the part they must play in salvation history; and only in this way, I ¯ through the direction of a wise spiritual father, ,will they discover the path of mortification which is suitable to them. result Uniformity of ascetical practices is often the~ of pragmatic spirituality. If everybody performs an act of mortification at a certain time in a predetermaned way, there is an implied assurance that all are r~ortifying themselves. This is hardly the case. St. Ignatius, la mystic who was keenly aware of the value of acts of Oortifica-anchoritism reveals how httle it is a way of escaping from charity. On the contrary, ~t ~s simply the means of effectively ga~m.ng integral charity" (p. 315). ÷ ÷ Mortification VOLUME 24, 1965 379 ÷ William ]. Rewak~ sd. REVIEW FOR RELIGIOUS 380 tion, refused to set down any rules governing their performance: ¯. it does not seem good that in those things which regard ~Pgnsr,a ywear,t cmheindigtast iaonnd a ondth setru dayu,s oter rciotirepso,r aaln eyx reurclies essh souuclhd abse f alasti-d down for them except that which a discreet charity will dictate to each: provided, nevertheless, that their confessor is always consulted . ~ It is for this reason some countries and dioceses have cur-tailed or abolished the fasting rules. This action does not indicate the depreciation of the value of penance; it has been made obvious that the Christian obligation of penance now devolves upon the individual who, guided by the Holy Spirit and insured against error by the advice of his confessor, will perform more spontaneously and therefore more effectively the penitential practices suitable for him.27 It is not necessary that mortification be identified with corporal austerities, though these will ordinarily be useful to some extent. The best way 0f seeking mortifica-tion is in the sphere of human relations. There is much need here for broadening the scope of our penitential practices: seeking the solutions to others' problems, standing up for others' rights in the face of ridicule, intelligent obedience to legitimate authority--being a Christian individual, in other words, in a world where conformity is a despotic fashion. Father David Stanley says this was the real mistake of the Judaizers: they could not be Christian individuals in a society which con-sidered the cross of Christ a folly and a stumbling-block.~ s "As many as wish to please in the flesh compel you to be circumcised simply that they may not suffer persecution for the cross of Christ" (Gal 6:12). The state of mortification is a state of love; for love is the source of the dialogue that takes place between ~".non videtur in iis quae ad orationem, meditationem et studium pertinent, ut nec in corporali exercitatione ieiuniorum, vigiliarum aut aliarum return ad austeritatem vel corporis casti-gationem spectantium, ulla regula eis praescribenda, nisi quam discreta caritas unicuique dictaverit; dum tamen semper Confessarius consulatur . " Constitutions o! the Society of Jesus, P. VI, c. 3, n. 1 08~). ~ See Paul J. Bernadicou, $.J., "Penance and Freedom," R~vmw FOR Ra~LIOIOUS, v. 23 (1964), pp. 418-9, Father Bernadicou writes with conviction and persuasiveness of the need for expert spiritual guid-ance in the sphere of mortification. Karl Rahner applies this same principle of each one's unique entrance into and expression of the mystery of Christ to the problem of the relation between the indi-vidual and the Church, and here also insists upon the application of the discernment of spirits. See "The Individual and the Church," Nature and Grace, trans. Dinah Wharton (London: Sheed and Ward, 1963). ~ David Stanley, s.J., Christ's Resurrection in Pauline Soteriology (Rome: Pontifical Biblical Institute, 1961)0 p. 78. man and God and results in man's response of faith, prayer, and acts of mortification. Love is forgetfulness of self because of the neighbor who is loved with the charity of Christ, and what else but this is an act of true penance? Kenunciation, then, cannot but be an exer-cise in joy, for where there is love, there is joy. Our self-chosen acts of mortification, performed at times in great spiritual unrest, are tokens of confidence: Man implicitly recognizes that he does not know where his true happiness lies and that it is hidden from him, but God knows it ~or him. He perceives it through the signs which reveal it to him: the escape from Egypt, the land of slavery, the crossing of the desert under God's guidance, the hope which dwelt in the heart of the wandering host making its way to the Promised Land. The desert is the apprenticeship of an austere joy which is like the dawn on the horizon of conscience.~ We do share in Christ's resurrection, having shared in his death; and consolation will ever be the keynote of authentic Christian experience. But the fullness of joy is not yet ours for we live in the eschatological age, an age of tension between time and eternity, hope and fulfillment. Acts of mortification take on, in this con-text, the character of witness. Asceticism is the eschato-logical attitude of the Church, an attitude that is most acute in religiou

Issue 9.2 of the Review for Religious, 1950. ; MARGH° 15, 1950 Diocesan or PonHfical ? 'Joseph F. Galle. 'Virtue of Faith . John M~hews Oh'Controversy . ~. Gera[~Kelly Works:of God Manifest . .Dominic Hughes (;)uesHons and Answers Book Reviews Communications Report to Rome VOLUME IX NUMBER 2 Ri::VII::W FOR RI:::LI IOUS VOLUME IX MARCH, 1950 NUMBER 2 CONTENTS DIOCESAN OR PONTIFICAL ?--Joseph F. Gallen, S.J . 57 THE VIRTUE OF FAITH IN THE SPIRITUAL LIFE-- John Matthews, S.J . 69 OUR CONTRIBUTORS . 72 ON CONTROVERSY~ (An Editorial)--Gerald Kelly, S.J . 73 SEARCHLIGHTING ~URSELVES . 77 WORKS OF GOD MADE MANIFEST--Dominic Hughes, O.P. . 78 FATHER ELLARD'S REPLY . 91 COMMUNICATIONS . 95 SUMMER SESSION . 96 BOOK REVIEWS-- The Mother of the Savior and Our Interior Life; Ignatlan Methods of Prayer; Little Catechism of Prayer . ~ . 97 BOOK NOTICES . " . 100 BOOK ANNOUNCEMENTS . 101 QUESTIONS AND ANSWERS-- 7. Abandoned Wife Entering Religion . 104 8. Extending Postulancy, Novitiate, etc . 105 9. Postulancy outside Novitiate . 106 I0. Dowry When Transferring to Contemplative Order . 106 11. Sick Religious and Daily Communion . 107 12. Genuflections in,Chapel . 108 REPORT TO ROME . 108 THOUGHTS ON ST. JOSEPH . 112 IN MEMORIAM (Alf'red F. Schneider, S.J.) . 1 12 REVIEW FOR RELIGIOUS, March, 1950. Vol. IX, No. 2. Published bi-monthly: January, March, May, July, September, and November at the College Press, 606 Harrison Street, Topeka, Kansas, by St. Mary's College, St. Marys, Kansas, with ecclesiastical approbation. Entered as second class matter January 15, 1942, at the Post Office, Topeka, Kansas, under the act of March 3, 1879. Editorial Board: Adam C. Ellis, S.J., G. Augustine Ellard, S.J., Gerald Kelly. 8.J. Copyright, 1950, by Adam C. Ellis. Permission is hereby granted for quotations of reasonable length, provided due credit be given this review and the author. Subscription price: 2 dollars a year. Printed in U. S. A. Before wrltln9 to us, please cons,,It notice on Inside back cover. Diocesan or Pont:ific l? ¯Joseph F. Gallen, S.J. THE following pages constitute ~in effqrt to answer two practical canonical' questions: (1) should a diocesan congregation "Con-fine' itself to the diocese of origin? (2) should a' diocesa'n congregation become pontifical? These are very. important questions for many institutes. They are also questions to which angwers can. be given that are based solely on personal knowledge and espe'ciallT on personal preference. Such knowledge can be inadequate and the preference can be very subjective. Therefore, I l~ave tried to avoid mere.personal opinion and to base the answers primarily on the mind and 'v~ill of the Holy See and secondarily on the opinions that com-monly exist in the Church as found in approved authors. ~" I. DiSti~'~tion of Defi'nition between a Pontifical and a "" Diocesan Congregatiqn~ . . :,~., It is by no means unusual to encounter the mistaken opiniqfi.th, a~ a, diocesan religious institute is one that. is confined to a particul.ar. diocese and a pontifical institute one that has houses in seve.ral di0,- ceses. These false definitions are deafly excluded by canon 488, 3°: "'institute app~ou.ed bg the Hqlg See. (Religio iuris pontifical), ~every institute which has obtained from. the Apostolic S~e either ~p~r.o.-'.~ ba~ion'~o~'i.a.t, leas.t.the decree of commendation (decretur~,'l~udis)t;i Diocesan Institute, an institute erected by Ordinaries, which ~has ~not y~.t:.o."bthined this" decre~ ofcommendation.". Thu's the diStinCtiOn between a pontifical and a diocesan congregation has in itself nothing Whatever to do with territorial diffusion; it is based sblely on the p~es.ende or'absbnce of approval by the Holy See. We shall see tha~ a diocesan institute is also destined to spread to many dioceses, and d~ffu~ion~ to'. rrian~r diocese~ is only an ordinary, not ari absolfitel prerequisite for obtaifiing papal opproyal. In actual fact there are diocesan;. congregati6ns in the United 'States that haCce spread to several dioceses., It is equally true that some pontifical congregation~ in~thi~ c6dh~ry are confined to one diocese. ~All religious orders are pontifical institutes, since the approbation of 'an order is reserved to the Ho!y See. Ther?fore, institutes such as those of the Carmelite Nuns, Dominican Nuns, Poor Clares, Sacra-mentirie'Nuns, and Visithndines are pontifical. A religi0ds order is 57 JOSEPH F. GA'LLEN Review for Religious ¯ an institute whose particular law pr~scribes that at least some of the subjects at least should take solemn vows (can. 488, 2°). The hope of clarifying this o'ften misunderstood definitio'n is the justificat.for the tautology. It is not required that all of the members of the institute, but it is s~f~cient that only some of these, should either actually take solemn vows or be obliged to do so by the law of the institute. An institute can also be an order even if none of the mem-bers actually take solemn vows. It is sufficient that some should do so from the particular law of the institute.1 Solemn vows are not taken in mo~t of the monasteries of nuns in the United States, yet all of these institutes are orders since at least some of the members should take solemn vows in virtue of the particular law of the institute.2 A religious congregation is an institute in which all the members actually take simple vows, whether perpetual or temporary, and in which none of the members should take solemn vows in virtue of the law of the institute (canon 488, 2°). No religious institute can exist in the Church that has not been approved by legitimate ecclesi-astical authority. The foundation of a religious institute may certai.nly be approved by the Roman Pontiff, but in practice it is approved by the ordinary of the diocese of foundation. This approval of the local ordinary makes the congregation a diocesan institute. ~For example, article 37 of the Constitutions of the Ursuline Nuns of the Congre-gation of Paris, Pittsburgh, Pennsylvania. reads as follows: "By tight, these vows are solemn vows, as they were so approved by holy Church at the beginning: but, in fact, in this country, by disposition of the Holy See, they are only simple vows." Article 641 of the Constitutions of Dominican Nuns reads: "Those Nuns of our Order whose vows are, by constitution, solemn but who because of circumstances of time (cgn. 488, 70), by prescription of the Apostolic See, make only. simple VOWS . " -°In 1864 the Holy See declared the following monasteries of Visitation Nuns in the United States had solemn vows: Washington, (Georgetown), Baltimore (Roland Park), Mobile, St. Louis, and Kaskaskia. The last-mentioned later united with its daughter community in St. Louis. Mo. Since 1864 the monasteries that follow have received a rescript from the Holy See granting solemn vows. The year of the rescript is put in parentheses. Carmelite Nuns of the Ancient Observance: Allentown (1931): Discalced Carmelite Nuns: Philadelphia (1902, but solemn vows were first taken in 1925), Wheeling (1925), Bettendorf (1949), Louisville (1930), Morristown (1926), Loretto (1932), Rochester (1930), Mobile (1943), New Brunswick (1948): Dominican Nuns: Detroit (1929, Menlo Park (1929), West Springfield, Mass, (1928): Dominican Nuns of the Perpetual Rosary: Buffalo (1944), Camden (1947), Syracuse (1947): Poor Clare Nuns: Cleveland (1946); Franciscan Nuns of the Most Blessed Sacrament: Cleveland (1912), Canton (1925, but solemn vows were first taken in 1950): Nuns of Perpetual Adoration of the Blessed Sacrament (Spanish speaking) : E1 Paso (1930) : Visita-tion Nuns: Elfindale, Springfield, Mo. (1888). Solemn vows are taken in the Oriental Order of St. Basil the Great. Four other monasteries have applied for solemn vows¯ 58 March, 1950 DIOCESAN OR DONTIFICAL? After an initial period of growth the congregation usually peti-tidns the Holy See for papal approval. The attainment of papal approval makes the congregation a pontifical institute. It is sufficient that the Holy See approve either the institute or the constitutions. The present ordinary practice of the Holy See is to approve both. In answer to the first petition of the congregation for papal approval, the Holy See gives its first approval to the" institute by what is called a decree of praise or commendation. At the same time the Holy See gives a temporary and experimental approval to the.constitutions for a determined period of time, which now is usually seven years. At the end of this time the congregation sends another petition to Rome. The Holy See then gives a final approbation to the constitutions and, frequently at least, a definitive approbation to the institute.3 The practice of the Holy See can vary in many matters, and it has varied in the present case of the approval of religious congrega-tions. It is possible to find congregations that have long possessed papal approval and yet discern that the constitutions alone were approved by the Holy See. A doubt could and did arise as to the sufficiency of an approval of the constitutions alone, since the Code definition of a pontifical institute appears to be confined to a decree of~ praise or approbation of the institute. However, the presumption always is that a canon agrees with the pre-'Code law, and Leo XIII had originally defined pontifical institutes as those "in which in addi-tion the sentence of the Roman Pontiff has intervened, either by approval of their laws and statutes or also by the granting of praise or approbation.TM In this definition the approval of the constitu-tions is not only sufficient but apparently primary. All doubt was removed by a reply of the Sacred Congregation of Religious that the Sisters of Mercy, founded by Mother McAuley, were pontifical, whether it was a question of the independent communities or of the unions that had been established with the approval of the Holy See.5 3For the present practice of the Holy See, cf. P. Cosmas Sartori, O.F.M., duris-prudentiae Ecclesiasticae Elernenta (Romae: Pontif. Athenaeum Antonianum, 1946)~ p. 74. 4Leo XIII, Const. "'Conditae a Christo,'" 8 dec. 1900, Codicis luris Canonici Fontes III. p. 562. The same definition is repeated twice in the constitution. Cf., pp. 563, 564. nThis particular reply of Nov. 24, 1925, undoubtedly because of its general import, was published in the Acta Apostolicae Sedis, XVIII (1926), 14. It can be found in English in Bouscaren, Canon Law Digest, I, pp. 269-270. Valuable commen-taries on the reply have been written by. Maroto, Cornrnentariurn Pro Religiosis, VII (1926), 83-92: and Vermeersch, Periodica, XV (1927), 52-53. To any-one unaware of this reply the distinctive constitutions of the independent com-munities can' cause difficulty as to their pontifical character. 59 .JOSEPH F. GALLEN Review foF Religious The constitutions alone of the Sisters of Mercy were approved by the Holy See in 1841. The same thing is apt to be true of any.congrer gation of religious women approved before 1850, because of the varying practice of the Holy See in approving religious congregations. Therefore, a congregation is made pontifical by any one or m6re of the following.four approvals: approval of the institute by either a decree of praise or of definitive approbation; approval of the con-stitutions either experimentally or finally. To all congregations that have received any one of these approvals are equally applied" the rights, laws, and obligations of pontifical institutes. II. Should a Diocesan Congregation Confine Itself to the Diocese of Origin? 1. The Code of Cation Lau;.--Canon 495, § 1 reads: "A dioce-san religious congregation cannot establish houses in another diocese without the consent of both Ordinaries, namely: the Ordinary of the place where the motherhouse is situated and the Ordinary of' the place where it is desired to make the new foundation, but the Ordi- .nary of the place of delSarture, shall not without a grave reason refuse his, consent." For the first house to be erected by a dlocesan.institt~te in anothe~ diocese, this canon requires the permission not only of the ordinary of~the new house but also of the ordinary of the mother-house. We can s.ee in this law of the Code an implicit affirmation of the closer guardianship, of the greater interest, supervision, and direc-tion that the ordinary of the diocese of origin is to exercise over a diocesan congregation in the early years of its existence. The same canon explicitly forbids the ordinary of the mother? house to refuse permission for the erection of a house in another diocese unless he has not merely a. reasonable or a just reason but a serious reason for the refusal. The .Code of Canon Law, therefore, implicitly states that it is the or~linary thing for a diocesan institute to spr,ead to other dioceses and that this diffusion can be prevented only by reason of a serious obstacle. It cannot be held that thi~ seri-ous obstacle is ordinarily tO be fouiad in diocesan institutes.' If this-were factually tr.ue, there would be little sense in the law of the Code that forbids the ordinary'of the motherhouse to refuse the permissi?n, and the law would rather read: "and the Ordinary of the mother~ house may grant this permission in extraordinary cases.',Y Therefore, the" law 'of the Code is that confinement to one" dioces~ sli'~.uld ble restricted to the early years of the existence-of.a, diocesan dongrega:- fi0n wl~en the institute is a.c.qujri, ng strength rand:.sta,,~:ilit.~.: .~T.h.!.s. 60 March, 1950" DIOCESAN OR PONTIFICAL? period should not be excessively prolonged. Diffusion to other dioceses is a usual prerequisite for obtaining papal approval, but the Holy See stated before the Code of Canon Law that ten or fifteen years from the time of the foun'dation of the first house of theinsti-tute could suffice for the presentation of a petition for papal approval.6 2. Documents of the Holy See.--The Holy See both before and after the Code of Canon Law has issued norms that are to guide the local ordinaries in the erection of new institutes. One of the most important of these norms is that the ordinary, rather than found a n~w congregation, is to invite and admit into his diocese a congrega-tion already approved that has the purpose desired by the ordinary. In speaking of these congregations already approved the Holy See makes no distinction between pontifical and diocesan congregations.) Therefore, the Holy See again positively implies that diocesan insti-tutes are not to be confined to the diocese of origin. 3. Doctrine of authors.--Two authors, Fogliassos and Muzza-relli, 9 have recently made detailed studies into the juridical nature of diocesan congregations. Fogliasso states: "Certainly a diocesan con-gregation, even though it consists of only one house, unlike a mon-astery of nuns, is an organism that bg its verst nature tends to uni-versality . The purpose of the disposition of canon 495, § 1 is to prevent the local ordinary of the motherhouse from impeding the ordered diffusion of a new congregation. This diffusion together with spiritual fruits is required for the granting of a decree of praise. Furthermore, recourse can always be made to the Holy See against the arbitrary opposition of this ordinary. Therefore, the norm of canon 495, § I, while it immediately, furthers the fundamental liberty of a new congregation, which is the attainment of its own increase, paves the way for the congregation to reach the prescribed condition by which, through means of a decree of praise, it may take its place 6Normae Secundum Quas 8. Congr. Episcoporum et Regulariura Procedere Sofet in Approbandis Novis lnstitutis Votorurn Simpliciurn, 28 iun. 1901, n. 9. ~Leo XII][, Const. "'Conditae a Christo,'" § 1, III, C. I. C. Fontes, III, p. 563; Pius X, Motu Propr. "Dei providentis,'" 15 iul. 1906, C. I. C. Fontes, III, p. 675; S. C. de Prop. Fide, Instr., "'De Congregationibus Religiosis lndigenis Condendis,'° 19 mart. 1937, n. 1, AAS XXIX (1937), 276. SAemilius Fogliasso, S.D.B., lntroductio in Vigentem Disciplinara de luridicis Re-lationibus inter Religiones et Ordinarium Loci (Augustae Taur[norum: Schola T}'pographica Salesiana, 1948). 9Fridericus MuzzareIli, S.S.P., Tractatus Canonicus de Congregationibus luris Di-oecesani (Romae: apud Piam Societatem a S. Pau[o Aposto[o, 1943). 61 JOSEPH F. GALLEN Review for Religious among pontifical institutes.''~° Muzzarelli expresses the same doctrine: "The nature of a diocesan congregation precisely as diocesan is universal only in potency and capacity . . . indeed the mind of "the Holy See with regard to these congregations is not that from their foundation they should be aSso-lutely confined within the boundaries of one diocese. They are rather considered as the first stage, the first phase of juridical et~olution. When this evolution is completed they become pontifical and uni-versal in fact and in law . Hence it generally happens that these congregations become multidiocesan in a short time and l~hus are uni-versal in fact . If the ordinary (of the motherhouse) should refuse his consent, recourse is always open to the Holy See.''11 Father Vidal, S.J., whose eminence as a canonist and years of service as a consultor of various Roman Congregations should qualify him to know the mind and prac.tice of the Holy See, affirms: ". the ordinary of the place of dephrture is forbidden to refuse his " consent except for a serious reason (canon 495, § 1) ; and recourse against an unreasonable refusal would always be open to the Sacred Congregation, which will usually lend a ready ear to such a recourse, unless there is question of an institute that is faring badly and is destined rather for extinction.''x~ The doctrine that a diocesan institute should at least ordinarily spread to other dioceses is held implicitly by many of the authors mentioned below, who teach that diocesan congregations should ¯ become pontifical, since diffusion to other dioceses is in the practice of the Holy See an ordinary prerequisite for obtaining papal approval. 4. Diffusion does not imply separation.--Diffusion to other dioceses is the second phase of the natural growth of a diocesan con-gregation to the juridical maturity of a pontifical congregation. Evidently diffusion does not impiy but excludes separation from the houses of the diocese of origin. Canon 495, § 1 is speaking of the spread of the same institute to other dioceses, not of the erection of. new institutes in other dioceses. The fear of separation, however, can exist. The diffusion of diocesan and even of pontifical congrega-tions to other dioceses of the United States in the last century very frequently was followed by a separation from the houses of the diocese of origin (and the same thing occurred in other countries). ~-0Fogliasso, op. cir., 160-161. The italics in this and subsequent citations are mine. XlMuzzarelli, op. cir., nn. 51, 123. xZWernz-Vidal, Ius Canonicum, III, "De Religiosis,'" n. 61. 62 March, 1950 DIOCESAN OR PONTIFICAL Fortunately, many of these separated congregations have ultimately at least prospered in vocations and in the extent and excellence of their lives and work. These happy consequences have not always been verified. Some of these congregations are still small in number of subjects, and they toil in vain for increase in the rocky territories of few Catholics and few vocations. It would obviously .have been much better if they had remained.united to houses located in dioceses that are more fertile in vocations and also financially. Furthermore, such separations were not of their nature conducive to a progressive improvement in the spiritual and intellectual formation of subjects. These separations may not be effected now without the permission of the Holy See, since the separation would involve at least the erec-tion of a new institute and also the passing of professed religious from one institute to another, both of which require recourse to the Holy See (canons 492, § 1; 632). III. Should a Diocesan Congregation become Pontifical? 1. The Code of Canon Latv.--To Father Arcadio Larra-ona, C.M.F., the present undersecretary of the Sacred Congregation of Religious, we are especially indebted for evolving the answer from the Code of Canon Law. Father Larraona calls attention to the definition in the Code of a diocesan congregation, which is not described as one that has been approved by a local ordinary or as one that does not possess or has not obtained a decree of commendation but as one, "that has not yet (nondum) obtained this decree of com-mendation (canon 488, 3°).'' Thus the very definition of a dioce-san congregation in the Code of Canon Law manifests that it is only in an initial and transitory state and in the first phase of a juridical evolution that is to terminate in the attainment of pontifical approval,la Larraona could have derived the same conclusion from canon 492, § 2. The argument is clearer in the translation of Woywood- Smith, although it can also be d~duced from the Vatican translation. This canon reads: "A diocesan congregation retains that character though it has in the course of time spread to several dioceses, and it remains completely under the jurisdiction of the bishops, until it has obtained from the Holy See approval or, at least, the decree of praise." The Vatican translation of this last and pertinent clause is: "as long as it is without pontifical approval or the decree of commendation." The Code here again does not consider a diocesan congregation to be laLarraona, Cornmentarium Pro Religiosis, II (192 I), 284. 63 JOSEPH F. GALLEN Review for Religious . in a definitive but only in an initial and temporary state. 2. The initiative of bishops.--The most°manifest testimony of the i.nspiration, encouragement, and support of bishops to diocesan congregations becoming pontifical is the vast number of congr.egations that ha~e been approved by the Holy See. This support of bishops wa~ evident at an early date in the era of pontifical approval of congregations of Sisters. The Provinci.al Council of Avignon, held in 1849, enacted the following norm for the bishops of the province: "That [Sisters] may conform their lives to that prescribed by the rule they have professed and observe their constitutions and praiseworthy customs, that the constitutions also may have a greater authority, the bishops are to take care as' soon as possible that these be approved by the Holy See,. if they have not already been approved.''14 The bishops of the Plenary Council of Latin America, celebrated in 1899, established a similar law: "Since in congregations that have spread into several dioceses and whose constitutions have not as yet been submitted to the examination, correction, and approbation of the Holy See, here and there things have been done in good faith that are contrary to the laws and mind of the Hoist See, we decree that, the prescriptions of law being observed, such congregations which, in the judgment of the bishops, increase and give good expectations to the Church shall submit their statutes to the judgment of and petition the approval of the Holy See.''1~ 3. The doctrine of authors. Especially in this important ques-tion authors are cited primarily to manifest the mind and the will of the Holy See and also to give the answer that is generally held in the Church. Greater attention should clearly be given to the canonists who are acknowledged specialists in the field of canon law for religious. LARRAONA: This author has been engaged since 1920 in writing an exhaustive explanation of the canons on religious in the Cormnentariurn Pro Religiosis. The greatest tribute to his authority is the frequency and respect with which he is generally cited by other authors. Writing of pontifical and diocesan congregations before the Code of Canon Law, he states that diocesan congregations were not considered "as something fixed and stable but as incomplete entities, tending by their nature to juridical perfection, which in the second 14Concilium Provinciae Avenionensis, Collectio Lacensi#, tom. IV, col. 351, n. 2. l~Acta et Decreta Con¢ilii Plenarii Americae Latinae (Roinae: Typis Vaticanis, 1902), n. 324. 64 March, 1950 DIOCESAN OR PONTIFICAL? category, that is, in pontifical congregations, alone appeared to be found.''10 This same doctrine, although not with the same urgency, he later applies to diocesan congregations after the Code of Canon Law.17 He likewise affirms: ".-. the constitution of a di6cesan congregation is not very conducive to the internal unity, strength and liberty of diffusion of the institute. The result is that diocesan con-gregations have scarcely begun to evolve and to be diffused when they are borne along almost by their own weight to become pontifical, which corresponds completely to the mind of the Holy See.''~s He styles the diocesan state of a congregation as the novitiate of the insti-tute and says of this novitiate: ". the Sacred Congregation has tended and now tends to surround this [diocesan state] with suffi-cient protection and to affirm it as transitory by representing this state to the eyes of both the bishops and the congregation as a period of probation, which should not be prolonged longer than is necessary to test the spirit and stability of the.congregation and for it to obtain some diffusion. When this test has been surpassed, it is undoubtedly the mind of the Hol~l See that a decree of commendation should be requested.''1° He continues: "Unless congregations become pontifical when they reach the above maturity, experience certainly proves that they can scarcely preserve their unity of spirit, of ministries, and of government. Consequently the.i.r internal force and solidity is almost necessarily exposed to positive dangers, or at least the congre-gation is uselessly hindered and its tendency for diffusion and expan-sion impeded.''u° In another work he reaffirms the same principle: "From the nature of the case a unity of government is scarcely pos-sible if the government itself is practically divided into as many parts as there are dioceses in which the institute has houses.''~ Other passages could be cited from this outstanding author to confirm the doctrine he states above that the diocesan state of a congregation is of its very nature transitory and the mind of the Holy See is that such congregations should seek papal approval after the initial period of probation and diffusion. 16Larraona, 17Larraona, lSLarraona, 10Larraona, 20Larraona, Commentariura Pro Religiosis, I (1920), 137. ibid., II (1921)', 284. ibid., II (1921), 284. ibid., V (1924), 146. ibid., V (1924), 146. ~aLarraona, Acta Congressus luridici Internationalis, IV, "'De Potestate Dorainativa Publica in lure Canon&o," p. 153, nota 17. JOSEPH F: GALLEN Reoieto [or Religious FOGLIASSO22 and. MUZZARELLIz~ accept and assert the doc-trine of Larraona, but the latter adds: ". especially when a con-gregation has spread to distant territories a practical necessity exists of asking for a decree of praise and approval of the con'stitutions from the Holy See, if one wishes to provide for the security, unity, and becoming expansion of the entire institute.''24 BASTIEN, who is a most eminent authority on the canon law for institutes of simple vows, states in the editions of his book pub-lished both before and after the Code of Canon Law: "The condi-tion of a diocesan congregation, as described in the preceding pages, is rather precarious; spread in different dioceses, they are dependent upon various bishops, without a sufficiently strong central authority. No wonder, then, that the. Holg See desires them to leave this initial stage, and exhorts them to present their constitutions [or its ap-proval."~ 5 BATTANDIER, who is of equal authority on institutes of simple vows, states in the same editions of his hook: "But the,dioce-san institute can naturally have the desire to attach itself more closely to the Apostolic See, which will give more authority to its govern-ment, more stability to its laws, and will permit it to be assured of the future.''~° Among the authors who have expressed their opinion less strongly are the following: CREUSEN-ELLIS: "When the new institute shall have devel-oped sufficiently and shall have shown by the test of time the value of its religious spirit and its unity, it may ask of the Holy See a posi-tive approbation.''27 "The Code does not provide for the erection of provinces in an institute which is purely diocesan. When it has arrived at this importance, it should ask for approbation from Rome, which will make its life and its government more autonomous.''2s 22Fogliasso, op. cir., 160-161. Z3Muzzarelli, op. cit., nn. 51, 102. ~4Muzzarelli, op. cir., n. 102. ~SDom Pierre Bastien, O.S.B., Directoire Canonique a l'usage des Congrdgations ~ Voeux Simples (lst edit., 1904, Abbaye de Maredsous), n. 22; (4th edit., 1933. Bruges: Ch. Beyaert), n. 70. The translation is that of D. I. Lanslots, O.S.B., Handbook of Canon Law (New York: Pustet, 1931), n. 19. Lanslot's d!gest is based on Bastien. ~OMgr. Albert Battandier, Guide Canonique Pour Les Constitutions des Instituts Voeux Simples (Paris: Librairie Victor Lecoffre), 4th edit., 1908, n. 19; 6th edit., 1923, n. 20. :tTCreusen-Ellis, Religious Men and Women in the Code (Milwaukee: The .Bruce Publishing Company, 3rd English edition, 1940), n. 27. ~SCreusen-Ellis. ibid., n. 30. 66 March, 19 5 0 DIOCESAN OR PONTIFICAL? BOUSCAREN-ELLIS: "'It is the mind ot: the Church that after a diocesan congregation has developed its membership and spread to other dioceses, and has given satisfaction in its pursuit of good works, it may apply to the Holy See for pontifical approbation and thus become a po.ntifical institute.''2~ REGATILLO: "Diocesan congregations are not accustomed to be divided into provinces because when they are sufficiently diffused they become pontifical.''~° RAMSTEIN: "Since every religion of diocesan law normally entertains the hope of acquiring in time the status of a religion of papal approval . JOMBART: "A congregation spread into several dioceses and flourishing generally desires to become pontifical.''z2 "A multidioce-san and large congregation desires almost always to become pon-tifical, the better to safeguard its unity.''3~ Doctorate dissertations in canon law of the Catholic University of America have expressed similar opinions: ORTH: "The great difference that exists between episcopal and papal approbation is well known and, since the papal dxcels the epis-copal in extent, being wider and greater in effects and giving assur-ance of an unerring guidance, it is not in the least surprising that from the start, a new religious congregation will have this in view, to obtain a favorable decision'concerning itself from the Holy See. In its early stages a new community is still in an imperfect condition. Though entirely an autonomous society, yet it is subject to many restrictions on the part of the bishop. Besides formerly if it should chance to spread into other dioceses many things militated~ against unity which is a prime requisite in order that the institute preserve its original nature and purpose. In this respect nowadays it is welI pro-tected by the Code. The aim of the new society will be to have firmness and stability, to be enriched with all the privileges and favors of Mother Church, which aim will not be fully obtained unless it has received the seal of definite approbation from the Head of all christendom.''34 "The spread to other dioceses is considered ~t0Bouscaren-Ellis, Canon Law (Milwaukee: The Bruce Publishing Company, 1946), p. 234. Z0Regatillo, lnstitutiones luris Canonici (Santander: Sal Terrae, 1946), I, n. 650. 81Ramstein, A Manual of Canon Law (Hoboken: Terminal Printing ~ Publishing Co., 1947), p. 299. a22ombart, Traitd de Droit Canonique (Paris: Letouzey et Ane, 1946) I, n. 810, 2. 33Jombarr, ibid. 8'~C. R. Orth, O.M.C., The Approbation of Religious Institutes (Washington: The Catholic University of America, 193.1), p. 131. 67 JOSEPH 1::. GALLEN the best reason for asking the approbation of the Holy See, because in that case there would be as many heads as there are bishops of the places where the community is established and this multiplied gov-ernment is not conducive to unity.''s5 FARRELL: "When a congregation has received pontifical appro-bation many phases of its subjection are withdrawn from the local Ordinaries in whose territory the congregation exists, and this juris-diction is supplanted by direct subjection to the Holy See. Thus, unfettered by the divergencies of the multiplicity of diocesan juris-dictions, the congregation achieves an extensive opportunity to exer-cise in a wider way the autonomy of moral personality, affording a unity of purpose through the various ramifications of its internal government to accomplish more effectively the work and purpose of its foundation.''s° IV. Conclusion The reader is now in a position to give his own answers to the questions of this article. These answers should be based primarily on the mind and will of the Holy See and on the common opinion in the Church. If the will of the Holy See is evident with regard to any action, arguments in favor of or contrary to that action are simply a matter of indifference. The intrinsic arguments for seeking papal approval emphasized by the authors cited above are: (1) the government and the constitu-tions of the institute receive a greater authority; (2-) the central and internal government becomes stronger; (3) the unity of govern-ment, spirit, and ministries of the institute is preserved;. (4) the in-stitute is endowed with a greater stability and is thus better able to preserve its original nature-and accomplish its original purpose: (5) the life and government of the institute become more autono-mous; (6) the institute has a greater liberty of diffusion and thus of increase. To these can be added (7) the more autonomous character of the institute naturally begets a greater internal initiative; (8) the immediate subjection to the Head of all Christendom and the wider diffusion of the institute are more apt to engender the universal view-point of the Holy See; (9) the constitutions approved by the Holy See and examined and corrected by specialists will very likely possess a greater excellence and utility. s~Orth, ibid., p. 145. SOB. F. Farrell, The Rights and Duties of the Local Ordinary Regarding Congrega-tions, o[ Women Religious o[ Pontifical Approval (Washington: The Catholic Uni-versity of America Press, 194~1), p. 56. 68 The Vir :ue of F:ait:h in :he Spiri :ual Life ~lohn Matthews, S.~I. BY ITS BAPTISMAL BIRTH man's soul receives divine life for the first time. It takes on a wholly, new and higher life. A second life comes into the soul and into its powers of mind and will. While sanctifying grace lifts the soul to a divine way of life, the virtues of faith, hope, and charity fill man's mind and will with the strength he needs to live his higher life. Thus grace thrbugh faith, hope, and charity makes us new men with new minds and wills. But what is faith? Life means power; faith is a God-given power of our grace-life. Life means lasting power; on this earth the holy person always possesses faith. This faith is a virtue, a power to take God at His word. By faith in action we believe God just because it is God who has spoken. In faith we bend our minds to the authority of God, of God's Son 3esus Christ and of God's Church. Man has a duty of bowing his whole self before God; through faith be subjects his mind to God. Thus faith is belief in God because He knows and tells the truth; those who enjoy such faith we call the faithful. In our Christian life this virtue is absolutely necessary. ~¢ usually comes through baptism and is lost only by mortal sins against faith such as heresy and apostasy. So the grown-up without faith lives in serious sin and has turned himself away from both God and heaven. "But without faith it is impossible to please God" (Heb. 11:6)--in the way God wants to be pleased, honored, adored, loved and obeyed, i.e., in the supernatural way of life. Again, we need faith because it enters into every deed of our grace-life. In all these works faith is at least implicit. Lastly, as souls born of God, we must have faith. For, as the child must be able to take his parents at their word, so we must be able to believe our heavenly Father: and we do this by faith~ "For you are a11 the children of God by faith" (Gal, 3:26). This important virtue of which we speak is a supernatural gift. It forms part of the equipment by which holy souls live and grow in the divine life. With this faith we know truths man could never know of himself. All the genius of Aristotle, Shakespeare, and 69 JOHN MATTHEWS Review [orReligious Edison could never figure them out; all the power of all men's minds could, never guess them. For by faith we know divine truths in a divine way. We see with certainty what God has told men through Christ and the, Church;; we take a .deeper look into God's teachings; we view everything with a sight and understanding far beyond the human. Through faith, furthermore, we possess the mind of Christ. "But we have the mind of Christ" (1 Cot. 2 : 16). This is the new mind we receive along with the new life of grace. No longer do we think and plan in a merely human{ way but we think as Christ did, we plan as Christ planned, we value what Christ valued. We think holy thoughts; we know the truths Christ knew and chose to tell us; we accept His judgments and values on everything, e.g., on the world, on race and color, on the human soul. With the new mind of faith the supernatural man looks on all things in their relation to God and to his own salvation. This is faith at work--a living active fruitful faith: The virtue of faith, while itself interior, produces acts of faith both interior and exterior. Indeed, the faith of God's children must be a working faith. Such is the message of St. James in his Epistle. "For even as the body without the spirit is dead, so also faith without works is dead" (James 2:26). Possessing the mind of Christ, we must use that mind to live our divine life. For faith is the rock-foundation of our morals, our devotions, and our liturgy. Hence our holy deeds must be rooted in and must spring from faith in action. The "man of God must live by faith, and this he does when he bows his mind to divine truth on God's authority and when he guides his actions by that truth. Faith guides our actions by entering into there. It underlies and penetrates all our virtuous acts. The Catholic can hope for heaven only after faith tells him heaven exists. The faithful obey Christ's Church because faith assures them it is the true. church. Penitents by approaching the confessional bear witness to their faith that God's priest has power to forgive sins. In his belief that bap-tism is necessary for salvation, the Catholic father bears his child to the font of eternal life. Confirmed in faith, God's children adore the Eucharistic Christ, receive Holy Communion, and offer the Holy Sacrifice. As another instance of how faith penetrates.our life of holiness, let us consider charity. This latter virtue shows .itself in many diverse acts (1 Cot. 13:~r-8). There is the love of God above all 70 March, 1950 VIRTUE OF FAITH else, which we must practice in order to continue living the divine life. There are the works ofmercy, compassion' for one's fellow men, perfect contrition, almsgiying, the love of our neighbor in Christ, th~ expending of self for God's sake and for others. The reason why holy souls do these charitable deeds is the love of God in Himself and of men in God. But this infinite lovableness of God they know through.faith, which teaches them that God deserves to receive our purest love. Thus faith enters into our works of charity by supplying a supernatural reason for doing them. So too in all the circumstances of life does faith play its divinely assigned part. The truths we believe have power to overcome our human fear, weakness, and distrust of seIf. How often Our Savior spoke these words: "thy faith hath made thee whole" (Matt. 9:29; 15:28; Luke 8:48; 17:19). In the face of temptation, sickness, evil habits, poverty, andpersecution our faith gives us grounds for confidence that we can overcome all hardships in a Christlike man-ner. "This is the victory which overcometh the world, our faith" (1 dohn 5:4). In. order to see further the force and value of Catholic belief in the soul, let us view two men-~one with and the other without faith. On the death of a relative the latter can give only human sympathy, cannot help the deceased, can only send flowers and'can-not comfort the bereaved very'greatly. The real Catholic through his faith speaks words of divine sympathy. He helps both his dead relative and bereaved kinsfolk--by his comforting words, by his prayers and Masses and virtuous deeds. The soul without faith grieves as those "who have no hope" (I Thess. 4:13); the faithful soul sees in death God's will, entertains the hope of eternal happi-ness for his dear deceased, and offers his pain at bereavement to help his relative into heaven. Again the work of faith appears when these same men yisit a Catholic church. To the faithless person the church is a structure--perhaps, a thing of beauty; to the faithful, it is a home, a holy place, the house of God. For the former the stained-glass windows may be works of art; for the Catholic they serve to recall the mysteries of his religion and to hold his mind in prayer. In the opinion of the man without faith the baptismal font, confes-sional, and altar rail are the ordinary furnishings of a church; the child of God esteems them as sources of divine life in his soul. To his mind the tabernacle is no mere happening but the abode of Christ in the Eucharist; the altar is no chance property but the place of daily sacrifice, the bne thing withoutt which no building can be a church: 71 JOHN MATTHEWS the sactuary lamp is not just an adornment but a sign to the faithful that Jesus is at home, waiting for their visit. In the Catholic church the person who has not faitl-J is a stranger and sight-seer, the man of faith is at home with Jesus in His Father's house. So vast is the difference between the person without faith and the man whose actions are wholly penetrated by tiis Catholic faith! Let us sum up now the work of faith in the divine life of our soul. The virtue of faith gives us a new mind, enlightened with the new truths of Our Lord's Testament. A grown-up receiving the virtue of faith, may seem the same after his conversion as before-- ¯ but he is not. He has new thoughts; he knows God's new com-mands; all events in his life take on a divine meaning for eternity: his belief gives a heavenly purpose to his actions: he will soon show by his outward deeds of virtue the inward change within his mind. "For with the heart we believe unto justice: but with the mouth confession is made unto salvation" (Rum. 10:10). Moreover, to live the life of grace we must 1ire a life of faith. This virtue must influence' a11 our actions. Hence our every deed must be an act "of faith, must bear witness that we choose~ to be amongst God's faithful, must be a profession of our belief. Our religion, which is our .faith, must underlie all the circumstances of our lives and give them a Catholic tone and value. That is the work ¯ of faith. Thus by living a life of faith we actively live our grace-life. "The just man liveth by faith" (Rum. 1:17). Indeed, our faith and our divine life grow step by step together. For every holy deed we do God gives us this reward: our grace-life grows fuller and at the same time our virtue of faith is so deepened and enriched that it becomes stronger against temptation, that we are more Christ-minded, that we can make greater acts of faith. In this manner faith plays its important part in the growth of our divine life. OUR CONTRIBUTORS JOSEPH F. GALLEN and JOHN MATTHEW8 are members of the faculty at Woodstock College, Woodstock, Maryland. DOMINIC HUGHES is a member of the Pontifical Faculty of Theology, Dominican House of Studies, Washington, D. C. 72 On Controversy WE HAVE RECEIVED certain c,r, iticisms for publishing "Thd Three Ages o~f the Interior Life, by G.'Augustine Ellard, S.3". (Cf. REVIEW FOR RELIGIOUS, VIII, 297-317.) One criti-cism is that the "theological erudition" of Father Ellard's article "takes advantage of readers who lack the technical preparation neces- Sary to measure its true weight." (Cf. IX, 42~-43.) Another criti-cism, not sent for publication, is that Father Ellard's article contains controversial matter, and that a magazine like ours should keep clear of controversy. It seems advisable to explain our position. Father Ellard's article was a book review; and the work he reviewed (The Three Ages of the Interior Life, by Father R. Garri-gou- Lagrange, OIP.) is decidedly theological. It is difficult to see how a v~ork of this kind could be reviewed without using theological erudition. Moreover, The Three Ages is intended, as least partly, for just such people as our readers; hence it seems that the theological erudition used in reviewing the work would no more take advantage of readers than would the work itself. It might be added here that one of the precise purposes for founding this REVIEW was tO present sound theology without the technical accompaniments that are usu-ally found in a strictly theological journal. As for controversy, we have always tried assiduously to avoid controversial topics or at least to avoid taking sides in any theologi-cal debate. Less than a year ago, when we published "Mystical Life--Mystical Prayer," by M. Raymond, O.C.S.O., we were care-ful to prefix to the article an editorial note indicating that Father Raymond's view was only one of three legitimately defended opin-ions on the normal development of the spiritual life. We expressed no preference for any of the opinions. (Cf. VIII, 121,) No one objected to our calling attention to the controversial nature of Father Raymond's article. Why, therefore, should anyone object to Father Ellard's pointing out that certain basic questions in The Three Ages are subjects of legitimate controversy? It would be naive to imply that, in publishing Father Ellard's .article, we did not expect contrary reactions. Since the author of The Three Ages has many admirers, it was quite likely that some of 73 ON CONTROVERSY Review for Religious them would come to his defense. It is clear, then, that in publishing the book review, we had to run the risk of controversy. The only ways oi~ avoiding it would be to refuse to review the work, or to publish an insincere review, or to print a sincere review without allowing a rebuttal. None of these procedures was or is desirable. Hence, we have some controversy, and perhaps it may continue for a time. We trust that our readers will find it both interesting and profitable. In this issue we present an article by Father Dominic Hughes, O.P., in rebuttal to Father Ellard, together with a brief reply by Father Ellard and a communication defending his position. Other'expres-sions of opinion on either side will be accepted. However, lest this subject .matter consume disproportionate space in the REVIEW, it seems necessary to limit further contributions to communications. Conditions for acceptance of these communications will be found on page 96. Now a word about Father Hughes's article. In some aspects it differs from our usual editorial policy; yet it seemed better, under the circumstances, to waive insistence on policy. What he says, however, about doctrinal authority in the Church, especially the authority of Doctors of the Church in general and of St. Thomas Aquinas in particular, calls for special editorial comment. For the most part this comment will simply agree with him and emphasize the truth of what he says; in one point it will at least qualify one of his views if not express a complete difference of opinion. Father Hughes rightly observes that the highest doctrinal author-ity in this world is the teaching Church. And this truth needs emphasizing in our times, even in the case of many devout laymen. This teaching Church is composed of the Pope himself, and of the bishops of the world united with tbe Pope, whether in a general council or ~in their respective dioceses. Theologians graphically and reverently style the~e successors to the Apostles theVioum Magisterium (the living teaching body) or simply the Ecclesia Docens (the teaching Church). It is a wonderful thing, this living teaching Church; it pos-sesses not only the great truths of revelation with which Christ and the Holy Spirit endowed the Apostles but also all the wisdom of the succeeding centuries which has been used in the exploration and explanation of the original endowment (the Deposit of Faith,. as it is. called), The Doctors and other theologians have authority only in so far as they express either the doctrine of this living .Church or 74 March, 1950 ON CONTROVERSY speculations which are in conformity with that doctrine. The revelation confided to the Church is a limitless treasure; and our knowledge of the doctrine and its implications is subject to con-stant growth. In this process 9f growth through the centuries there have always been questions that were not clear, that needed further exploration and illumination. Consequently, there have been and are divergent opinions, with abIe scholars defending contrasting views, without remonstrance and even with encouragement from the Church. The interesting question thus arises: how is the theologian of today to align himself in such controversies? Thd first duty of the true theologian is to judge the reasons of the respective sides in the light of already established principles and doctrines. Finding the reasons lacking sufficient cogency to win his preference, he might then inspect the authorities holding the different views. Suppose that in a debated question such as I have just outlined, a Doctor of the Church would be the principal defendant of one opinion. Should he, by the very fact that-he is a Doctor, win the theologian's intellectual preference? I get the impression from Father Hughes's article that he would answer this question in the affirma-tive. If this impression is correct, there is room here for a difference of opinion. The title of Doctor of the Church includes an official declaration of eminence in theological learning, but not necessarily pre-eminence over all uncanonized scholars. The eminence of some of these uncanonized theologians is attested by the constant use of their works in theological schools and even by the great, confidence placed in them by the Church while they were still living. Father Hughes suggests that in the canonized Doctor there is the added con-sideration of supernatural wisdom. But this wisdom is not limited to the canonized; it accompanies grace and virtue, not canonization. And history attests that many of the uncanonized scholars were men of lofty virtue. For example, speaking for Benedict-XV, Cardinal Gasparri styled Scotus a "most holy man,"; and speaking for himself Leo XIII referred to eminent Jesuit scholars (none of whom .were then Doctors of the Church) as men of "extraordinary virtue." So much for the authority of Doctors of the Church in general. As for St. Thomas Aquinas in particular, it is unquestionable that the Church's esteem for him is unique. Canon 1366, § 2, directs that professors of philosophy and theology should treat these subjects after the method, doctrine, and principles of the Angelic Doctor, and ¯ should hold these as sacred. An examination of the many documents 75 ON CONTROVERSY Review for Reliflious referred to in the sources of this' canon shows that it is but a capsule formulation of the insistent injunctions and directives of Leo XIII, Plus X, and Benedict XV. These Popes considered him not merely as an individual but also as the representative of all the great Scho-lastics of his time because in his works the best of their teaching is most perfectly embodied. Six years after the promulgation of the Code of Canon Law, Plus XI reaffirmed the praise and injunctions of his predecessors in an encyclical letter (Studiorum Ducem, June 29, 1923) which is rightly called a papal commentary on canon 1366, § 2. Finally; just a few months after he became Supreme Pontiff, Plus XII, in an address to clerical students in Rome, .recalled and approved all these directives (June 24, 1939). Obviously, therefore, the Church wants professors and students of philosophy and theology to follow St. Thomas. Ye~ it is not to be a slavish following which, in the words of Benedict XV, "would clip the wings of genius with consequent injury to the deeper study of theology," (Spoken in an audience granted to the Jesuit General and his Assistants, Feb. 17, 19.15.) 'This is not the place to try to indicate precisely the legitimate limitations to the following of St. Thomas; but it may be well to show, through the words of the Popes themselves, that the~e are some limits. Speaking of the "wisdom of Aquinas," Leo XIII insisted that he did not wish to propose to our age for imitation "anything which does not duly agree with the proved findings of a later age;" or any-thing "which does not hax~e its measure of probability." (Cf. the encyclical Aeterni Patrfs, in Fontes Codicis, III, p. 149.) Benedict XV declared in a letter to the Jesuit General (Mar. 19, 1917) that the Roman Pontiffs "have invariably held that St. Thomas must be regarded as the guide and master in the study of theology and phi-losophy,, although everyone retains full freedom to argue for either side of those questions which can be and are wont to be disputed." Pius XI, having enjoined the strict observance of canon 1366, § 2, added: "But let no one require of others more than is required of all by the Church herself who is the teacher and mother of all; for in those matters in which there is division of opinion among the best authors in Catholic schools, no one is forbidden to follow that opinion which seems to him to be nearer to the truth." (AAS, XV, 324.) Finally, in the address previously referred to, Pius XII said: "At the same time we make Our own the warnings of these same Predecessors, whereby they sought to protect genuine progress in sci- 76 ON CONTROVERSY ence and lawful liberty of research. We thoroughly approve and recommend that the ancient wisdom be brought into accord, if need be, with the new discoveries of scholarship; that there be free discus-sion of points on which reputable students of the Angelic Doctor commonly argue; that fresh resources be drawn from history for the better understanding of the text of St.Thomas." (AAS, XXX; 246-47.) Some people, hazily cognizant of historical disagreements on certain profound questions, seem to think that Dominicans and Jesuits are always on opposite sides of a theological debate and that Jesuits are not followers of St. Thomas. The impression is false. And it may be informative to add here that St. Ignatius enjoined the study of the "Scholastic doctrine of St. Thomas," and that this rather general prescription of our constitutions was made very definite by our Fifth General Congregation (1594), which legislated that Jesuits must consider St. Thomas as their own special doctor. The words of Leo XIII are witness to the fidelity of Jesuits in carrying out this command. Speaking of eminent Jesuit theologians, the Pope said that "being as they were, men of extraordinary virtue and talent, and applying themselves assiduously to the works of the Angelic Doctor, with certain arguments they expounded his tenets in a manner full and excellent,, they adorned his doctrine with the rich trappings of erudition, they made many keen and practical deduc-tions therefrom for the refutation of new errors, adding besides what-ever declarations or more exact decrees had since that time been made by the Church in this same field. The fruits of their industry no one in truth can spurn without loss to himself." (Apostolic Letter Gravissirne Nos to the Jesuit General, 1892.) --GERALD KELLY, S.J. SEARCHLIGHTING OURSELVES Many shrewd observations for retreats and tridua are found in Searchlighting Ourselues, the Retreat Notes of Father Timothy Brosnahan, S.J., edited by Francis P. LeBuffe, S.J. The book contains notes on the various meditations of The Spir-itual Exercises, several conferences on basic points of the spiritual life, and a number of special meditations, notably a series on the Beatitudes, for use during tridua. Jesuit Seminary and Mission Bureau, 51 East 83rd St., New York 28, N.Y. 77 Works of Made/v anit:es!: Dominic Hughes, O.P. CHARITY and solicitude for souls moved .Father Ellard (RE-VIEW FOR RELIGIOUS, November, 1949) to lay several stric-tures upon Father Garrigou-Lagrange's Three A~es of the Interior Life. That same charity now prompts a staying hand. Petulance or truculence cannot rise to defend either side in chari-table controversy. Neither party can reprove the sincere expression of an opinion any more than either can approve indefiniteness in doc-trine or ineptness in expression. Rather both must call upon charity's constant companion, wisdom, whose "abode is in the full assembly of the saints" (Ecclesiasticus 24: 16). However unqualified writers or readers may be in matters secu-larly or sacredly scientific, their judgment from wisdom will partake of that calm and certitude of those aware that "If anyone desires to do His will, he will know of the teaching whether it is from God" (,John 7:17). Even in these controversies about subsidiary doc-trines and their suitable expression something of the clarity and security of a truly wise appraisal is attainable, "for the spiritual man judges all" (I Corinthians 2 : 15). The judgment of the spiritual man is based on neither caprice nor allegiance, but solely upon wisdom. "It pertains to wisdom," --St. Thomas, the Common Doctor, expressed the common doc-trine--" to consider the highest causes through which it may judge of other things with the greatest certitude and according to which it should order other things" (Summa Tbeolo~qica, II-Ilae. q.45, a.1). Wisdom, then, has one main product and two by-products. The primary product of any habit of wisdom is a "consideration of the highest causes." In the different orders of reality and knowl-edge, various highest causes attract the attention of divers kinds of wise men. In any case, however, the object of wisdom's considera-tion is the ultimate, in words as in works. In works the absolute ultimate in no way ordered to anything further, and the measure of all, are the works of God made manifest in the works of Christ. Relatively ultimate, first and last in a particular line, and the measure of that group, are the works, for example, of a founder of a religious society, so that St. Ignatius would be the measure of the accomplish-ments as Jesuits of his followers, even of the glorious achievements 78 March, 1950 WORKS OF GOD MADE MANIFEST of St. Francis Xavier and St. Robert Bellarmine. In words, the absolute and unassailable ultimate is the voice of the Church and Sacred Scripture. Relative ultimates, too, are found in various writings: .those of St. Thomas for the whole of theology, those of St. Alphonsus Liguori for practice in moral problems, and those of St. 3ohn of the Cross inmatters mystical. Upon the basis of this "consideration of highest causes" wisdom has as one of its by-pr0ducts a judgment of things other than the highest cause itself "with the greatest certitude." The maximum of security in judgment is not invariable, but will change according as the highest cause is either absolutely or only relatively ultimate. In matters in which the Voice of God has not yet been heard---or may never be--the certitude attainable cannot be as unqualified as when the Church has spoken. Yet various other causes may be given a limited but appreciable certitude as they more or less cogently elimi-nate any worthy fear of contradiction. Moreover, some considera-tions within the scope of wisdom's judgment, metaphysics for example, need admit of no exceptions. Moral judgments, of which the mystical is a phase, however, can attain a certitude about human actions only "as they most often happen." "For it is the mark of the educated man to look for certitude in each class of things just so far as the nature of the subject admits" (Aristotle, I Ethics, c. 3). In this spirit, St. Augustine, who was well aware that no case was finished until Rome had spoken, expressed a wise certitude: "I do not wish my reader to be bound down to me, so I do not wish my corrector to be bound down to himself. Let not the former love me more than the Catholic faith, let not the latter love himself more than the Catholic verity . Do not be willing to amend my writings by thine own opinion or disputation, but from the divine text or by unanswerable reasons." (On the Trinity, Bk. III, Preface.) The mere possibility of an unwarranted contradiction because his every word was not inspired or even uncontested--was not enough to unsettle the mind of St. Augustine, even about what he himself had written. Certainly others reading his words so often approved by the Church can reach the "greatest certitude." Like-wise, concerning a wide variety of matters, even without a decision of the Church or a consensus of theologians, certitude can be had upon the basis of either the arguments proposed or auth6rities cited. The citing of authorities is not a matter of number but of weight. The weight of one Doctor of the Church can overbalance toward 79 DOMINIC HUGHES Review [or Religious certitude any dispute, despite the contradictions of a multitude of theological scribes. Weighing such authority is the second by-product of wisdom. From a catalog of opinions or an enumeration of members of various schools a deep appreciation of human limita-tions may be derived, but scarcely a wise judgment. Wisdom, in addition to considering the highest causes and judging other things with the greatest certitude, orders other things .acgording to the highest cause, either in any particular grouping or according to the absolute ultimate itself. It does not gather a crowd but establishes a hierarchy. Not how many authors may be found who differ from one another, but how they are arranged relative to the primary master of the subject, e.g., ~lohn of the Cross~such is the judgment of wisdom. This wise ordering of authors, moreover, avoids two extremes. Spiritual atavism is inclined to bow so low and so often before the ancestral authority of a father, either of the Church or even of a particular spiritual family, that little opportunity is afforded for examining or explaining doctrinal implications or making practical applications. The other extreme to be shunned, more a tendency than a tenet, is a mollified "modernism." Those affected by it are disposed to judge the latest as the best, the more contemporary as the, more commendable. The foundation for avoiding both extremes, too much of the past, too much of the.present, and of formulating a truly wise judgment is an ordering, not according to.personal prefer-ences but according to principles. The principles of wise judgment are not personal but the peren-nial preferences and special approbation of the Church. When the Popes have praised and so often used particular authorities, e.g., St. Augustine or St. Thomas, as the highest, though not the exclusive causes for engendering certitude in the judgments of the faithful, there is little fear of worthy contradiction in following their example. In that case, other theological or spiritual writers, as they more or less approach and approximate the doctrines of these highest causes of the greatest possible certitude will take their place in the estimate and esteem of wisdom. The impressiveneses of such considerations as numbers, either of authors or copies of their works sold, avail-ability in English, or other such shavings of certitude is, for wisdom, negligible compared to the arguments or authority of but a single Doctor of the Church. These teachers of the "mind of Christ" offer principles at once profound and practical. The highest in heaven always seem the most down-to-earth. None realized more than they how each soul 80 March, 1950 WORKS OF GOD MADE MANIFEST must budget its talents, using a few well-coined principles through- Out its spiritual life to make both ends meet---in God. Prodigality in principles and in words, they were sure, would contribute to neither practicality nor profundity. With but little, and all of that Christ's, they sought and saw the deep things of God and the deep things of each soul on its way towards Him. The profundity and practicality of other spiritual writers can be wisely appraised only as it more or less approaches what is found in the Doctors both in their wisdom by infusion and their Wisdom by 'industry. Together in a single act these fountainheads of truth converged to give the saintly doctors their certitude. In others--so often what is united in superiors is divided in inferiors--an actual judgment is the result of either one or tlSe other, either of wisdom by infusion or of wisdom by industry. Wisdom by infusion, the science of the saints, as a Gift of the Holy Ghost judgeswith certainty and orderliness, not through metaphysical discourse, but by a loving accord with its object--"by tasting and seeing that the Lord is sweet." Wisdom by industry, the science of theology, on the other hand, secure though it is in the principles of faith, suffers the labors and infirmities of all human effort. Yet,. at times, wisdom by infusion must appeal to wisdom by industry to corroborate its expressions and to co-ordinate its findings; the mystics and spiritual writers must submit divine truth to the scribes in theology for a test in human terms. Wisdom's test, in human terms, concerning the charitable contro-versy over the divergent views of Father Garrigou-La~range and Father Ellard involves two major considerations: doctrine and method. The points of doctrinal divergence most worthy of mention con-cern the Gifts of the Holy Ghost: contemplation: its place and kinds; and the unity of the interior life. The methodological differences arise either positively from the stress or emphasis of one doctrine more than another, or negatively through the omission of detail by some considered as integral to any spiritual treatise. WISDOM IN WORDS: DOCTRINE The points controverted concerning the Gifts of the Holy Ghost are their necessity, nature, function, and number. " Concerning each of these points separately, and cumulatively, too, Father Ellard brings forth his hobgoblin--uncertainty. Upo'n how little might be said with certainty there can be found only the sole small voice of scholarly research, Father DeBlic, who 81 DOMINIC HUGHES Review [or R'eligious minimizes w.hat even Father De Guibert, S.J., thought .an irredu-cible denominator. Many Dominican theologians, are cited as recog-nizing a.controversy upon the matter, but the conclusions of each do not seem worthy of mention by Father Ellard. If thi~. process were pushed to its principle, it would imply that as soon as a point is questioned it immediately becomes questionable, and as soon as doubted, doubtful. Such can. scarcely be a moving principle to wis-dom which has ordered authorities according .to the highest among them and thus attained the "greatest certitude." To corroborate the general judgment of wisdom, however, each subordinate point which has come under scrutiny may well be examined. The necessity of the Gifts, as explained by St. Thomas, seems to have suffered the least from the minimizing tendencies of later and lesser theologians. None of the mystics, moreover, have found them a luxury. They are vital to the life of divine grace; "the just man," Leo XIII testified in his Encyclical Dioinum illud munus (May 9, 1897), "has need of these seven gifts." Because of the overwhelming testimony in tradition to the intimate association of the state of grace and presence of the Gifts, even the doughtiest opponent of Thomistic doctrine on the Gifts must treat the denial of this point as negligible. The nature of the Gifts, however, is quite another matter. "They make us docile to the Holy Ghost," according to a formula suffi-ciently broad to embrace all'variants, but not to preclude precisions. While all would agree that docility to the Holy Ghost is of the essence of the Gifts, as Father Ellard triumphantly pointed out to drive in the wedge of uncertainty, "not all" would ,concur with St. Thomas in finding them distinct habits in the soul. The words of Sacred Scripture itself give warrant for St. Thomas's doctrine, inasmuch as they imply a unique divine influx. This,doctrine of St. Thomas cannot lightly be set aside. His reason cannot be dis-proved, his authority no one can gainsay. Although obviously not of Faith, his doctrine has an approbation by the Church incompar-ably above any i~f those proposed by Father Ellard as competitors for our certain allegiance. Ordinary permission to teach or publish thisis only a faint resemblance to the abundant approval given to Doctors of the Church. In them, because of their sanctity and the special scrutiny of their works, the Church recognizes unique wit-nesses and guardians of her patrimony, the doctrine of Christ. Over and above the acclamations usually given to a Doctor, St. Thomas has received frequent and unique marks of esteem from the Church. Pope Pius V referred to him as "the most certain rule of Christian 82 March, 1950 X~rORKS OF GOD MADE MANIFEST doctrine," and Pope Clement VIII was sure that he could be "fol-lowed without any danger of error." These" and many other state-ments by successive Popes are not private hyperbole but public declarations, normative if not mandatory in Faith. Against this weight of certitude from St. Thomas, Father Ellard proposes (p. 305) a theologian described, in a citation from clerical students, as the."Subtle Doctor." Of the su.btlet~r of'Scotus there is no doubt; but of the tebm "Doctor" as applied to him there is con-siderable reason for hesitance. No more of a' Doctor of the Church than so many others who have taught in her schools throughout the centuries, Scotus has neithe~ the approval of his sanctity nor of his doctrine that is required of a Doctor. His opinion is, therefore, of an entirely other brder in certitude from that of St. Thomas. It is on a plane "with that of Suarez, who could not concur with St. Thomas in the matter of grace but could affirm against Scotus that he appreciated the importance of distinguishing between the virtues and the Gifts. The allegiance, moreover, of St. Francis de Sales to the doctrine of Scotus cannot be alleged'with certitude. The Gifts are, in the words cited by Father Ellard' (p. 306), "the virtues, properties and qualities of charity." (Cf. The Looe or: God, XI, 15.) "Speaking precisely," as St. Francis assured us he was doing, all these entities are distinct from the essence, although perhaps inseparable from it. In like manner, although the Gifts and charity are always together, they do not merge into one habit, otherwise the same might be said of St. Francis de Sales' doctrine of the relation of charity and the other infused virtues. Charity would not then be the "gift of gifts" (XI, 19), but the one gift, n6t the essence or bond of perfection, but the whole of the spiritual organism. There is nothing suffi-ciently explicit in the words of St. Francis de Sales to indicate an approval of the Scotistic opinion or the disapproval of the doctrine of St. Thomas. Even if a rivalry were established between these two Doctors of the Church, inasmuch as the matter is one of theological principles, the preponderance of authority would easily go to St. Thomas. To St. Thomas, then, and not to Father Garrigou-Lagrange, wisdom looks for its "highest cause" according to which it might order other opinions and thus attain the "greatest certitude" possible concerning the nature" of the Gifts. Obviously, Pohle-Preuss, Forget; Van der Meersch, and legions of other writers who subscribe to what is least as what is safest, are far from disturbing the certitude of 'a 83 DOMINIC HUGHES Reoiew for Religious soul in which wisdom dwells. The judgment of wisdom appre-ciates the authority and approves the arguments, the sublimity and certainty, of the doctrine on the Gifts proposed without equivoca-tion by St. Thomas. Allegedly based upon St. Thomas and employing his authority is the more recent confection of two different modes of the Gifts in life. The gesture with which Father Ellard includes Cardinal Billot among Thomists is so expansive that it would embrace all who, for one point or another, approximate the teaching of the Angelic Doc-tor, whose method, doctrine, and principles are to be held by all teachers as sacred according to the mandate of the Church (Code of Canon Law, canon 1366, § 2). Moreover, the contemporary pro-ponent of the theory qf two modes of the Gifts in this life, one ordi-nary, the other extraordinary, was immediately and unhesitatingly denounced as having mistaken and misquoted St. Thomas by Fathers R. Dalbiez (l~tudes Carm$litaines, April 1933, pp. 250ff.) and P. P~rinelle (Revue des sciences philosophiques et theologiques, No~ember 1932, p. 692), as well as by Father Garrigou-Lagrange (La Vie spirituelle, November 1932, suppl, pp. [ 77 ] if). Such total misinterpretation of St. Thomas cannot be a "form of modern Thomistic theory on the Gifts," as Father Ellard would have it (p. 310), but rather a warning against making St. Thomas a wit-ness to any elaboration prejudicial to his principles. Certain, partly because it is "seamless," Thomistic doctrine preserves its purity and integrity by faithful adherence to the "method, doctrine, and prin-ciples" in the text of St.' Thomas, particularly in the question of the nature of the Gifts. The number of the Gifts is likewise clearly and authoritatively determined in the text of St. Thomas. As always, he is in full accord with the texts of Sacred Scripture which the Church and the best exegetes c~ansider most reliable, as well as the sense of the Church in the hymn Veni, Sancte Spiritus, and the Catechism of the Coun-cil of Trent. St. Augustine is of the same mind (cf. On Christian Doctrine, II, 7), and St. Francis de Sales refers to the "seven Gifts of the Holy Ghost" (The Love of God, XI, 19) in a text otherwise considered probative by Father Ellard (p. 306). To introduce and perhaps induce a doubt in the traditional enumerhtion as taxative or "limitative," Father Ellard cites (p. 309) an author who would amplify the number as by "an infinite variety of shades." This plethora, seven is a "plenitude," the same author affirms is the intention of the sacred authors, "as we know." How we are to know, 84 March, 1950 WORKS OF GOD MADE MANIFEST however, is not indicated. Either a private revelation or some extremely adroit exegesis would be necessary to belie the authority of Doctors of the Church, who, so close to the primary author of Sacred Scripture--the Holy Ghost--have considered the Gifts as numeri-cally determined. Determination by the Doctors on one point may leave still another undetermined with exactly the same cogency and certitude. St. Thomas himself, having given, on the authority of another, a general schema of the functions of the various gifts, found it neces-sary to reconsider one of its aspects. "Who will assure us that the . last is perfect?" Father EIIard quotes (p. 309) a scholar who has studied the point. Who, on the other hand, will be temerarious enough to.insist that the last is imperfect or.less perfec~ than any other proposed? A distinction and argument which, after long thought, had clarity and cogency for St. Thomas has the added note of authority for those who wisely appraise both the change and the conclusion. In making his schema, St. Thomas realized he was establishing an appropriate parallel, an educative device, an argu-. ment of convenience. Neither he nor St. Augustine--nor Father Garrigou-Lagrange--attributes the same probative force to a schema as to a syllogism. Indeed, The Three Ages evidences an admirable conformity to the doctrine of St. Thomas, and his classical commen-tator, John of St. Thomas, in the substance and schema for the functioning of the various Gifts. The final point concerning what Father Ellard chooses rather ungraciously to call "the present-day Thomistic hypothesis" of the Gifts is their association with the doctrine that some graces are intrinsically efficacious. A larger issue is involved here than the .mat-ter of the Gifts and it should not be treated by innuendo. If at this juncture "many people pause," as Father Ellard expects (p. 310), because the common pre-Reformation doctrine on the efficacy of grace and the nature of the Gifts are "indissolubly bound" in doctrinal integrity, will it be to neglect an assured and consistent teaching for one that is hopelessly entangled in affirmations, denials, and com-promises? Those who demur at the doctrine of grace as expounded by St. Thomas cannot fail to deny his teaching on the Gifts. Only a compromise could enable Suarez to affirm the doctrine of St. Thomas on the nature of the Gifts and deny his doctrine on grace. Such compromises are always uncertain, as the doctrinally internecine con-flict among Molinists and Congruists amply testifies. Somewhat as a summary of his consideration of the .Gifts, 85 DOMINIC HUGHES Review [or Religious Father. Ellard implies (p. 311) that because leading Thomists are aware of controversies they themselves are subject to uncertainty. Nothing could be further from the truth, unless that Catholics by their cognizance of heresy diminish their faith. Moreover, because the teaching of The Three Ages is based upon what "the great majority of theologians hold with St.Thomas," a wise judgment would con-cede Father Ellard but poor pleasure in having ferreted out an admission that "'not all [italics his] theologians agree on this par-ticular fundamental point." Upon such minimal evidence and defensive techniques only an artificial uncertainty and imprudent reservation or suspension of judgment can be built. Father Ellard-emphasizes complexity ;ind confusion, Father Garrigou-Lagfange the "certitude of the great directive principles that illuminate all spirituality (cf. p. 311)." In the matter of the Gifts, their neces-sity, nature, number, and fufiction, .not St. Thomas' and Father Garrigou-Lagrange's unassailable doctrine, but Father Ellard's unre-solved doubts lead to "'disillusionment and discouragement" which all are so solicitous to avoid. Another complex question in need of "great directive principles" is that of contemplation. Concerning the exposition of contempla-tion in The Three Ages, Father Ellard seems to find two points of difficulty: the presence of acquired contemplation; the place of the infused. With regard to acquired contemplation, Father Ellard finds reason for criticism in the fact that Father Garrigou-.Lagrange gives it "hardly any place" in his s'ynthesis of the entire interior life,, while the Carmelite Father Gabriel of St. Mary Magdalen devoted "half his work, St. dohn of the Cross" to justifying its place in Carmelite theology. The same Carmelite, however, gives as his wise and orderly conclusion (pp. 199-200) that "the central thesis of the Thomistic spiritual synthesis is supported by the doctrine of actlx;e contemplation." Even if Father Ellard, in the Three Ages, would replace "hardly" with "half" to suit his preferences, the wise ordering of part to whole in both Carmelite and Dominican is obvious. Moreover, "St. Theresa never speaks of any other than infused contemplation.,"~ Father Gabriel states categorically (p. 111), while he and others can find only equivalents of the term in St. John of the Cross. Both the problem of terminology and the point of doc-trine concerning the "beginning of contemplation" (Dark Night, I, 9) and the "acquired prayer of recollection" receive ample and appropriate treatment in the chapter on "Contemplative Prayer" in The Three Ages. More would.make a part into a polemic. 86 March, 1950 WORKS OF GOD MADE MANIFEST If others disagree with Father Garrigou-Lagrange in this matter it should not be surprising. The harmony he has indicated between St. Thomas and St. John of the Cross is well-founded in the best Carmelite and Dominican authorities. If a dissident attitude arises from the outside and even seeps within, the foundations, of accord in the Theresian and Thomistic teachings are not tragically undermined. Without mentioning either the Common or the Mystical Doctor, Father Ellard has assembled a variety of authorities (p. 303) to indicate a confusion on the place of infused contemplation. The teachings of Msgr. Saudreau, Tanquerey, Crisogono, and Naval-- all but the last two differing from one another--are arrayed against that of The Three Ages. No mention is made, however, of which of all in the field more closely conforms to the doctrine of the Doctor of Contemplation, St. John of the Cross. Tanquerey, Crisogono, and Naval are not even close. Msgr. Saudreau confines contempla-tion to the unitive way. With "a great difference indeed" (p. 303) Father Garrigou-Lagrange conforms exactly to the doctrine of St. John by placing infused contemplation in both the unitive way and--to use St. John's own words--"the way of proficients, which is also called the illuminative way, or the way of infused contempla-tion" (Dark Night, I, 14). This explicit testimony of the "highest cause" in matters of contemplation and Father Garrigou-Lagrange's strict conformity to it, leaves but one judgment ~or wisdom-- "greatest certitude" for the doctrine on the place of infused con-templa. tion in The Three Ages. Moreover, when it is a question of the relationship between the Gifts and contemplation, Father Ellard's strictures are utterly con-fused. His use as an argument from omission of inappropriate texts from St. Francis de Sales and St. Alphonsus "who would have advocated for all a form of mental prayer that is full of inspirations from the Holy Spirit" is pitiably feeble. Fantastic, nothing less, is his assertion that "although in their process nothing has been said about infused contemplation," persons have been canonized, and hence "we can safely conclude" from no mention, let alone non-manifestation, to the non-existence of interior intellectual movements of the Holy Ghost in their souls. Father Garrigou-Lagrange clearly indicates (I, 81) saints and situations in which the activity of the intellectual Gifts are "diffuse." In them the practical Gifts of coun-sel, fortitude, or fear are more apparent, yet all the gifts will be "highly developed" and wisdom will [egulate all. Since the highest of mystical experiences is within the scope of a moral consideration, 87 DOMINIC HUGHES Ret~ieto for Religious judgments must be wisely formed" of them "as they most often hap-pen." Exceptions corroborate, not corrupt, certitude in morals, "for the man educated to expect them." Neither the fact that "various exceptions" are admitted to the doctrine of the predominance of infused contemplation, nor its "being so closely associated with a questionable theory of the gifts (p. 312)" is ground for asserting that the Theresian-Thomistic position in the Three Ages "suffers" a loss of certitude. Only those who are con-stantly looking for some "phenomenon in consciousness" which is "humanly noticeable" (p. 31'~) complain of dangers of disillusion-ment because the truth of mystical experience did not fit into their preconceived patterns. From the doctrines on the Gifts and contemplation flows the final point of difficulty: the normality of infused contemplation or the unity of the interior life. To Father Ellard's wonderment, The Three Ages "embodies no great new discovery nor corrects any old error" (p. 311). His observation is remarkably exact. The discovery is old, the error is new. Until the seventeenth century no one lost sight of the unity of the interior life and no arbitrary and artificial cleavage between ascetical and mystical theology was introduced. With the publica-tion of Scaramelli's Ascetical Directory an.d Mystical Director~l, how-ever the division and its tragic consequences were popularized. Since things ascetical were conceived as ordinary and the mystical, i.e., infused contemplation, as extraordinary, humility became the motive for the humdrum, and many souls apt for contemplation were forced to excruciating torments on the treadmill of discursive meditation. This new error bade fair to destroy an old discovery. To Father Garrigou-Lagtange is due sincere tribute as one of the vanguard leading souls to an appreciation of the traditional teaching on the unity of the interior life, its contemplative graces and gifts. Those only need fear disillusionment or discouragement in his leadership whose limited ideals or faint heart stultify their wisdom. WISDOM AT WORK: METHOD Wisdom governs not only the principles of the interior life but their presentation. In The Three Ages, Father EIlatd finds its doc-trinal stress and seeming omissions particularly distressing. Father Garrigou-Lagrange's stress upon the Gifts of the Holy Ghost is indeed a strain for Father Ellard. For him, "The whole vast construction presented in these two large volumes stands or fails with the special doctrine on the Gifts of the Holy Spirit which 88 March, 1950 WORKS OF GOD MADE MANIFEST forms as it were the supporting framework for it" (p. 305). Yet Father Ellard himself declared (p. 297) that "degrees of virtues, the functions of the Gifts of the Holy Ghost, various purifications, arid the grades of prayer are assigned to each of the three ages." Perhaps the mere presence of the Gifts gives them too much prominence for Father Ellard. On~ of his authorities (p. 313), and a confrere, Father Poulain, apparently not a theologian, however proficient a psychologist, in his extensive work, The Graces of Interior Prayer, somehow manages to avoid any treatment of the Gifts. To anyone acquainted with their importance in traditional spiritual writers, the exposition of The Three Ages will seem the mere summary it was intended to be (I, 66). On the other hand, the omissi~)ns Father Ellard finds so lamen-table are more nominal than real. If the part;.cular examination deals with the predominant fault, a chapter on that subject should satisfy Father Ellard's justification of it as "one of the major tech-nique. s in modern Catholic asceticism." When "for the general examination no precise method is suggested," it need not be a strange omission.Once the "Sins to be Avoided" are mentioned, as Father Garrigou-Lagrange does in a chapter by that name (I, 299), the remainder is left to the individual conscience', even in the Spiritual Exercises, since of its five acts in this matter two are a preface, two an epilogue of prayers. Again in the case of mental prayer, concrete details appeal to Father Ellard as the source of certitude. As a mat-ter of fact, the opposite is true. The more particularized is the treat-ment, the more it is subject to doubt. The devious details of these devices for praying, whose security for some is largely in their famili-arity, are better consciously omitted by anyone who writes with the "certitude of the great directive principles of all spirituality" (cf. p. 311). The method of The Three Ages, moreover, cannot rather "stress theory than practice" (p. 302) if its principal excellence is "its inspiratio:lal value," and if "a reader feels his heart warmed and his enthusiasm enkindled" (p. 301). It can scarcely be labeled as more given to "metaphysics than psychology" (p. 302) when the author keeps reminding his readers of the grand dogmas of Christianity, their "infinite elevation," their implications for our "affective and practical lives" (p. 301). WORDS AT WORK FOR THE WISE For the wise, who are so either by industry in theology or by 89 DOMINIC HUGHES infusion .with God's love, a word of conclusion is sufficient. A wise word may not have rhetorical flair, but it cannot be faltering or fal-lacious. As an expression of the judgment of the "highest causes" with the "greatest certitude" and other things in an orderly manner, it is not an assembly of facts, but an appraisal of values. The relative values of both content and method between what Father Garrigou-Lagrange and Father Ellard offer for its appraisal leave wisdom no doubt whatever. In points of doctrine Father Ellard seems to be without the solid foundation of a man whos~ theological industry has made him wise. Despite his erudition-- sometimes amid the most trivial sources-~-his analysis lacks pro-fundity. Its practicality, too, since it fails in its calculated effect, is open to question. In the face" of an artificially imposed order, Father Ellard's thoughts ramble and lose themselves in details. When his conclusions are declarative, they waver over a "whatever" (p. 314) or a "whether or not" (p. 316), and when they are an interrogative they are most uncertain. His precision in labelling the doctrines of others he suddenly loses when he lets "Catholic" and "Church" slip into sentences containing ideas he favors (p. 302). All of this gives his article the appearance of a somewhat gauche polemic rather than of a sincere and solicitous appraisal. On the other hand, the mag-nificent proportions of The Three Ages are not often met with in contemporary spiritual writing. Because it presents so well the "great dogmas of Christianity" as well as "their implications for our affective and practical lives," each reader feels his "heart warmed and his enthusiasm enkindled for these great truths" (p. 301). Wisdom's final word concerning the providential purpose of this and other discordant notes in the harmony of the teachings in the Church on the interior life is after the Model of Wisdom Him-self. When the Apostles saw the man born blind, they balanced-- unknowingl~, perhaps--one rabbinical opinion against another: "this man or his parents?" They were forced to suspend judgment, because seeing only alternatives and not an order to a Highest Cause, they remained uncertain. When they appealed to Christ, He gave them an answer many rabbis would not have considered scientific or satisfying "in terms of human experience."" Yet it was sublime and secure. Wisdom Himself replied to the Apostles, and reassures all in the present instance: supernatural security and salvation are accom-plished through suffering and the triumph of wisdom--"because the works of God were to be made manifest . " (John 9:3). 90 March, 1950 FATHER ELLARD'S REPLY FATHER ELLARD'S REPLY In his inspiring introductory remarks on wisdom Father Hughes proposes a restricted, relative, and special sense of "certain." " If'we accept that, th~n really there hardly seems to be any necessity of my saying more. He' has virtually conceded the great cardinal point of my whole criticism, namely, that Father Garrigou-Lagrange's doc-trine on the gifts and the corresponding thesis on infused ~ontempla-tion insofar.as this depends on that doctrine, are not, in the plain and ordinary sense of the term, certain. Certaint~ , in this sense, espe-cially when predicated of a doctrine that is theological and specu-lative, is opposed not only to probability, bfit even to greater prob-ablity. Similarly, if the langu.age of The Three Ages is to be under-stood as expressing doctrine t~at is certain only in a limited and relative sense, I. was deceived, and my labor was in vain. Perhaps also some other readers will be misled too. It seems sufficient, therefore, to notice 'very briefly only what in Father Hughes's reply is most relevant to my four principal criti-cisms, and not to say more about certain matters in which he' has mistaken my meaning. Nor shall I advert further to several expres-. sions suggestive of what I would disclaim. Those four contentions were: "'The Three Ages is theoretical rather 'than practical; it is one-sided and narrow; an essential part of it, namely, its doctrine of the gifts of the Holy Spirit, is uncertain; and its main thesis is not after all really so significant" (p. 302). I shall follow the order in which Father Hughes deals with them. First, the gifts. As a simple and practical way of ending this ¯ particular argument, I will give to Father Hughes, if he wishes, a list of all the leading theologians of the twentieth century with their works and the appropriate references to what they teach on the giftsl Then he can see at once in black and white whether Catholic theo-logians agree in proposing as certain, in the usual sense, any such elaborate theory of them as that in The Three Ages. These theo-logians will embody, in varying degrees and ways of course, the present mind of the Church; they will be quite conversant with the altogether unique authority of St. Thomas, and they will be aware also of whatever else is pertinent. In [hem, considered adequately and properly, not merely arithmetically, will be found accumulated Catholic theological wisdom in its most mature and authoritative form. When the theologians, who are the most competent to judge in a question of this kind, are as greatly divided and as uncertain as 91 FATHER ELLARD'8 REPLY Review for Religious they actually are, on what evidence could particular persons come to certain knowledge in the matter? Possibly they can; but indeed it seems most unlikely. When the authorities disagree or "are not posi-tive, it would seem wise for individual persons to suspend judgment. If, as Father Hughes seems to agree, the two Thomistic doctrines on the efficacy of grace and the nature of the gifts stand or fall together, then most emphatically are theologians divided. As for the Doctors' of the. Church, the Augustinians claimed St. Augustine for their view on grace; and both Dominicans and Jesuits appealed to St. Augustine and St. Thomas. "Among the more modern Doctors, St. Alphonsus de' Liguori is cited for a modified version of the Augustinian theory; and St. Robert Bellarmine for the Jesuits. According to Von Pastor, St. Francis de Sales declared, in a memo-randum written for Pope Paul V, "that on the whole he shared the view of the Jesuits; and he added that he had made an exhaustive study of the subject, and that he saw considerable difficulties in either opinion, He did not think the time had come for deciding a question on which so many able scholars were unable to agree." (History oF the Popes, XXV, 240.) These facts concerning the controversy on grace are given, not with any intention of arguing such a matter in these pages, but simply to show that, if Father Garrigou-Lagrange's teaching on the gifts is logically involved in this highly disputed sub-ject, surely it cannot be called certain. Father Hughes writes: "Many Dominican theologians are cited as recognizing a controversy upon the matter [of the gifts], but the conclusions of each do not seem worthyof mention by Father Ellard" (p. 82). In the writings referred to I have not noticed any con-clusions contradictory either to the statements quoted from them or to the proposition in substantiation of which the citations were made. If Father Hughes should point out any such conclusion, I shall be glad to acknowledge it. Of course the same five theologians can be quoted in favor of the Thomistic theory of the gifts, and two of them for the certainty of it, for example, Gardeil in th~ Dictionnaire de Theolo~Tie, IV-2, 1776, 1777, and Garrigou-Lagrange himself, in PerFection Chretienne et Contemplation, II, [88-91]; neverthe-less, they witness the fact of disagreement among theologians and admit that others do not share their own view. Secondly, I said of The Three Aoes that it is one-sided and nar-row. Father Hughes replies that it is in accord, if not with lesser lights, at least with St. John of the Cross, the great and ultimate 92 March, 1950 FATHER ELLARD'S REPLY (relative) norm in this matter. But the same agreement is claimed by other authors also, among them tw6 Carmelite spokesmen. In other words, there is more than one interpretation of St. John among orthodox Catholics. ."But Father Garrigou-Lagrange has the right one." Perhaps he has; but we might be better, convinced if he would give us a chance to judge for ourselves. Could he not at least give us fair notice of dissenting opinions?. A fresh sample of div.ergenc~ is furnished by Father Gabriel of St. Mar.y Magdalen in his new book, St. Teresa o~: desus. Although he writes, "'For all that, it can be shown in fact that this teaching of the Teresian school is not irreconcilable with the modern Thomist synthesis of the spiritual life" (p. 44), yet repeatedly throughout - the book he contradicts Father Garrigou-Lagrange on the necessity of infused contemplation. The first point in my criticism reads: "'Tile Three Ages is theo-retical rather than practical." Of all, this was the least important, especially as instruction and inspiration are also in their own way most practical. Father Hughes objects: "The method of The Three Ages cannot rather 'stress theory than practice' if its principal excel-lence is 'its inspirational value,' and if 'a reader feels his heart warmed and his enthusiasm enkindled.' " Why not? In this respect the work resembles treatises on dogmatic theology which are preoccu-pied with doctrine rather than practice and which can at least be bigh.~y inspiring. Again my critic writes: The book "can scarcely be labeled as more given to 'metaphysics than psychology' when the author keeps reminding his readers of the grand" dogmas of Christianity, their 'infinite elevation,' their implications for our 'affective and practical lives.' " The answer is. simple. When a book contains dogmatic, metaphysical, and psychological elements, why cannot it accentuate them in just that order? As a matter of fact, The Three Ages does. I cannot imagine how Father Hughes can say: "In the case of mental prayer, concrete details appeal to Father Ellard as the source of certitude." My final contention was that the main thesis of The Three A~Tes, namely, that infused contemplation comes within the normal devel-opment of the interior life, is not after all very significant. It would be pregnant with meaning and significance if according to the mind of its author it were intended to im'ply that mystical contemplation in the full and obvious sense as described by St. Teresa in The 93 FATHER ELLARD'S REPLY Review/or Religious Interior Castle is normally to be expected. St. Teresa's terminology is used and one anticipates sbmething very wonderful. But then one finds out that only "what is essential" is promised us, and that seems much less indeed. Such language is surely apt to deceive the less wary. On this point, the climax of everything, Father Hughes has sur-prisingly little. I was careful not to deny the thesis of the nor-mality of mystical contemplation, or the unity of the interior life, or even to call them in question, except insofar as the thesis is pre-sented as a corollary from the theory of the gifts. Of course I am not suggesting that the tiniest bit of infused con-templation is not a most precious grace. It is, by all means. Rather, the question is whether the mysticism which Father Garrigou- Lagra~nge holds out in prospect for us is the same as the substantive sublime graces depicted in St. Teresa's Mansions and in St. 3ohn's Spiritual Canticle and The Living Flame. It seems highly fitting that I should add a word on two personal references that some readers will resent. I used a quotation in which Scotus was called '~the Subtle Doctor." There appears to be no reason for the depreciatory language which my critic uses. Scotus was one of the most influential of all Scholastic philosophers and theologians; for centuries innumerable times he has been referred to as "the Subtle Doctor" in more or less the same way that St. Thomas is termed "the Angelic Doctor." There was no suggestion at all that he is a Doctor of the Church; yet he is great enough to have been the theologian to whom above all others under the providence of God the Church owes the dogma of the Immaculate Conception. Likewise it seems inexplicable that Poulain, the author of The Graces of Interior Prayer, A Treatise on Mystical Theology, should be referred to with these words: "apparently not a theologian, how-ever proficient a psychologist" (p. 89). True, Poulain was not a dogmatic theologian, and his design in writing on mystical the-ology was different from that of Father Garrigou-Lagrange, but his work is in certain respects, especially for an account of the facts of mysticism and for practical help in direction, of first-class worth and thus far unsurpassed. To conclude: if I am right in taking Father Hughes to mean that the doctrine of the gifts is to be considered certain only in a relative and limited sense, and not with the obvious and proper force of that term, then on the'chief point we are in agreement. If not, I would 94 March, 19 5 0 COMMUNICATIONS say to readers who have followed this criticism 'and countercriticism, especially if they have actually read The Three Ages, andpr.eferably against the background of Saints Teresa and 3ohn of the Cross: "I speak to men of reflection; judge for yourselves of what I say" (I Cor. 10:lS).--G. AUGUSTINE ELLARD, S.J. ommun{caldons Reverend Fathers: A few years ago in an issue of Emmanuel the reviewer of one of the books of Father Garrigou-Lagrange expressed his doubt of the truth of the characteristic doctrines of that eminent theologian, at the same time stating his hope that a more thorough criticism would be made in a lengthier review. That same doubt and hope have been felt by many who read Christian Perfection and Contemplation and The Three Ages of the Interior Life. In those works the views of the author on some points of dogmatic and of mystical theology were stated in such a way that the reader if not versed in these matters would conclude that these particular views are not seriously disputed by competent Catholic theologians. But they are disputed, and to bring out this fact, as Father Ellard has done in his review of The Three Ages of the Interior Life in your November, 1949, issue, is to render a real service to the reader of these valuable spiritual books. The truth that some of Father (3arrigou-Lagrange's theories are disputed, and are not part of Cath-olic doctrine nor the unanimous opinions of theologians will not hurt anyone. Veritas vos liberabit. In emphasizing the disputed character of .these opinions of the gifted.writer, it is not intended in any way, I am sure, to imply that he has deliberately misled his readers. But Father Garrigou-Lagrange has led the majo.r portion of his life in the midst of skilled theo-logians. He naturally and unconsciously keeps them in mind as he writes. Yet what he writes is being read by many who are n~;t versed in even the fundamentals of theology and who consequently may easily be misle.d by his statement, of his positions. For the general public a clearer statement of what is general Catholic doctrine and what. is not, is certainly desirable. May I add a personal note? After some experience in directing 95 SUMMER SESSIONS ReVietO [or Religi,,os souls who have undoubtedly received the gift of infused contempla-tion, I find it difficult.to believe that Father Garrigou-Lagrange has any real concept, of infused contemplation at all. Everything he writes leads me to believe that he is really thinking and speaking of that prayer which is variously called "acquired contemplation," "the prayer of ~implicity," etc. There is an essential distinction between this simplification of discursive prayer and infused contemplation; and that distinction, I believe, cannot be understood merely from ¯ reading the works of mystical writers or theologians. I thoroughly agree with the Benedictine' who said 'that "the conception that St. John of the Cross had of mysticism and contemplation entirely escaped" the gifted author of Tile Three Ages. No harm can come from giving testimony to the inexactitude of Father Garrigou-Lagrange's distinction between Catholic doctrine and the theories of certain theologians; nor to the incorrectness of his understanding of the fundamental nature of infused contempla-tion.-- A SECULAR PRIEST. [EDITORS' NOTE: Further communications concerning Father Ellard's appraisal.of The Three Ages will be acgepted. These communications should be kept as brief as the subject-matter permits. If at all possible, they should be neatly typed, double-spaced, with generous margin. The sender should sign his name; and the name will be printed unless the content is of a personal nature.] SUMMER SESSION The Plus X School of Liturgical Music, founded by the late Mother Georgia Stevens, will conduct its Thirty-Fourth Summer Session: June 29-Augtist 10. Registration is open to men and women, whether as students matriculated for the B.A. or B.Mus., degrees, or as non-matriculated students; resident and non-resident. Courses will be offered in Gregorian Chant, Gregorian Accompaniment, Con-ducting, Polyphony, Liturgical Singing, Vocal Production, History of Music, Keyboard Harmony,. Music Education, Counterpoint, .etc. Members of the Staff have been long trained in the traditions of Solesmes and have national and international pedagogical experience and recognition. Private lessons in organ, piano, and singing may be procured. Membership is held by the School in the National Association of Schools of Music and it enjoys the official approval of the most eminent music organizations. According to a long-established custom there will be lectures by prominent musicologists and the usual s, eries of weekly concerts. Students will be given the opportunity of~active particip.ation in the Liturgy by the congrega- 96 March, 1950 BOOK REVIEWS tional singing of Holy Mass, Vespers, Compline, and Benediction. The Very Reverend Monsignor Frederic Teller, D.D., Ph.D.,C.G.M. will teach some courses. The Ve.ry Reverend Monsignor Martin B. Hellriegel, of the Church of the Holy Cross, St. Louis, Mo., and the Reverend 3ohn 3. Dougherty, S.T.L.,S.S.D. of the Immaculate Con-ception Seminary, D~rlington, N. 3, will give daily lectures on the Liturgy throughout the Session. For further information write to: Mother Aileen Cohalan, Director, Manhattanville College of the Sacred Heart, New York 27, New York. Book Reviews THE MOTHER OF THE SAVIOR AND OUR INTERIOR LIFE. By Reginald Garrigou-Lagrange, O.P. Translated by Bernard J. Kelly, C.S.Sp. Pp. 338. B. Herder Book C;o., St. Lou~s, M~ssourL $4.00. The theological and d~votional literature about the Blessed Virgin is so extensive that .a new synthesis by a capable author is highly welcome: Father Garrigou-Eagrange published such a syn-thesis in 1941 (reprinted in 1948). The present translation from thd French makes his book available for the la.rge number of readers who have come to value his works in English versions. The book is divided into two parts. The first part, on "The Divine Maternity and the Plenitude of Grace," is doctrinal. It aims at imparting knowledge about Our Lady and her unique position, in subordination to her divine Son, at the very summit of creation and the supernatural order. The pre-eminence of the divine mater-nity, which dominates all Mariology as the source and end of all Mary's great gifts, is very clearly brought out. Here and there a line of reasoning is pursued that is not very convincing: but strictly theo-logical procedures are hardly to be expected in a work that is more devotional in spirit than scientific. The second part, on "Mary, Mother of all Men: Her Universal Mediation and our Interior Life," demonstrates Mary's activity in the plan of redemption and the important causality she exercises in our salvation and sanctification. In view of the character of the volume, the author has wisely refrained from entering into the contemporary debate among theo-logians on the precise meaning and function of Mary as co-redemp- 97 BOOK R~VlEWS Review [or Religious trix, contenting himself with general expressions that should prove acceptable to all parties in the controversy. The main source for the theological presentation is Merkelbach's well-known Mariologia. But the Fathers, the great Scholastics and their later successors, spiritual writers, orators, and Popes are called upon to yield up their treasures. Many gems have been contributed by Saints Ambrose, Sophronius, Andrew of Crete, Ephrem, and Peter Damien. Saints Bernard, Albert the Great, Bonaventure, Thomas Aquinas, Alphonsus, Grignon de Montfort, and Francis de Sales have all offered their riches. Suarez, Terrien, Dublanchy, le Bachelet, and Hugon have generously thrown open their books. And these great names represent but a sampling of the numerous sources consulted and utilized. The encyclicals of Popes Leo XIII, Pius X, Benedict XV, and Plus XI manifest the mind of the Church on recent Mariological doctrine. The Polish Dominican, Justin of Mi~chow, provides the inspiration for one of the finest chapters in the book, "Special Aspects of Mary's Queenship." The article on the Rosary sheds fresh light on that welt-loved devotion, and sug-gests a way of practicing it that will be profitable to all Catholics. The translator has done his part admirably. Comparison with the French edition shows how faithful Father Kelly has been to the orig!nal. If we did not know that the English edition is a transla-tion, we could hardly guess that fact from reading the book. And that is the supreme criterion of the translator's success. CYRIL VOLLERT, S.J. IGNATIAN METHODS OF PRAYER. By Alexandre Brou, S.J. Translated by William J. Young, S.J. Pp. xl ~ 203. The Bruce Publishing Com-pany, Milwaukee, Wisconsin, 1949. $3.00. The aim of this book is very clearly stated by the author when he tells us that he set out to discover "what exactly did St. Ignatius want to say, and what did he say" on the subject of prayer. The word "discover" is used purposely, for the many commentators on St. Ignatius have not always clarified his thought nor passed it on unadulterated to their readers. Father Brou observes: "Now it some-times happens that with'the best intentions in the World his thought has been misunderstood. Authors . . . have viewed the teachings of the Saint through a mist of commentary, and a commentator never fails to add something to his text" (p. vii). Father Brou gdes back to sdurces, the text of the Spiritual Exer-cises, and he interprets them in the light of Stl Ignatius' personal March, 1950 BOOK REVIEWS letters, supplementing his findings with. the writings of intimate con-temporaries of the Saint--St. Francis Xavier, Blessed Peter Faber, Father Nadal--to mention but three. The work is divided into four main divisions. In the first St. Ignatius' teaching on prayer and the interior life, the ,relation of prayer to the apostolate, seeking God in all things, the presence of God, and finally mystical prayer are treated. The second and third parts are devoted to the preparations for prayer and the so-called methods of prayer respectively, while the fourth part treats the coun-sels for the time during and after prayer, and tl~e rules for the dis-cernment of spirits. Two features of the teachin'g of.St. Ignatius as presented in this book are noteworthy. First is the continuity ot: practically every portion of the Ignatian teaching with a tradition of Catholic spirit-uality which he both inherited and developed into the forms found in the Exercises. The other is what we might call the compatibility of high prayer with the active life of the apostolate. Great mystic ¯ that he was, SI~. Ignatius was eminently a man of the active aposto-late, what we would call nowadays a man of affairs. He conceived the man of affairs as a man of prayer, and a life of prayer as not at all incompatible with a full daily schedule. "To St. Francis Borgia he asserts that it is more perfect to be able to find God everywhere and in all things than to have need of an oratory and long prayers to enter into union with Him" (p. 39). The book combines the excellent qualities of thoroughness and brevity. It can be r~ad and reread with profit.--T. L. McNAIR, S.J. LITTLE CATECHISM OF PRAYER. By Father Gabr;el of St. Mary Mag-dalen, O.C.D. Transla÷ed by ÷he Discalced Carmelite Nuns. Pp. 44. Monastery of Discalced Carmelites, Concord, New Hampshire, 1949. $.2S (paper). People in general who cultivate mental prayer and v.ery particu-larly all those who would like to practice it in the spirit and after the manner of the Carmelites, traditional leaders in matters of the contemplative life, will welcome this Little Catechism. In six chap-ters and eighty-nine questions it introduces one to "prayer in the contemplative life," "the methbd of mental prayer," "preparation and reading," "meditation and colloquy," "difficulties in prayer," and "the presence of God." There is nothing theoretical or learned or meticulously precise about it. Evidently it is meant, as its title suggests, to be a simple and practical primer. On the other hand 99 BOOK NOTICES Review for Religious there "are thoughts in it which would be helpful and inspiring, I should say, to almost anyone, even tb contemplatives far advanced in the ways of prayer and sanctity. For instance, from the very first page one might learn this distinction between the Christian life and the contemplative life: the good Christian "lives /:or God," whereas the contemplative soul "lives not only for God, but also with God." Likewise it is emphasized at the very beginning in a quotation from St. Teresa that to reach the higher degrees of prayer one must per-force add the practice of mortification, "because prayer and comfort do not go together."--G. AUGUSTINE ELLARD, S.,J. BOOK NOTICES BLESSED MARIA GORETTI: Martyr for Purity, by 3ohn Cart, C.SS.R., is an admirable life of the twentieth-century martyr whom the Holy Father intends to canonize in the course of the present holy year. Blessed Maria sets an ideal before modern youth who live in an atmosphere so perilous to purity. (Dublin: Clonmore ~ Reynolds, Ltd., 1949. Pp. 70. 3/6.) Father Louis I. Fanfani, O.P., an outstanding modern canonist, has published a third edition of DE IURE RELIGIOSORUM. While keeping all the good qualities of previous editions, the book has been brought up to date and considerably increased in volume. A separate chapter is devoted to the newly established Secular Institutes. Four important documents are added by way of appendices: I. The new Norrnae of 1921; II. Letter of the Sacred Congregation of. Religious of 1931 on the formation and training of religi6us for sacred orders; III. Instruction on the enclosure of nuns with solemn vows issued in 1924; and, IV. The Statutes for Extert~ Sisters of monasteries of nuns, approved by Pope Pius XI in 1929 an'd published by the Sacred Congregation of Religious two years later. These documents are given in the original Latin text. (Rovigo, Italy: .Istituto Padano di Arti Grafiche, 1949. Pp. xxxi + 810. L. 2000.) OUR ETERNAL VOCATION, written anonymously by a Carmelite nun in England, is intended for all, priests, religious, or laity, who are interested in attaining higher sanctity. Of its three main sections, the first treats of sanctity in gener.al, its meaning, its instruments, its fruits (pp. 9-135). The second is concerned with religious voca-tion in particular (pp. 135-177). The last tells about the sanctity and mission of St. Therese of Lisieux (pp. 177-207). The doctrine seems to be solid throughout and Jr'is presented palatably by a crisp style tinged With feeling and garnished with 100 March, 195 0 BOOK ANNOUNCEMENTS striking illustrations. The book contains some shrewd psychology on the value of sincerity in attaining holiness, on methods of over-coming mental depression, on the natural requisites for a religious vocation. As might be expected, the author emphasizes the "Iittle way" of St. Therese, but she does not derogate from other methods of acquiring sanctity. (Westminster, Maryland: The Newman Press, 1949. Pp. 207, $2.25.) BOOK ANNOUNCEMENTS [These notices are purely descriptive, based on a cursory examination of the books listed. Some of the books will be reviewed or will be given longer notices later. The list is complete up to Feb. 10.] CARMELITE THIRD'ORDER PRESS, 6427 Woodlawn Avenue, Chi-. cago 37. Take This Scapulart. By Carmelite Fathers and Tertiaries. Pp. 270. $2.50. Unfolds the story of Our Lady's Scapular. FRANCISCAN HERALD PRESS, 1434 W. 51st Street, Chicago. Tertiar~ Office of the Parers. Pp. 103. $.50 (30% discount for orders of 25 or more). A vest-pocket booklet of aids in reciting the office prepared especially for members of the Third Order of St. Francis. Also contains the Seraphic Office, the Office of the Pas-sion, and the Franciscan Tertiary Office with reflections. M. H. GILL ~ SON, Ltd., 50 Upper O'Connell Street, Dublin. Fair as the Moon. By Father M. Oliver, O.Cist.R. Pp. xi -b 235. 12s. 6d. A portrait of Mary, the Mother of God and "Purest of Creatures." Catherine McAule~I: The First Sister of Mercy. Pp. x ÷ 434. 15/-. "This book, the fruit of considerable research, is based largely on hitherto unpublished document's, and throws fresh light on Cath-erine McAuley's life and work." [5. HERDER BOOK COMPANY, St. Louis 2, Missouri. Ps~/cbiatq/and Asceticism. By Felix D. Duffey, C.S.C. Pp. 132. $2.00. True Stories for First Communicants. Pp. 80. $1.25. First Communion Davis. Pp. 96. $1.25. Both by a Sister of Notre Dame. True stories which should help children in preparing for their first Communion and after. The books were first printed in 1919 and 1920 respectively. The Life of Our Lord Jesus Christ. Two volumes. By Maurice 101 BOOK ANNOUNCEMENTS for Religiou* Meschler, S.J. Pp. xxii q-- 545 arid viii -b 551. $12.00 (set). Translated by Sister Mary Margaret, O.S.B. This is the fifth edi-tion of the author's well-known meditations on the life of Christ. LEMOYNE COLLEGE PRESS, LeMoyne Heights, Syracuse 3, New York. Inigo de Logola. By Pedro Leturia, S.J. Pp. xiii + 209. $4.50. The story of the early life of St. Ignatius up to and including his conversion. LIBRERIA FRANCESCO FERRARI, Via dei Cestari, 2, Kome, Italy. Manuale Tbeorico-Practicurn Tbeologiae Moralis ad Mentern D. Thomae. By Father Louis J. Fanfani, O.P. Pp. xix + 648. This is the first of a set of three volumes. It treats of man's last end, human acts, laws, conscience, the virtues, sins, and censures. It is planned to complete the set within the course of the year. LITURGICAL PRESS, St. John's Abbey, Collegeville, Minnesota. Life. and Miracles of St. Benedict. By Pope St. Gregory the Great. Translated by Odo J. Zimmermann, O.S.B., and Benedict R.Avery, O.S.B. Pp. xv q- 87. $2.00 (cloth); $.90 (paper). A translation of Book Two of the Dialogues of St. GregorY. MCLAUGHLIN ~ REILLY, 45 Franklin Street, Boston 10. When the People Sang. By Marie Pierik. Pp. 32. $.50 (paper). "A simple treatise on the Gregorian Chant, its history and use." NEWMAN PRESS, Westminster, Maryland. Treatise on Prager and Meditation. By St. Peter of Alcantara. Translated by Dominic Devas, O.F.M. Pp. xx ÷ 211. $2.50. Besides this classic treatise on prayer, the book contains an introdtic-tion and sketch of the saint's life and a complete English version of Pax Anirnae, a treatise formerly attributed to the saint. The Spiritual Life of the Priest. By M. Eugene Boylan, O.C.R. Pp. 161. $2.50. A reprint of a series of articles which first appeared in the pages of The Priest. The Holg Year of Jubilee. By Herbert Thurston, S.J. Pp. xxiv -[- 420. $4.25. An account of the history and ceremonial of the Roman jubilee. Contains many illustrations. First printed in 1900. The Wag of Divine Love. Pp. xxxvii q- 532. $4.25. A com-plete account of the revelations of the Sacred Heart as made to Sister Josefa Menendez, Coadjutrix Sister of the Society of the Sacred Heart of Jesus. There is also a short biography of the Sister and an analytical index. 102 March, 1950 BOOK ANNOUNCEMENTS Purgatorg and the Means to AvoidIt. By Martin Jugie, A.A. Pp. 203. $3.25. A doctrinal and devotional treatment of a subject that is of interest to all. The book is translated from the seventh French edition by Malachy Gerard Carroll. The Life and Revelations of Saint Gertrude: Virgin and Abbess, of the Order of St. Benedict. Pp. xlv + 570. $4.00. A reprinting of an old favorite which first appeared some eighty years ago. Prager for All Times. By Pierre Charles, S.J. Translated by Maud Monahan. Foreword by C. C. Martindale, S.J. Pp. 328. $3,50. A book on prayer designed "to mak~ smooth the ways of the spirit and to unfold the eternal message of the nearness of God." Little Catechism of the Act of Oblation of St. Th~r~se of the Child Jesus. By the Carmelites of Lisieux. Translated by Rev. Mi-chael Collins, A.M. Pp. 22. $.25. PROVINCE OF ST. JOSEPH OF THE CAPUCHIN ORDER, 1740 Mt. EI-liott Avenue, Detroit, Michigan. Meditations: Volume I: Advent to Ash Wednesday. By Bernar-dine Goebel, O.F.M.Cap. Translated from the German by Berch- "mans Bittle, O.F.M.Cap. Pp. 537. $3.50 (paper). ST. CATHARINE JUNIOR COLLEGE LIBRARY, St. Catharine, Ken-tucky. The Catholic Booklist 1950. Edited by Sister SteIla Marls, O.P., for the Catholic Library Association. Pp. 74. $.65 (paper). "An annotated bibliography, for the most part Catholic in authorship or subject matter, chosen as a guide to the recreational and instructional reading of Catholics." UNIVERSITY OF NOTRE DAME PRESS, Notre Dame, Indiana. The Christfan Vfrtues. By Charles E. Sheedy, C.S.C. Pp. xi q- 361. $3.00. A book on moral theology for college students and lay readers. God and the World of Man. By Theodore M. Hesburgh, C.S.C. Pp. viii -}- 318. $3.00. A theological text for the layman. Treat-ises on faith, God, the Trinity, creation, the elevation and fall of .man, the end of the world and man. JOSEPH F. WAGNER, INC., 53 Park Place, New York 7. --Must It be Communism? By Augustine J. Osgniach, O.S.B. Pp. x -]- 486. A philosophical inquiry into the major issues of today. The last three chapters are by Jerome L. Toner, O.S.B. 103 .uestdons and Answers We have an application from a woman who has obtained a permanent separation from her husband and now wishes to try out the religious llfe. Creusen, ReBgious Men and H/omen ~n the Code, p. 135, states: "A wife abandoned by her husband., does not need his consent to enter, rell-gion. One may see in R.C.R., 1939, under what conditions her entry into religion may be obtained." Please tell us what R.C.R. stands for, and, if convenient, give us a summary of the conditions referred to. R.C.R. refers to a review for religious published in Belgium by Father Creusen and his associates under the title Reoue des Commun-autos Religieuses (53 rue Royale, Brussels, Belgium). Here is a sum-mary of what Father Creusen wrote in the answer referred to. (1) The aspirant must not have been in any way the gravely culpable cause of the separation. (2) There must be moral certitude that she cannot be forced legally to abandon the religious life in order to resume married life. A civil divorce is the best guarantee. (For this the bishop's permission should be obtained.) (3) If the appli-cant has children, their care and support will have to be guar~inteed. (4) The superior of an institute or monastery who is willing to accept her on trial must be convinced that she has an extraordinary vocation and that there are particular reasons to anticipate her perse-verance. If all these conditions are fulfilled, the person in question may appeal to the Holy See for the necessary dispensation. She should do so personally. To this personal appeal a letter of recommenda-tion from her bishop should be added. This recommendation should be given at least regarding the good character of the person, even though the bishop does not wish to support her application for the dispensation. Finally, a letter from the religious superior who is willing to accept the candidate, stating that she believes the applicant to have an extraordinary vocation and that the community is willing to receive her on trial, will complete the official documents required. A baptismal certificate of the applicant and a copy of the decree of civil divorce ~hould be sent along with the other documents. Father Creusen concludes his answer with the following para-graph: "It must be added that the Holy See shows itself very prudent and very reserved in granting this dispensation. The utmost good will in the beginning is far, it seems, from guaranteeing perseverance 104 QuEs-r~o~s ~no ANswrRs in vocations of this kind. It is useless to encourage the application without exceptional reasons." Canon law cjrants to superiors the rlgttf #o extend: (I) the posfulancy, but not beyond six months (canon 539, § 2); (2) the time of the novif~ofe, but not beyond six months {canon 571, § 2); (3~ the period of temporary vows, but

Issue 5.5 of the Review for Religious, 1946. ; Revxew for Religxous ,, SEPTEMBER ~,15, 1!94 Qualities of' ~ Moral Guide . . . . , 6~,ald Kelly New Vitality for the Exame.n . '. . Richard t: Rooney. How is Your:Fai÷h? . ~ . . ,. Patrick I~1~ Regan ,On Readin9 af Table ' Claude Ke~n !Preparincj Lay Apostles . ~' / . JohnA. Herdon 0u Lr da ys o'sRary ¯ ¯ ¯ ¯ ~ , . Adam¯~ C. EII;s ,~ " ~_~., ¯ Ques÷i0~s Answered Books Reviewed ,Vo~u~E:y NUMBER REVIEW FOR R L GIOUS VOLUME V SEPTEMBER 15, 19"46 NUMBER 5 CONTE TS QUALITIES OF A GOOD MORAL GUIDE Gerald Kelly, S.J. 281 NEW VITALITY FOR THE OLD EXAMEN Richard L. Rooney, S.J. /296° OUR CONTRIBUTORS . ". . . ~ . . 300 HOW IS YOUR FAITH?--Patrick M. Regan. S.J . 301 IN CASE YOU DON'T KNOW IT-- . . 314 ON READING AT TABLE Claude Kean, O.F.M .3.15 PREPARING FOR THE LAY APOSTOLATE John A. Hardon, S.J. 319 OUR LADY'S ROSARY Adam C. Ellis, S.J .3.2.4. QUESTIONS AND ANSWERS-- 29. Confessions in Convent Parlor .' . 335 ~0. Gift-Money Put Aside for Masses . 33~ 31. Toties Quoties Indulgence on Rosary Sunday . 336 32. Indulgence for Renewal of Vows . 337 33. Use of Profits from Sale of Stationery and Religious Articles 337 34. Profits of School Store Used for Teachers' Supplies and .Correspond-ence Courses . 337 35. Quality of Flour for Altar Breads . 338 BOOK REVIEWS " The Mysteries of Christianity; Major Trends in American Church His-tory; A Mystic Under Arms: Wisdom for Welfare: The Golden Thread of Newman; The Sacred Ceremonies of Low Mass; Caeremoniale: Pars Altera De Celebrante . g . . . " . 340 BOOKS RECEIVED " " 344 REVIEW FOR RELIGIOUS. September. 1946. Vol. V, No. 5. Published bi-monthly; January, March, May,,July, September. and November at the College Press~ 606 Harrison Street, Topeka; Kansas. by St. Mary's College, St. Marys, Kansas, with ecclesiastical approbation. ~Entered as second class matter January 15, 1942. at the Post Office. Topeka, Kansas, under the act of" March 3, 1879. Editorial Board: Adam C. Ellis, S.J. G. Augustine Ellard, S.J. Gerald Kelly, SJ. Editorial Secretary: Alfred F. SchneideL S.,I. ° Copyright, 1946, by Adam C. Ellis. Permission is hereby granted for quotations of reasonable length, provided due credit be given this review and the author. ,Subscription price: 2 dollars a year. Printed in U. S. A. Before writing to us, please consult notice on inside back cover. Qoalities of a ¯ Good Moral Guide Gerald ~Kelly,o [;.3. IWAS recently'called on to give a confereonce and lead a discussion on the qualities of a good moral g~ide~ In : preparing the conference I was.impressed by the fact that among Catholics .the most important of all moral guides is the confessor, and that all who give extra-confessional moral guidance must possess to some,degree a5 least the per-sonal qualifications that the Church expects her confessors to have. It seemed quite logical and practical, therefore, to base the conference on the qualities of a good confessor enumerated in the Roman Ritual, and to explain these qualities in much the same way as moral theologians explain them when~treating of the minister of the sacra-ment of penance. Since the group for whom the confer: ence was prepared, was made up almost entirely of religious, I Considered that anything which wouldbe of use to them should also be useful in the REVIEW. That is the reason for the present article. Before discussing the qualities of a good moral guide, it is necessary to determine what ismeant by moral guidance and who might reasonably be considered' as moral guides'. A "guide" points the way,to something, helps others to attain a goal of some kind. A "moral" guide that ls, a guide in moral matters is one who helps others to lead good lives and thus to achieve the best and highest of goals, their salvation and sanctification. SuCh, I think, is the' accepted meaning of moral guidance in the Catholic Church: guidance in,things that pertain to virtuous living. ~Very likely, when We think of guidancel we usually 281 GERALD KELLY Reoieu~ [or Religious. think of it in terms of direction given to individuals: for example;°iJyl confessors, spiritual directors, and student counselors. Yet it .would be a mistake to limit the meaning ~o such formal, indivi~lual relationships. The teacher who explains the Commandments of God, the precepts of the Church, or the Evangelical Counsels, is certainly giving moral guidance, not-to an individual, it is true, but to an ehtire g.rou~p.- So too, the teacher who in' an informal way answers the questi.ons concerning right conduct, that 0stu-dents are wont to ask after class hours is really giving moral guidance, ~ven ,though not in the official capacity of a~studen~ counselor. From what I have said, it is clear that the term "moral ~uikt'i~:' is hpplicable tO-'ii wide range of persons: pfirents: teachers, youth counselors, religious superiors, spiritual directors of religious, confessors, and all others who, in at least an informal and general way, give advi,ce on moral matters. In a class by himself is the confessor, because of his~unique power of absolving and because, quite naturally, certain probl.ems will be referred to him which will rarely, if ever, fie referred to the others. However, if we exclude what belongs uniquely to the confessor, it is apparent that ' all the other moral guides I have mentioned share with him to some degr.ee the office of directing souls and should there-fore be proportionately endowed with the qualities the Church expects him to possess. The remaining sections of this article are based on this assumption. I might add, however, .that in drawing the parallel between the con-feskor and extra-confessional moral guides, I have par-ticularly in mind those religious who have been entrusted with the special office of guiding youth: for example, stu-dent cdunselors. °The Ritual lays special stress on these four qualities of a good confessor: knowledge, prudence, holiness,-and a .282 September, 1946 QUALITIES OF MOI~AL G~ID~s careful observance Of secrecy. It would be difficult~ if not impossible, to think.of' a more apt and adequate summary of qualifications for good moral guidance, whether in or out of the confessional. 1. KNOWLEDGE That those who gu.ide others in the way of salvation must hav~ some knowledge seems too obvious to need com-ment. The blind cannot lead the blind. Yet, it is distres-sing to note how often one hears remarks like these: "You don't need knowledge; all you need is common sense . In the guidance of youth, and especially of children, com-mon sense and sound piety will take care of everything." Such statements are sheer nonsense. Common sense and sound piety certainly have their places in moral guidance, as will be'explained later; but they will not supply for a lack of knowledge of God's laws and of the teaching and laws of the Church. Nor will they supply the' factual knowledge of such things as physiology and psychology that is sometimes required for appropriate guidance. It is one thing to say that g ~uidance presupposes knowl- ,edge; it is quite another_ thing to say just what the moral guide should know and how much he should know. The basic studies that enter into the training of confessors are moral theology, canon law, and ascetical theology. Besides these, it is presupposed that as.a priest he Will know dog-matic theology. I think it is safe to say that-these same subje.cts should form the basis for extra-confessional guidance. The required essential knowledge would differ, theref6re, rather in degree than in kind: All guides should know at least the laws of the ChurCh that ordinary Cath-olici must observe and the approved explanations of these" laws. They should also know the main principles of Cath-oli~ morality and asceticism. 28,3 GE~_ALD" KELLY Review for Religiou~ Guides ~dealo.with:human beings; ,they must 'therefore know something of that h.ighlyAnteresting thing sometimes re.ferred to, as ~"huma~a,~nature.~ ~Ofsourse;~a great :deal 6f knowledge of "human nature" can be. gleaned, fr0m per-sonal experience and close 9bservation of the reactions of oneself and of others. Yet ~ersonal experience is not narfly, sufficient for .the moral grade;~ he should 'also know Something of;the e~dei~len(~cien~dfic st~idies no~ available on ~iJd ps~cholgg;Ci~d61es~ent psychology, the ps~ch010g~ of Cha~c~er, mentfil "hy~iene, "and s6 forth. In~re~iding.such works, however; the moral guide may himself ia~eed the guid~_n~e~°of a competent~ psychologist; for, l~esides the ex~lien~ ~a~efial'~written'on these subjects, ther~ is no small amour~ of Ua[eli~ible. and even .basically ~nchristian materl~l:~ - ¯ - °Ho~ niucl~ mus.t one know !n order to give proper g~uid~inc¢?. The only~ answer is that it depends on the kind of guidance one isi~xpected to give. The nbrm usually given for the minimum amp_unt of~ knowledge of mdral the-ology require'd of a confessor is this: he should know enough to solve the ordinary cases iike!y to be p~esented to him in th~ place wtiere he is to hdar confessions and should be able to recognize exceptionally diflicul t cases that demand further study or consultation with experts. I beli~eve ~that same norm may be. ~applied proportionately to all guides, and I doubt if ~anything mor~" definite can be given in a gen- ~ral article like this. 2. PRUDENCE " Prudence is the virtue which "helps i~s in all circum-stances to form a right judgment as ~o what we should seek or avoid~for the sake of eternal life" (cf. Gasparri's~Cate-chism). ¯ Wheh: we~ speak of this virtue with .regard to a director of souls the "eternal life" that we have principally,, 284 1946 QUALITIES OF MORAL GUIDES in mind is not the spiritual good of'the director but rather the good of the person, he is directing. In. other wobds, the spiritual guid~ must judge what is dondu¢ive, or more con-duci~ ce, .to the~salvation and sanctification of his charge and then, give his counsel accordingly. It is not 'correct, however, to say that the spiritual director seeks ont~/the good'of the persons he "is directing. True prudence must take iia the whole picture. One is "not prudent who ha~rms his own soul in trying to benefit others. .Nor i~ one, prudent who seeks to help ~n individual at the expens~ ofagreater good, Jfor example; the good of the whole coin.munity,,or the, good of the ~hole Church., An adequate descriptiQn, of the prudent guide would, ,~there~ fore, be stated, somewhat as.follov~s: he is one who uses his knowledge, ~his perso.nality, ahd his influence on others°in sucb.a.:way.asoto atthiwthe good of the soul. he.is~directing ' ~ithouvat the;same tim~ harming his°6wn-soul.~ovd~feating a ,,greater good . ~In~ fact, when~corre~tly interpreted,~-t~he ~ord~°,,ad rriajorein,, Dei~:,91oria~ formul~ite, a; perfect rule of prudence. _ "-,~ ~, , - .;. ~ Without further theorizing on this virtue, I should,like to give here a,, nu'mber of practical points concerning the exercise of prudence, in giviiag,moral guidance. :. I am listing th~se points more or less in the fofm,of,,jotting~ because the subject is too large for more complete treatfnent here;' and, though I, gefierally dislike negatives, I thihk it Will, be espe-cially conveni~flt to put these stiggestions in the form~ of._. a series of dOn'~b. Some ,of thesed o'n ts may appear to be more directly concerned ,with,,tbe technique of counseling than"with the virtue of pr-ud~nde; yet, as .I have already indicated; the- actual exercise~of prudence consisl~s"nbt only in directing souls towards a certain end,but also in choosing the :most"appropriate ~means ,,for ~attai.ning., this: end.~q And technique, or tact, is a,.gery., important means,in :the direc~ 285 GERALD KELLY Review for Relioions tion 6f~others. Don't scold. Even~ people who' ask for.h scolding-do notusually want it and are rather .alienated: than helped.by it. I still remember a story told.'during one of my novitiate retreats which aptly ill~astrates this po'int. In a certain parish ;there was a very devout woman who yearned to s:ale the b.eights of holiness and who had heard that trials and humiliations are essential for this. Accordingly she pleaded ins~ste:~tly .with her pastor, "Try me, Father. Please, try me, Father." The pastor was a peace-loving manand had no inclination to accede to her desires ; but one day when she returned some altar linensshe had launder'ed " he kept her for a few minutes and beganexamining the 'linens in her presence. As he looked at each piece of linen he called attention to some imaginary° (or real) defect in the laundering. A few minutes of this was all that the .would-be saint could endure. She burst into tears and began to__~upbraid the pastor for his ingratitude. But he . cut. her short in the midst of her. tirade with a dry'smile and the chiding rebuke, "Try me, Father. Please, try .me, Father." Don't interrupt unnecessarily. It is generally better for the guide to allow his consultant to tell his entire story and then ask questions about points that need further elu-. cidation. Unnecessary interruptions are apt to cause con-fusion and even irritation. Moreover, such interruptions can easily remove the pe.rfect spontaneity of the narrative and result in a "coloring" of the story ac4ording to some preconceived notion of the director. Don't make yourseff indispensable to your consultants. Even ~ children should gradually be emancipated from the need of getting advice about the ordinary moral problems of life. And, though, maturity does not entirely relieve one of all necessity of getting advice, yet progress towards 286 September, 1946 QUALITIES OF-MORAL GUIDES maturity should surely be marke~ by a diminishing neces-sity of advice in ordinary matters. The best type ofspir-itual direction consists in helping the consultant to do his own planning--with the help of .the Holy Ghost, of course; and the guidance of even the immature and the mentall~r unsettled should be directed towards this same end. Don't unnecessarily send consultants to someone else. Boys and girls sometimes ask their teachers about their problemsbecause they have confidence in these teachers. It is not prudent to send them elsewhere, even to a confessor, if ode can easily solve the problem, for they usually accept help most willingly from those in whom they can readily. confide. And this is also true of "grown-ups." The opposite of this error should also be avoided: that ~is, counselors should never show resentment if their con-sultants wish toL seek guidance from someone else. In this matter one should keep in mind :the liberty that the Church' extends to the faithful regarding the choice of confessors. Tbe~same liberty should be enjoyed by_ those who seek extra-confessional guidance. Feelings of superiority or of jealousy, even among those who are working for God, are quite human and excusable; but the deliberate yielding to and manifestation of such feelings by bragging or criticism is petty and can do great harm to God's cause. Don't destroy cont~dence in others. I am thinking of cases such as this: A priests6metimes finds that a child has a false notion of what is right or wrong because of something his mother told him or something a Sister said. In cor-recting the child's conscience it is the priest's du, ty to try to do so in such a way as to preserve'his confidence in his mother or the Sister. He can usually do that by saying, "Your mother meant something like this . . ."; or "The Sister probably'didn't mean it ji~st that way"; and so forth. As a-matter of fact, the child may have misunderstood his 287 GERALD KELLY Review [or Religious mother or the Sister; but, even if h~ did not misunderstand. th~ priest should avoid giving the impression that the m6ther or the Sister was wrong. The case,of the child as just cited is merely, an example. A~nyone entrusted with the guidance off.others can make a mistake, inculcate erroneous0ideas, and foster a.false con-science.~ Yet among.alF.guides--whether parents, teachers, counselors, ,,or confessors-~there should be a spirit of what I might ~call '~'profeisional "loyalty" which.shourd prompt each one to correct the mistakes ma'de by others without at the same ~time,~°shying that they were mistakes. It is important-for all of" us that those who .need ~uidance should retain their confidence :and respect for those" who guide i?h~m; Ddn'~t be too quick to sdlve "ba~d-luck stories" that inOoloe absdnt persons. When two parties are involved in a quarrel or a misunderstanding there are always two sides to the matter. If the donsultant is one of the parties, he will very likely be prejudiced, even though he does not wish to be ahd sincerel3i thinks that he is not. Ir~ such cases the' ideal solution is to get the two ,parties together:and thexi to thresh out the matter: but of course this"may seldom be possible when a ~matter of co~nscience is involved. Never~ theless, even when tb~ other party cannot be se~n or inter-. viewed-the" "guide should try to understand his ,side of the c~se:b~fore planning a course'-of action for his cbnsultant.~ ,Don't bxaggOratb~.tbe sex prbbtem. ' Speaking.:of the confessor's'prudence; moral~theologians lay particular stress. on the ~need df this vi,rtue iia ~all m~itters" p~rtaining,, to,~sex. ":It is better to say-too little thaB too much,~.' is a' theologi:~ cal_ axiom in this,iegard; and~thisapplies-not only, ~o,con-~ fes~brs but to,, all nioral guides.-,:~eachers~ and,,counselOrh' need not~ be surprised~ if they fihd, the topid,int~re~ting.;~yei~, the.yo, should not allow their; interest to,become ~rnbrbid'. 288 QUALITIES OF MORAL'GUIDES They should :not probe for sex problems, particularly for details ~concerning such.problems. A.,.probing.tendency easily becomes morbid and often results in ~the ri~di~ule~ bf the teacher .or counselor who manifests such a tendency. For example, if a few students once suspect, that a. certain teacher or adviser is especially, interested ~in-: sex ~problems, they will speedily.pass:the vgord~on to ot.hers, and'offensive nicknames will pr0bablyobe coined.; I am not arguing,f6r,a~ Victorian silence concerning sex. I believe .that the topi~ should be treated with a simple wholesomeness,, but. as one'part of life,~ and not.as the whole of-life,~ The di.rector who overemphasizesothe'subject will but. defeat,his own cause--and this, :for one~'in the ap.ostolic life, is a gross- _violatio.n:_ of, the ,.most .fun_damental~ rule of prudence~ There,~:are people boys and girls,, men.and women.~---evendn this sex-consdous world of~o~rs, who have absolutely no problem with°regard tq sex: ~0It is v~Lry imprudent .for a guide, .to create prob.lems for such people by' u.nnec.essary,~.questioning,, or by imparting useles.s i.nfor- " ,T,he~Holy ~ee ha~: repeatedl~ called attention~to the. n~edof pr.udence, not only in treating the topi~ of,,sex~ bht also iri' dealing, with the members of the opposite sex., Here again;,~l, might mention that~ special interest is, not unusu~I. It is Certainly quite'naturaI.ofor a man to e'x~erience a,.special interest in,associating with ~omen; quite natural too that, ~omen will be,particula, rly enthusiastic in helping,boys and young men. To'-s6me extent:this natural attractiveness can'be made a powerful, force in the spiritual life. But not if, it gets out of control. The counselor.who makes himsdf or herself a special apostle to the other sex is not likely to have the, dignity, reserve, and purity of intention°required for true success. Hence, while On" the on~,hand it:is not right for anyone to caltivate.a.n i~ttitude of disdain forthe 289 GERALD KELLY Revieto t:or Religious othersex and to become-a. "man-hater", or a ,~'woman-hater, ""it is nevertheless necessary to'avOid the other extreme of giving the impression'that one's.life is divinely dedicated only to, the' opposite sex. Furthermore, one must remember that e~en innocent relationships can appear unsavory and thus harm the cahde:of Christ. Don't giv~ in~orrnatiofi that can't be digested. Those who teach and advise children- are particularly in need of this Caution: Children cannot assiriailate allthe fine dis-tinctions onerlehrns in ethlc~ and in moral th~01ogy:" for example; the~tea~hingon mental 'reservation, the' cases in-' vdlving the "double effect," the difference between the abso-lute and the relative methods of calculating grave sins of theft. We can ~afely say that childrenshould.never be t01d What is false; btit it does not follow 'from this that they shbtild always be t01d the whole truth. For in'stance, Chil-dren should be c6rrectly instructed as to what to do when they doubt whether they have broken the Eucharistic fast, whether they have yielded to a serious temptation, whether they are excused from hearing Mass, and so forth; and-from the solutions of these individu'al problems they will gradu-ally learn by induction the very important ~principles regarding the solution of the so-called "doubtful coil-science." The same is true ~of other moral and ascetical principles.-' Children "learn them best_ thrdugh concrete examples ~and through the solution of individual cases. They are'hardLy capable of learning the.principle firsl~ and then. applying 'it to, practical cases. (But the teacher or the director must know:the principle well; otherwi~e~he might cause confusion in'making the transition from ~one case to anothe'r. Don't guess an answer. If l.had to grad~ errors in prudence ~according to:.their potential" h~rmfulness; I would put'this amofig the'.very highest. '; If' the director "d0es'iaot 290 September, 1946 QUALITIES OF MORAL.GUIDES know the answer to a question or the solution tb a prob-lem, he shodld say so. It is the common experience", even of those who teach children, that omniscienc~ is not.expected of human beings and that the sincere admission of ignorance does not hndermine confidence. "On the other hand, it is evident that great harm can result from trying to solve vital problems by guesswork. Some go to the opposite extreme in this matter: they never give a definite answer, even-when they are reasonably certain about the correct solution. ,This type of guide has the same attitude toward his consultants' problems that the scrupulous person entertains towards his own. The latter is always afraid he is wrong;and he find~ it difficult, if not impossible, to m~ike himself follow what are in themselves perfettly reasonable judgments. ~ Similarly, the timorous guide will not trust his own judgment and will fear to commit himself in the solution of practical moral prob-lems. In other words, he is no guide ~it all. Don't fret over errors mdde in good faith. It is very helpful for those who direct consciences to examine them-selve~ periodically to see how they ~isk questions, solve problems, deal with-different pgrsonalities, and so forth. If this is done calmly and solely with a view to self-imprbvement it is a salutary and commendable practice. ,But if it is used as an occasion to generate worries, it is use-less and even harmful. It can make the office of guiding others an intolerable burden. None of us is infallible except the Pope; and his infallibility is circumscribed by many coriditions. 3. HOLINESS A few years ago The Messenger of.tbe Sacred Heart published an instructive 'incident from the life of Garcia Moreno, once President of Ecuador:. If I remember, the 291 GERALD KELLY o Reoiew for:Religious storycorrec~ly, it went,:somewhat as follows. As a young man Moreno was a master at expl_aining his faith; but scarcely a tyro in 4ts practice: Ond ~vening,:'in-the course of a long discussion with a rationalist acquaintance, Moreno repeatedly'got the' bette~-of °the arguments; arid' the ration- Mist-finally admitted: r'.v rytlamg ,you say seems to be true; yet I can't accept any of it, for.your own life-gives" the lie. to it all." . -: ~ .5 This~ story illustrates, one reason why the wisest guidance is apt to be useless unless the .guide is a persor~ of - solid-virtue.' Example speaks louder than words; Land ,.this is particularly true in the case of the .,young.~ The young are very human; and it is but human to lose con-fidence in ,one who does not practice what he preaches, to balk at accepting high ideals from one who apparently has no personal idea!s, to refuse to be taught honesty, purity, sobriety, and ~,such things by one whose own life is not marked by these qualities. ¯ In fact; if .we. donsider only g?od example, it seems that the ext.r~a.-co.nfes~iona1 guide.is ~more in need of solid yirtue than is the.confessor; for the faithful in general are schooled in the p,rin~iple.t~hat;the sa.craments do not .depend ,gn the 'holiness of the~,min,ister for their efficacy. This principle does not hold for non-sacramental ministries. Hence, in o~, ~ense a~,.least,.,th~e third .requisite. m, entioned by th.e Rttual=- , goodness, ofl~ e'i"f . - ~ - . p e ritans more to the e-xtra-sacramental. guide, than to the confessor. - ".)It seems~.ob,~ious~ th,at, ,quite apart from the need pf confirming one's words by good example, the successful carrying %n of moral guidance calls for the practice of many virtues. I will not try to enumeral!e these virtues here, for r think tha~,~ is ~uniledessary: ~he requirede.virtiies can be epito~nized.,.~iia ,~dne,:,.~ charit~r~, harity ,tow, ards God ,,and ctiaritg:towards the neighbor. - :.- . ,-, ~.r~ -,~. ,~., ~292 8eptember~ 194~ ~UAL'ITIES OF MORAL GUIDES . Love:.of .God is e~se~itial; for, the'~ direction,of souls :is His work.~i.nd it>must be.unequivocaIly:~onsecrated to Him. Some: :guides apparently have great success', even;though they seem to be impelled mostly, by a-.natural love" fo.r the ~ork~.and by the nattiral satisfaction they obtairi ',from having 6thers" ".dep.endent on them, confiding in-them; and flattering them. This may seem to be the case;,, yet I wonder if it is actually so. No doubt God can work wonders with cheap instruments. Yet.it is,~ardly according to His ordi-nary providence, to do so. , Normally He works His marvels of grace through the, instrumentality of those who-are closely joined to Him by love. ._ : , .Charity toward'the neighborAs also necessary. .The guide needs it first arid foremost" to give. him a ,vital super_- natural motivation. ; F,6r: even" though~ it be',trhe, that_some ean be-carried f6rward in: this wo'tk by some natural:~liking --becahselthey like,to, deal with" people,°like to'engage,,in externaLoccupations, and, so' forth--this is by no means universally>true. Most of those .who are assigned fo guidance work find that many who, need their help are not naturally, attractive. The guide needs to see these and, all souls with "the' eyes of,Christ;, he ',has to realize that these souls, who come to hiin for help are:Christ's ".~least.br~th~ ren"; that' they were redeem~d,by;_t.he Blood of (~hrist; that they bel6ng,'or should belong, to theMystical. Body of Christ. Motivation on some .16wer,pla.ne easily~ springs from or degenerat4s into'sheer selfqove:,,which usesghidance only as a "means bf serf-expression and self-glorification a sterile ihing in the propagation of, ihe Kifigdom of God: " Charity. t0wardslthe neighbor is not merely a~ motive force in guidance, Jris also,a supernatural', toot:.that must. be used constantly. :,In this regard.I can' think,.of nokhing more-appropriate than St. Paul'!s subhme eulogy,.:,: -Chanty is~ patient, is°kind; charity envieth not, ~dealeth, not per.- 293 GERALD KELLY Review [or Religious vgrsely, i~ n~ot puffed up, is ndt ambitious, seeketh not her own, is not provoked to anger, thinketh no evil, rejoiceth not in iniquity, but rejoiceth witla the trtith: beareth all things, hopeth all things, endureth all things." These inspired wor°ds merit constant meditation by the spiritual guide. But we shall have to leave them for medi-tation. I can but say a few words here about the first two qualities, "Charity is patient, is kind." ¯ The ideal for all spiritual guides is, of course, Our Lord Himself. Among the fruits of meditation on His life should be a sympathetic attitude towards others and an eagerness to help them; a desire to see the .good in them and draw it to the surface ;.a readiness for the little couitesies and kindnesse~ that mean so much to the human heart, After all, if these little thing~ mean much in ordinary life, they must mean even more to those who are seeking guidance and "who are often nervous, despondent, and even frightened. As for patience, the spiritual guide has countless occa-sions to practice it. Consultants are sometimes unpleasant in their manner; t,hey fail to cooperate; they c6me at incon-venient times; they dwell lengthily on irrelevant triviali-ties; they occasionally manifest a 'gross selfishness by need-lessly consuming time, as if under the impression that the guide has nothing to do but listen to them. Such things o are apt to test patience to the breaking point. And then there is always the possibility of impatience v$ith one's own s~lfmthat is, with one's inabi!ity to handle a case~ ,~ Some theologians advise priests to leave the ~onfes~ sion~aI for a while when they find that they are becoming irritable: to wal, k for a few minutes in the fresh air, or to ~ relax for a~short time in the rectory. It is better to keep the people waiting for a little while than to run the risk of being sharp or rude. Similar ~idvice may be profitable to all counselors. If one feels so ill-disposed that he cannot 294 September, 1946 QUALITIES OF MORAL GUIDES trust himself it is better to avoid an interview or at least to keep it short and continue it later. " ¯ SECRECY The fo~urth requisite for good spiritual .guidance ~is respect for confidences. Religious, perhaps more than any others, should realize the importance of this qualification. They know the great peace and sense of security enjoyed by. individuals and by communities when superiors and direc-tors are careful about respecting confidences; and they know what evils can result from the mere suspicion that someone in authority uses confidential information too freely. Only the sacramental secret is abs61utely inviolable. Other secrets admit at least theoretical and rare exceptions~ BUt it is safe to say 'that, with the exception of the very rare cases wJ~en confidential knowledge may be disclosed, the spiritual ~guide should have a similar ideal with regard to s, ecrecy that the Church constantly pu'ts before her con-fessors. This ideal is succinctl.y proposed by St. Augustine as follows: "I know less about what I hear in confession than I know about those things about which I know no'hinge" Much more could be said about the obligation of secrecy; but I believe that for our present pu~rpose it is suf-ficient to call attention to its importance. It puts what one might call the "finishing touch" on all the other quali-ties. If a director of souls lacks this quality, the others (even if possessed) will be useless; for the person Who does not feel sure that his confidences will be respected simply will not seek guidance. On the other hand, if the director possesses this and the other qualities explaified in this article and uses them for the .good of souls, he will accomplish great things for God and will earn for himself the reward promised to those who instruct others unto justice. 295 N " I't:y fo !:h Old l:::xamen ~ichard L.'Rooney, S.J. ' "" : ~n sea syhsq w.uhla.dt simply ,repeat the verse o~r s, entence over, and over w!tho~.t bejn, g con--. cerned about finish, i.ng .the. prayer or psalm. A month of consistent work at the al~ov~ method of ~xamining on-e's conscience will yield ~uch light :and life to the exercise as to make'it, the exciting cdnt~ict with God that it~can" be and was.meant t6 be. It~will help'too to fuse one's private prayers and liturgical prayers ,'iri~o the unified wholeness that should be the mark Of "the adult ieligious. , , ,OUR CONTRIBUTORS CLAUDE'KEAN, formerly,professor of chant and homiletics at Holy Name, Col-lege, Washington, D. C., is now principal of Timon High,~ School, .,Buffalo, New York. RICHARD L. ROONEY, after serving as a chaplain m the armed forces of the United States during the war, recently joined the staff of The Queen's Work. St.:,Louis,-Missouri. JOHN A. HARDON. who has done much work with high school students in't1~e fiei~l ~f debating and i~ublic speaking,-is'a~ tl~eological s~udent at West Baden College, West Baden Sprifigs, Indiana. [~ATRICK~ M.'REGAN, until r~ecently ,professor of-fundamental theology at St. Mary's C~ollege; St. Marys, Kansas, is sp.iritual director of the junior scholastics at St. Stanislaus Sem!nary, Florissant, Missouri. ~D^M C. ~ELLIg' anal ~EI~.~ED KELLY are"prof~s~ors of canon law m~)ral, theolog~, 'respectively at St'. Mary's .College, St. M~ys. Kdnsas, and are mem-bers of the Editorial Boaid of,REVIEW FOR RELIGIOUS. ~. 300 . )~'E~ENTL~ a non-Cath0hc journal of theology printed ~1~ ~aff~ditdfial ~n freed~N d{religion. After an.~lysis ~ - of-the' concept of freed5~, ~Yb~ author 6rew tb~s cob; c]usion: "Freedom i~?th~ ~fruit"of~]legxance~ given "to God .~f~ne."v 'He then c~htinued~ VGr~nfing only~a~truly re]i-giSus man-is ~u]ly'~fre~, .,wfi~tL'd0~ fr~edo~ Col: r~]igion mean? . It means, fi~st bf ~]l,a fr~edbm to .cHb~s~sn~s re]i; God resultsqn;freedom td~ ch00se, bne: s own:~religi6nq.~ Why;~ We "w6nde ~t produce allegmnce'to;Go6 s r~l.igion,~ r~veal~d4or all me~ b~ll:' ages? A~ain,,~:sffan~eg;10gic ~that;e:xpl'ai~s there a:fe assortment~of Chr~stmn~ tell: , one .as.good,as. anotHefl. ,~ In,. l'{~'s concern God~ ~s left-us to 'belleve~contrad~ctory doctnnes; to~,}fbllow Lconflietigg~ p~adric~s ~' "all~.this~the fruit , ~' That in the very worship of-God, ~an andnot the' norm~ ~s' contradzctory; "yet-that is precisely~ the~ daffy pracnce of mdhons of Chnstmns. "~s a matter'of factJ'zt - _does noi even occur to them that there is such a thing as one , true religion excludin~ M1 o~fiers as false. When on rare occasions someone institutes ,a s~arc~ for .[ehg~on, t[ut~ consloeranon, because sofew realize that '~ree'~d~m"i?' the' right to CBOose only', what xs gqod ahd t~ue, Godis almost unlvers~lly ~gnored.m matters religious: Truth in Revelation . . ,.:.,: ~o. ' In this whole question. ~f belief, erflphasis must be .laid 301 PATRICK M.R.EGAN R.eview for Religious on tfie'fact that there can bi~ no choice between true and false. GodHiinself in.m~kin.g a revelation could not ignore truth but had:t0, m, an~ifest divine reality as.it actually exists. In a Word, God revealed Himself; and since God cannot .possibly be altered to conform to human opioi0ns,-,man must nece,,,ssafily conform his intellect to the.,truth about God. This he,,does .by believ!ng .the. revealed word. describing God's essence and His relations to man. Now.the first step in,,,the act whereb.y we assent to this .~ruth~ is submission of.the intellect to God's au~h0rity. Thus at the very. outset we must establish direct.,communication with God. Catholics, even though blessed with the true faith and filled .with .high religi'0us id.eals, must, pay special heed to this need of.intellectual contact with God. Though not as vulnerable as those outside the fold, they still may be pron.e ,to give God a sub'ordinate place in their intellectual life of faith, or, even forget Him altogether. Many, for instance, never realize that faith first, last, and always reaches up, to God as the One revealing and the Reality revealed. In the matter of divine charity most of us under-stand clearly enough the necessity of going straight to God without detours through selfish interests, and so strive valiantly for perfect love and perfect contrition. But just as sure as the will embraces God in love,, so the mind is united to Him. in divine faith. God Overlobked However, in. our very zeal for the faith we incline to overlook this intellectual union with God. Bechuse of our tendency to concentrate on the truth, we are quite apt to forget God revealing and even God revealed. Nowadays with so many facilities for stu'dying our religion, wi,th so much urging to understand it and to be able to explain it, we are particularly inclined to focus'attention on its e~pla- 302 September, 1946 Hov~ IS YOUR FAITHi' nation or on a set of questions, thus.overlooking its divine Author as well as tl~e Reality revealed. Quite regularly it happens that, while probing the depths of-the mystery of the Trinity and answering objections proposed, we never even think of the Triune God. Or to take another setting, how many ever think to re, pel a. temptation against faith with: Can'I possibly doubt God's word? Only too.many, terrori.zed by the temptation against faith, wrestle with the truth itself, trying to comprehend, for example, how Christ can be really present in the Eucharist. The Church's Contribution What may prove another obstacle to the union of faith is the relation of the Church to our belief. If this is not dearly understood, it confuses us and may lead even to the Church's supplanting God in our mental attitude towards matters of faith. Any number of Catholics would sub-scribe to: "Because the infallible Church teaches "this doc-trine, it is true, and I believe it." By stopping there the~, profess faith in the Church's teaching with6ut advertence to the real.motive of faith. Following an accepted axiom in the Church th~at prayer conforms to truth (lex orandi, lex credendi), we can verify the motive from our ordinary act of faith: "I believe what the Church teaches, because Thou hast revealed it." Hence the act of faith in its full-ness erriphasizes God's place: "Because God has revealed this, it is true, and I believeAt." " To cede God's place to the Church, even unwittingly, is to lose the advantage'of the. power, beauty, intimacy, and the vision of faith; the com- -'munication of the divine mind to ours. Even though by faith we see God only as "a confused reflection in a mirror" (I Corinthians 13: 12), still it is God, as surely and really as if we saw Him face to face in heaven, and it is He who revealed the reflection. ~ 303 - PATRICK M, REGAN ,.~ Review for 'Religious ,,~; The~primary'office, of the Church is to give us an in,, fallibl guarantee', "This is God's~ messa.ge:r' , This prd: nouncement ig;for ub but a stage On the.way to faith; we must not make-it, a,~ goal. Pius IX in his definition of the Immaculate Conception emphhsized tile duty of.submission both, to the:Chu¢ch and to God;, to fail in the :latter.means, shipwreck for" the faith; °to fail in~ th~ former in~ w6id, w}itihg or ex~er, nal act subjects the offender to alLpefialties of Church Law. ~. The Church's contribution is further cl~irified by St. Paul's distinction: "It was for me to plant the seed, for Apollo to water it, but it was God ~vho gave the increase" (I Corinthians 3: 6). Like:~paul's, the Church!s missi6n is limited to Planting the seed and wateriffg it; it is gtill God who gives the increase. W~ too must beware the error of ¯ Corinth, decried by Paul: "Why, what is Apollo,. What Paul? Only ~the mlnis~er of God in whom your faith rests,. who have brought the.faith to each of you in the measure God granted" (I Corinthians 3:5). We must beware mistaking the gardener for God, to whom the life and. beauty of faith's garden is.realjy doe, Incidentally, we must 'also guard lest the beauty of the flowers of revealed: truth blind us to the beauty of God from whom all beauty comes. Contact with God .One more comparison will clarify and emphasize this ¯ fa~t of intellectual contact with God in faith., A telephffne operatorrs main work is to connect us With our party; tha( done, she maintains the connection and.finally breaks it ,at th~ e'nd of the conversation. While, the office of the infal-lible. :teaching Church' is .far more important than an operator's, involving~fa~, greater power arid ac'tivity,, still there is a :resemblance. It consists in this that the first duty and wish of the Church is to put us in communication with 304 Septe~b'er, 1946o HOW IS 'YbOR FAITHi~ Gbd. ~:Of::~burse,.i ~minirhizing ~her activity wand influence must be,.avoided., She is.not'.,a mechariic~il operhtor,:merely establishing communi~ation Vcith God,that wbuld involve exclusi~cely private 'in~piration. ~ind ~inter~pretatiofi' for a.n3? and.all. No,: she is God%~.own:guardian Of. the whole of His message, teaching it .~ithout possibility 6f er'~or to~.all men, ~xplaining" it, adapting it to our understar;ding, and applyirig,itto current problems. Thus, as mediator ' of God's truth," she is~ His supernatural instrum~nt~ for many~ an i~nspiration and clearer interpretation* in individual souls. -God's then is the,task of love,~'to aid the intellect, engaged with the dogma proposed by the Chu°r~h, to a free assent, and then to admit it~to the mysterious, counsels of the Trinity. It is the: ope~ration of His~ grace, ~silent, effica-cious, mysterious, as is every great work of G6d. Message of the Inffividu~t " Wha(has the individual to say to God, once he has con-tacted. Him th~rodgh the Church? By-passing theological ~ontroversies on ~he prea,~ble.s of faith and on the act i~self, we may say its ~es~a.ge~would be briefly: "Eord, through your Church I have learned of your r~velation to men, now contained in Scripture and tradition. Thes( truths-=I believe because You have revealed them wh~ 'can neither deceive nor be deceived. But more importan~ still, since Your truth is li~ing reality, I wish~ to explore:itslength ~:~ ' an~ ~ ~ depth, b~ead~h and height for. a ~f~r clearer~ arid m~r~ in-timate apprehension. On the Church I rely for explanation. direction, exhortation; but it is only by communicating "with You that I can share more fully in the knowledge of Your intimate nature." Faith Must Grow This contact established, answering divine communi= cationsare set in~mbtion as God through graces and~ inspi: 305 PATRICK M. REGAN ~ Reoi~to for Relioious rations opens .up new vistas of ~,understanding. for the believing soul.,~ To be sure, the.soul mustkeep the line of communication operi throi~gh an attentive mind, remem-bering a distracted or disinterested mind cannot capture the full imports of a messa.ge. This dedper, understanding cbmes, .therefore, during periods of special activity in spiritual matters: in meditation, in vocal prayer, during periods of recollection~, during attentive reading or listening to sermons; in. time of Mass, Communion, thi~nksgiving. Particularly. a recollected rnihd will be quick to recognize God's~inspiratibn, desiroias of profiting by it. Very. rich and elevat~ed is this concept of divifie faith ~:ompared to the all-too-frequent notion that it is mainly a vice-like grip on revealed truth. Thus many 'err in thinking that the more we grit our teeth and. the tighter we clench our fists, the strdnger our faith. Such an attitude exposes faith to the danger .of becoming a lifeless formality., a bone clenched between the teeth; it saps its vitality and dynamic force. In this atmosphere profession of faith can "quickly deteriorate into, "I believe, and that's that; now to Catholic Action, study clubs~ social.uplift, and the rest of the Church's activity." "I believe" should introduce the intellect to a whole world of reality, which like a greaLpainting grows on us through contemplating it. "Gbd revealed" ,challenges the mind to intense activity and will tax it to the limit~ of its capac.ity. Co-operating with "God revealing" by being ever attentive-to His illuminati6ns, we stimulate our life of faith, growing to fuller comprehension of the Reality that is God. In this manner our mental gaze is focused on the God-man,.forinstance, not as He appears in thee light of weak human reason -an-historical personage of the past but, as He is comprehended in all His mysteriousness by God Himself. For in this ihtimate union of faith, God shares 306 September, 1946~ HOW IS YOUR F~AIT~I.;' His own knowledge with us. It is quite detrimental, therefore, to the whole spiritual life to mistake faith as mainly tenacity in clinging to revealed truth. While~striving for ~the union of love, our minds do not meet God's to participate in its treasures. ' To be sure, tenacity has its own importance since we must hold ,fast to the faith. But revelation is not a bodyof truth delivered two thousand years ago, passed on from age I~o age as a sort of sacred fossil guarded by the Church, and exhib~ ited to our astonished gaze as an archaeological phenom-enon. True, "God revealed" does not change; there is no change in the Three Persons who are God. But our knowl-edge of '-'God revealed" changes, and that very rhuch, if we nurture it zealously to a robust growth; in fact, it will neve~ cease to grow as long as we tend it. Even in the Church there has been development in ufiderstanding doc-trine since the time of the Apos, tles, for living truth must grow. Our own individual growth must be fostered by a mind attentiv~ and a will docile to divine illuhaination; necessary too is our own burning desire and resolute will to overcome our natural dislike for contemplating truth. Steadt:ast in Faith " ~ome~of the foregoing strictures may give the impres-sion that constancy in faith is of minor importance. Such an impressi6n would be erroneous since tenacity has its place and importance as one of the essential properti~es of faith. Thus millions of martyrs through the centuries demonstrate and emphasize the need of cons(ancy; because they professed the faith even in the jaws of death, they were gloriously, crowned. This constancy is also living and dynamic enabling us to face the trials and difficulties of faith perseveringly to the end. It involves cooperation with God's activity in our souls. ~ This constancy, as a living thing, must also grow. For 307 P2(TRiCK-M. REGAN Ret~ieto [or Rel]oiou~ -one ~hi~g it will grow apace with our increasing intellectual apptehensior~ of God's.mysteries through our grac.e-assisted contemplation'of truth. The more peni~trating our. faith and the more real, the~deeper our convictions that make. for steadfastness: :No man.ever,laid down his life for a cold, unrealized .proposition; 'but millions; have died for God who through faith, bec~ime a g~eat and loved reality. ~Every element~,of,~.faith, therefore, must ,be ~arefull~r fostered to ~ttain full and healthy growth. God sets no limits to 'His~ graces to enable-us to accomplish this: Brighter and brighter will be °the~'illuminations~as We make progress, clearer and-clearer the vision, until only a thin veil. as~ it, were separates us from th~ i~naccessible light ,of "God revealed.'[ .Co-operating generously, with grace, m~ny; a~ saint ha~ attained to that sublim~ height,of intel~ lectual realization of~':God revealed." _ . Pihs XII Exhorts The majority of us, perhaps,~are altogether tOO supine about contemplating' ~evealed truth, even fighting shy of mysteries. Pope Pius XII in his encyclical on the Mystical Body writes:. ,- So'he through empty fear look upon so profound a doctrine . (of the Mystical 'Body) as something-dangerous, and so,they fight shy of it as~ the, be~autiful-~but.~forbidden ifrtiit of,~paradis_e.~. ,It is:not s0: Mysteries-revealed~ by God. cannot: be harmful to men; nor should they remain as treasures.hidden in a field, useless.° . : These words a~one if taken seriousl~'~at f~ll face vai, u~ should.inspire us to a study of mysteries, a study which is capable of ~assisting,.us to the heights :of. contemplative u~ion.~ ~ ~ery hexf ~brds 0~ the ~offti~m~l~ this: "~ysteries ,~ve been given .from on high preqisely ,to hel~ th~ spiritugl progress of those who stud~ them ~ a ~pjrit of-piety~ This would seem to be. a fruitful_source itual advance which manz~0~erlo~k ~rneglect.," " .". - 3O8 ¯ Septelnb"er, 1946. ,, HOW IS -YdlJR"FAITH? < ,7 ,,Makir~9, G~d Real -~' This~sthdy of.mysteries; thotigh ,it can be promoted throu~gl~ ,stu~ty ,clubs, ,doctrinal ;lectures;'assimila tiv~e .readin'g, does not necessarily involve such formal methods. Inq?act, if s~iritual p'rogtess is to result, it is only ac(omplished Under the tutelage of ~God Hims~elf, "in a spiri~ of.piety," as the ~oritiff puts it. ~ A fei?vent ~so~il, 'filled vith grow, will b'e0,greatly encouraged and , orisoled by its noticeable progress in spiritual insight into mysteries. making dailymeditation in this way in.~the presence of Christ, reflecting on th~ mysteries, prayihgfor light, in-voking the ~intercession of "the saints for grace, a s0ul will t~avel far toward making God very real to itself. Nor are these" exhortations to contemplate rev.ealed truth only f6r the highly educated and'for those learned in theology. It is the only way I~o make God real to the soul. Hence many uneducated and simple people have attained . brilliant success, not 0nly canonized saints, but hidden ones als0. ~rchbish6p Goodier in his booklet, "Some Hints on Prayer," tells the story of a poor woman., bedridder~ for years. When she-first became ill she arranged some daily prayers for~ herself, resolving to say them slowly to make them go bett~r. But soon the Our Father had gr6~n so much that.it took her a wh01eweek to'get.,through it. She often prayed~ that many otlfers wot~ld"find how much¯ ~s ~hidden in'~the Our Father. Through the grace of ~.God, therefore, through patient endurance of her sufferings, and through ridding herself of haste, which according to St. Francis de Sales is the ruin bf devotion, this poor, uneducated-woman reached "sublime heights of contempla-tion. Week after week the mystery of the fatherhoodof . G6d and the brotherhood of men.filled her thoughts as the ~reat reality it is. Her method was simplicity itself, yet few follow her example. _: ~ ~09 PATRICK M. REGAN Review for Religious Method. of Vatican Council The identical method for the st-udy of mysteries, explained in more technical language, is outlined in the encyclical: For, as the Vatican Council teaches, ;'reason illumined by faith, if it seeks earnestly, piously and wisely, does attain, under God, to a certaiti knowled, ge.and a most helpful knowledge of mysteries, by considering their analogy with what it knows naturally, and their mutual relations and their common relation with man's last end," although, as the same hol~r Synod observes, reason even thus illumined ~'is never made capable of understanding these mysteries as it does those truths which form its proper object." Undoubtedly, the poor woman in meditating the fatherhood of God was unaware she was using analogy and was integrating the mysteries, but she did that nonetheless. There is no other Way. Application Even a few meditations on this method of studying revealed mysteries would bring immediate advantage to any soul striving for spiritual progress. Such considerations as the following would be profitable: ( 1 ) Since an ecumen-ical council proposes this method and stamps it With its approval, we have antecedent certitude of its efficacy. (2) The first requisite is to "seek," and this involves the intellectual effort always required in the search for truth. (3) We must be "earnest, pious, wise" (each word fur-riishes enough matter for a meditation) in our search. (4) All'this leads to "a certain knowledge .and a helpful knowledge of mysteries." Having pkescribed the proper attitude and indicated the certain goal, the council then tells us how this is to be reached. Three lines of procedure are indicated._ .We must consider,the analogy of mysteries with what we know naturally. " Since God is mirrored in His creation, we can consequently always find at least a faint resemblance" 310 September, 1946 HOW IS YOUR FAITH? . for a mental take-off into the stratosphere of divine reality. The shamrock,indeed, has but a very remote resemblance to the Trinity; yet St. Patrick, according to tradition, used it successfully tb teach that mystery to the Irish. St. Augus-fine's mirror of the Trinity was the human soul with its being, knowing, willing. Ever.y successflil catechism teacher has learned by experience the practical value of clear, striking examples, which is nothing else but the method of analogy applied. The second line of procedure indicated b~ the Vatican Council is to consider the "mutual relations of mysteries." Thus a consideration of the relation of the Trinity to the Incarnation, of this to the Redemption, of this to the Mysr tical Body (to indicate only one .chain of mysteries) will astonish most of us by the abundant fruits of progress in knowledge of God. , The third line of procedure is a consideration of the "common relation of mysteries with man's last end." It too will delight us with the new superna[ural world it pre-sents to our wondering gaze. An Example An outstanding example of .the application of this method is to be found in the encyclical on the Mystical Body itself. This doctrine .is a strict mystery.involving very many other revealed mysteries. The main purpose of-the encyclical is to explain the doctrine. The entire first part is an explanation in three sections of the terms, ,Body," "of Christ," and "Mystical." The explanation of "Body" is an unfolding of the analogy of this Body to physical and moral bodies found amongst us. "Of Christ" is explained .by interrelating the mysteries of the Incarna~ tion, redemption, and sanctification to our union with Christ :for our eternal salvation. "Mystical" summarizes the two preceding expl~inations. Other mysteries involved 31i PATRICK M. "REc.~N Re~ieu~ for Religious in .the furtherexplanation are: union in faith, hope, and charity through .the Holy Spirit, the divine indwelling, and the sacrifice, of the Mass. An Application The" very intellectual life of faith we are treating is mysterious. It will not be amiss to apply what we have been l~earning from the° Vi~tican Council to throw new light on it. We shall employ an analogy. Suppose a sci-entist made a radar contact with an inhabited planet~ learning much of the nature of the place ahd its inhabitants. This scientist ~e would accept as an authqrity, studying with avidity the information he 1Sassed on. We would be most eager for mdre and more informati6n, ff by some chance" the ficientist enabled us personally ti~ communicatd in amystefious way with the ~uler of the. planet, we would seize every opportunity with miser's greed. Slow and imperfect though the method might be, we would l~atiently persevere, wqlcoming every new. bit of information, rejoic-ing that first crude ideas were being gradually clarifiedl Now the Church presents us th~ revealed facts of heaven, its citizens, its nature. As intermediary she guar-antees °the facts as ,revealed by God. The personal com-munication with God she makes.possible to us,~and, daily we speak familiarly with God, His Mother, the angels, and the saints. "We really live in .that atmosphere of the super~ nati~ral life, with God 'and its ~charac_ters growing more and more. real:with the passing of time~ Surely it all should~ be as ;~ctual as'any ~tadar communication'with a distant planet might be. : " ° '~ " ~ " ~' A East Applicatio~n But ,.rfght here on earth there is quite a bi.t Of heaven,," what with, the~. ~r.ii~ity ~indwellifig in our souls, the, Real Presence, the Holy Sacrifice. The Adoro Te of St. Thomas 312 September, 1946 How IS YOUR FAITh? Aquinas will furnish bur last application: Sight, touch and taste in Thee are each deceived, The ear alone most safel~l is believed, I believe all the Son of. God has spoken Than Truth's own word there is no truer token. If a blind man lived in paradise, how eagerly he would Hsten to every description and explanation of his surround-ings. His would be a very real world; and he would act accordingly, e.njoying every delight to the utmost of his limited capacity. In fadt' his very handicap would result -in sharpening other faculties" to chmpensate for his defect of vision. His prayer would be-ceaseless for full vision. his ~whole b~ing rejoicln~ at °every slightest advance to the goal. Now it is an astoun~dirig reality that every element of the beatific vision is so proximate to us. With Father, Son, and Holy Spirit dwelling in us through sanctifying grace, only mortal bodies and the obscurity of faith prevent full vision. This will come after we pass through the portal of death; but meanwhile immelisurable p~rogress toward vision is within our pdwer. T.he blind man is hopeless compared to us aided by God revealing Himself to us ceaselessly. How is 'Your Faith? In the light o~f all that has gone b~fore, we should be able to get a clear picture of the st/fie of our ow.n intellectual life of faith. ~re are halrdly in the class of those outside 'the fold for.whom God .means so little in faith and religion that freedom of reli~i.on means .the right to choose any re!igion you like. But if faith is mere words, a jumble.of words wi.tb no~.'ireality ~be~ind them, if praye~ is nothi~ng.but the droning of words, and spiritual reading a study of literary form and style, then God is'not a great r~ality in our, spit,] itual life. But perhaps many do actually glimpse a vague vision 31,3 PATRICK M~ REGAN of God as a great reality. Their faith Will still be weak unless daily they exert themselves constantly to keep in contact with "God revealing" Himself personally to them. This is our life's work and, faithfully followed, it leads to great heights. While checking the foregoing, we can also profitably~ examine our attitude towards the office of the Church and towards~ the function of steadfastness in our faith. All will be well if we find that for us faith is a first link with a supernatural world that is very real, and that through grace we contemplate that world, making God ever more real to us. In such a case we will welcome the helpful sug-gestions of the Vatican Council for studying mysteries, and the exhortation of our Holy Father to do this in a spirit of piety to promote our spiritual progress. In Case You Donq: Know ~Twelve years ago the Salvatorian Fathers inaugurated ~he devotion known as the "Priest's Saturday." It consists essentially in offering Holy Mass, Hbly Com-munion, all prayers, labors, sacrifices, joys, and sorrows on the Saturday f011owing the First Friday of each month for the sanctification of all priests and students for the priesthood throughout the world. Literature explaining the devotion in detail may be obtained from the Salvatorian Fathers, Publishing Department, St. Nazianz0 Wisconsin. "To de~,elop in souls a strong permanent devotion toward Our Lord in the Sacrament of His Love by concentrating attention on the Eucharist during thirty consecutive days," the Fathers of.the Blessed Sacrament organized a movement, which is now enriched with indulgences, fo~ the observance of April as the "Month of the Holy Eucharist." For full information wirite to.the Fathers of the Blessed Sacrament, Desk: M.H.E., 184 East 76th Street, New York 2, N. Y~ ~ new quarterly review, Catholic Action, is now published to provid~ for the special conditions, needL and opportunities of Catholic Action in India. The magazie is published at 2, Armenian Street, George Town, Madras, India. Ann.ual Subs.cription Re. 1-4-0. Our Lady's Press Mart, P. O. Box 122, Passaic, New 3ersey, offers gratis attractive "Go to Mass Sunday" ~tamps suitable for use on letters, packages, and so forth. Requests for stamps must be accompanied by a self-addressed stamped envelope. 314 On Reading a!: e Claude Kean, O.F.M. ~T CAN hardly fail to Strike the newcomer to religious life as odd--this reading aloud of pious books during meals. What, he wonders, is the purpose of it? Is it to expedite meals? Or to safeguard communal charity? Or to expiate the self-concession inherent in eating? Or, at least on fast days, to divert the mind from the menu? It is not long, of course, till he finds the answer: that, just as restaurants add music to meals for the consumer's pleasure, religious refectories add reading to meals for the consumer's profit. This profit can,. undoubtedly, be substantial. The refectory reading can draw our minds, after a morning or an afternoon of distracting duties, back from the perimeter of religious life to the Center; can "knit up the the ravell'd sleave of care"; can freshen our spirit and fill anew the wells of our motives. But it can do these things only if several conditions--quite .obvious, yet quite often ignored are posited. First, the reading must be heard. Normally, it will be heard if the reader observes Father Pardow's simple rubric: Open, your mouth, and,read slowly. There is the whole crux of the matter. A lectern, rightly placed, can help; and, in large refectories, a public-address system can help even more. But, as trained actors have proved a thousand times over in whispered lines, the audibility of a voice depends not primarily on bigness of volume, but on sharp-ness of diction. Barring marked impediments of speech, then, there is not one reader in the religious community who cannot be easily understood if, in the phrase of Canon Sheehan, he will "~bite off:. his words, as riflemen bite their 315 CLAUDE KEAN Review for Religio'~s cartridges,, and chisel:every~ consonant, and giv~ full scope to every vowel. Nekt to ~nunciation comes .interpretation. It would seem that, under this heading, a curious tradition governs mu~b bf our refectory reading:xhe traditiori°ofut'ter~.imp~r~: sonali'ty. Perhaps from"promptings~of humility, we'strive to sou:nd not like ourselves Or. lille any recognizable person at all, but like some generic concept of a religious. To that end we affect a voice suggestive of a~cold in the head: a voice - that is toneless, lifeless, remote, altogether detached from its posseskor; a voice that, shorn of allaccidents, comes forth before mafiklnd as a, sheer essence. We read .every word like every other word. We reduce all the author's thoughts " to a common denominator of impassivity. His challenging ~question-marks and his indighant exclamation-points w.e turn ~like'into prosaic periods. If dialog odcurs, we flatten it into monolog. If we come to a passage of poetic beauty.- we read it as dispiritedly as though w~ were reading the cdnstitutions of the community. And this is.passing strange. An hour or two ago, in a classroom, We read aloud a story so imaginatively that our young listeners hung on our every word; and now, inca refectory; we read aloud another story, or at least another book, so'perfunctoriIy that our religious hearers nod' over their plates. Why the sudden declension.from Dr.Jekyll to~'Mr.' Hyde? °WSy the horreht change~ fro~ entirely natfiral reading to entirely unnatural chanting? from a "stylethat vivifies a text to a style.l:hat embalms it? We .are, indeed, not to "tear passion t6 tatters" in our reading: we are not to over-read. -~But neither are we to under;read. Good reading is nothing but intelligent reading. And religious self-effacement demands neither the privat.e nor the public abstention from the. use of intelligence. The Horation precept still' holds: ""If you want me ,to 316 ~epte~nber, 1946 ON READING AT TABLE weep, yoti yourself" must-first grlev .'- The :interested listener still 15resupposes'the interested reader. A,nd, instead of a. drably~ ascetic feature of our daily schedule, what a profitable and pleasurable pastime might our table reading become if all our readers were, to read, not "in.,mournful numbers," but,in~tories thatovariously "echoed the sense" Of what. they read! Much of the prosperity_ of reading, it is true, depends upon the book: And 14ere let superiors remember that books, like music, fit particular purposes and occasions. Bach and Beethoven and B'rahms are masterly music indeed; but, as tests have proved (as though proof were needed!-), they are not good dinner music:, The subtlety of Bach~ tl'ie e/no-. tional inten~ity~of.Beethoven, the massiveness of' Brahms impede digestion, instead of promoting it. On the other hand, Strausi is ggod dinner music:~ for the most part light-some; melodious, and not too profound. In'a similar~ay, many books of devotion, :though in themselves excellent;-are not good table reading. -Contro-versial works aye not, nor are scholarly works of apologet-ics, nor are solid treatises on asceticism. Close concentration and happy digestion do not get along well together. Saint FranCis de gales, .for "that~ reason, advises against mental prayer ~immediately after a. meal, "before digestion-, is adxianced;" .citing.~not Only the diffidulty of concentration when-ori~:is "heavy .and drowsy," but the positive danger to.14ealthinoit. And is it hot at[ least conceivable thxt.some off,the stomach ~disofde'rs n'ot uncommon.among religious can~be~ofra~ed0to the tieayy.literary fare.serv_ed at our m~als.: thd .bookS:of unrelenti.ng s¢tf-an, alysis,.~the pon~derousotrea-tises on ,th~'~irows,; the.~un.relie.vedly.,statistical bi~graphi~sof the'saints? ~ ¯ One mother superior told the writer not long ago that, weary of high and dry books, she had appointed for table 3 CLAUDE KEAN reading an excelleiit novel by an excellent novelist, White Fire, by FatherE. J. Edwards. S.V.D. Though a few rigogists in the communiyy frowned at the, innovation; the majority of the sisters rejoiced. Here, for once, was a book to which they could listen without effort; indeed, a book which they could follow daily with bated interest and yet not without genuine spiritual profit. From the trials of a real flesh-and-blood nun, "Sister Agnes," they derived more practical wisdom than from whole libraries of abstract ascetics: Would the ~xperiment of that superior not be ~orth duplicating in al! communities? Is it against a book that it excite interest? that on occasiofi it even provoke good-humoredlaughter? Must we eoer eat our bread in serious-. nes~ and sorrow, as though joy w~re not a gift of theHoly Ghost? If Our Lord "taught in parables," is it undignified for us to listen to parables in the form of religious nov.els? If almost every word that He utterid was fringed with the pictoriM and often even the poetic, do we indulge in unseemly leyity by preferring the colorful and concrete religious bool( to the vaporous and abstract? We,live in an age of excellent, Catholic writing: of first;rate biographies[ such as .Walsh's Theresa of Aoila. Feeney's American Woman, Maynard's Too Small a World, O'Brien's Enter Saint Antl~on!1,~Sargent's Mitri, Repplier's dunipero Sera or Mere. Marie of the Ursulines; of well-Written novels, such as'those of Benson and Shee-ban and more recent writers like Edwards; of attractive works of apologetics, such as thoseof Chesterton and Lunn; of Nell-edited Catholic rnagazines and papers, replete with articles of current "interest and importance. Why, in the midst of such plenty, should we keep to a starvation diet? 318 ' Preparing t:or t:he Lay Apos!:oh !:e 3ohn A. Hardon, S.3. SOME time ago, one thousand Detroit public high school students and their teachers filled the Rackham Memorial Hall to listen to the devout recitation.of the Hail Mary! The Ave Maria was part of a dramatic story a young man was telling about a Canadian commando who seems to have been miraculous!~ cured of blindness by our Blessed Mother. o How did such a Catholic subject as. devotion to Mary ever get a hearing in a public speech exhibition? before an auditorium full of non_-Catholics? and .the whole affa~ir sponsored by a large secular university? The answer-is: Catholic Action through t~e Sodality. We must all be aware of the interest manifested by the late Holy Father and by the present Pontiff in the forming of a lay apostolate and of their wish that the Catholic school be made a training ground for such an apostolate. These facts were made quite evident by the letter to the superiors general of all religious institutes on the "Pro-motion of Catholic Action.'~' This letter, written in 1936 by the Cardinal Secretary of State in the name of Plus XI, was quoted in full in REVIEW FOR RELIGIOUS (September, 1945), and was accom-panied by a very complete commentary by Father F~fincis B. Don-nelly. It is one thing to know the fact that the Holy See. wishes our Catholic schools to be a training groun~ for the formation Of lay apostles; it is quite another thing to determine the meang o~f accom-plishing this purpose. Space fdrbids our giving ~ here an extended study of all the different ways in which training lay apostles can be integrated into the regular program of a Catholic grammar school, high school, or college. There are many methods of doing this:, and the teacher's own ingenuity will suggest scores of ways besides the one here detailed. But the writer's experience is limited to the effective-ness of one method of" dovetailing Catholic Action with Catholic education. The method in question is extra-curricular speech wbrk in high school elocution and debatifig. Elocution in its variant fo~ms---oratory, declama'tion, and dra- 319 JOHN A. HARDON Review for Religious matic dialog has long been recognized as an excellent medium for "d~vel6}ing the-intellectual and emotional talents of young students. But it can b'e much more than that. It can become the instrument f~f~aining"them tO give'that evidence of the faith within them of which we'American Catholics are so sorely in need. Once a teachdr df eloquence becomes convinced that his or her trainees can be inspired by higher ideals than mere excellence in vocal expression, then what began as-at~ elementary ~btirse in speech:culture become~ overnigh~'~ dyn~'.mi~ an~t almost r~sistless force of tl~e 'apostolate. No secular sub-jec(, be'it ever so nbble, has the power ofqhspiring young minds with ~the s~me enthusiasm that is evoked by the simplest truths of our ¯ Catholic 'faith. But there is more than inspirational value to this change of atti-tudd. As soon as a definite apostolic turn is given to elocution sub-ject matter ~nd technique, oppdrtunities will be found without even lookir~g'for them top~ut the ammumnon°t9 immediate use. In many ci'ti~'s tl~er°~ are forensic l~a.gues with mixed Catholic and non- Cat.holic membership. Ih such places Catholic studenf's have all the room they.w.ant to give express.ion to the ideals and principles of the religion th,ey profess/ This does not mean that every elocution, piece ips9 fdcto becomes a vehicle for Catholic propaganda: but it does ,mean that eyeiy speech cariies.enough of the substance of the faith to impress the ndn-Catholic 'audience that, "Here i~ something dif-fe'rdnt. It's good:and it's Catholic: ': " 3~V'hen,. for ek.ample, a young man gives 'a,n' oratorical piece like "T'h~ Easter 'Message from Co'r~regidor~'' even the most blas~ are bound to li~te~n sy~mpatbetica, lly. He quotes, the words of the an-nouncer of the Voice ~'o~ Freedom thht" fateful Easter morning of 1942: "People of the Philippines, .do nbt despair. Your deliverance is near at hand. Likh your Mas~t~r before°':you, you have been betrayed into the hands of your enemies. Like your Lord and Mas-~ tel you have been beaten and tortured and put to death. But like Him tOO, you will soon rise again to a glory and a peace that you have never known before. People of the Philippines do not despair." When words like that are spoken,, it doesn't take a Catholic or iven a Christian to appreciate the depth of human, feeling hidden behind ihem. But the important thing for our purpose is that they were_ originally spoken-by a devout Catholic, Colonel Romulo, aide to the late President Quezon of the Philippines. And they carry the sub- 320 September, 1946 PREPARING LAY APosTLES stance of a penetrating truth: the rederfiption of mankind by the death of Christ on the, Cross. So much for elocution as a suitable medium for cultivating~the apostolic spirii in our students by .giving them first hand oppor-tunities of'putting this spirit into practice. Another means'that has _been found even more effective in this respect is interscholastic debating. As an outlet for Catholic ~Action, debating is~only just beginning to be exploite~d .by our teaches of forensics. A case in point is the State of Michigan where out of two hundred high schools in the'forensic league all but five or so are secular institu-tions. .This argues to~ an oversight somewhere. Either the p~blic schools are~ misguided in the emphasis they place on" forensics, or we Catholics have not yet come to realize that there are more than~ edu-cational possibilities hidden in this field. It may sound romantic to talk about high school teensters,getting up in a ~ublic forum to defend some elemental troth like the charity of Christ in a godless world. But they doit. The aildience may be indifferent or unfriendly, and there is always the clever witticism to take from "the gentleman on the opposition." This offers no diffi-culty at all. The teensters enjoy the smell of battle aiid soon develop a cast of mind that practically nullifies a purely secular approach to'any stibject, political, social, or economic. Many examples could be given to illustrate the effectiveness of debating as an entree into the lay apostolate. On one occasion, during a city wide tournament, twelve of our debaters were defending Pope Pius XII's Five-Point Plan for World peace.Their opponents were eight ottier groups of high school students from as many dif-ferent secular institutions. One of the coaches openly criticized the program our young men were following: "Cut out that religion stuff. R~ligion is all right iri church, but it has no place on a debate platform. If~you want to get any decision from the judges, you'd better change your method of argument. ,You'll never win a debate that"way." Well, he was wrong; because the young Ciceros not only Won a debate but ran off'with the whole.tournament. Another timei~while debating with an out-of-town fsublic school on thd'question of a federal world government, the,first speaker on the affirmative did not defend.the affirmative. He brok~ into a tirade that lasted ten minutes, defending a world order in ~vhicb the Providence of God woul~l' not"be recognized. "What has .religion got us any-way~ Nothing but wars 'and misery: After all, we are masters of 321 JOHN A. HARDON Reoieto for Religious our own destiny. Let us work out a plan of world peace in which every notion of a power higher than man's will be scuttled." This might have beeh ranting nonsense, except that the poor fellow was dead serious about what hewas saying. The logical thing for our first speaker to do was to forget all about his own prepared talk 'and answer the blasphemy. So be spent his ten minutes of allbted time defending, not a substitute for a world government, but the recog-nition of Almighty God in the world which He created. Incidentally there is a peculiar significance in th~ choice of sub-jects or resolutions for. interscholastic debates. Individual schools do not choose a subject but the choice is made for them, apparentl~, through the National Educational Association and according to the recommendation of the Federal Government. Only one subject is given out each" year. It is the same for all the high schools and col- . leges throughout the country, As a matter of policy, the annual debate topic is being discussed in Congress during the very time that student polemists are threshing out the subject among themselves. All of th~s is part of our democratic system, whereby national issues are first ~ired among thg people before official action is taken upon ¯ them by the government. This emphasizes the.importance of our Catholic schools' . taking advantage of their democratic privilege to instil some of the principles of Christ into the minds and hearts of those who hardly know Him. And along with this positive indoc-trination of others, the students are training themselves to become what the late Holy Father made bold to call, "Bearers of light, helpers of the Holy Spirit, auxiliary light-armed soldiers of the Church."' A word is in place on the ranks from which the young men' were drawn for this basic training in the apostolate that we have reviewed. They were Sodalists, actively interested in promotiiag the apostolic aims of the Sodality. Many of them were members of a local Catholic Action cell where they received the backgroflnd and inspiration necessary to appear in public as youthful exponents of their faith. It took courage to do what they did; but the courage was never lacking. Sometimes their efforts were repaid with the high compliment of imitation. They might come back to a return engagement in debate and listen to the opposition non-Catholic, of course defending -the Pope as" an authority in politics and the social sciences. , An objection might be raised that it is time enough to introduce Catholic students inl~o the lay apostolate after they have finished their 322 September, 1946 PREPARING LAY APOSTLES formal studies. Then too there is the question whether the secular clergy and not religious are to take the 15fimar~r'.and~almost exclusive initiative in the promotion of Catholic Action. To both these ques-tions we have the authoritative answer of Plus XI in~his Apostolic Letter to the Brazilian hierarchy, October 27, 1935. His words deserve to be me, moriz, ed ~by every religious who is sincerely interested in th~ apostolate of the laity: "Surely the most p6werful and far-flung support o~f Catl~oli~ Action may be expected from the numerous religious institutes of men and vi'omen wl~ich have already rendered such signal services to the'Church . Religiofis men and women will he!p'Catholic Action in.~a very.spec!al way if they strive to prepare for it from their earF, est years the boys and girls whom they have in their schools and academies. These young people should at first be g~ntlV drawn to a desire for the apostolate, and then should be steadily ~nd earnestly urged to join the associations of Catholic. Action; and ,where such associations are wanting, they should be promoted by the religibus tb~rnselt~. Surely there is no bettdr way and no better opportunity for training young people in Catholic Actioia, than those which exist in schobls and cblleges.~' -One las~"pbint needs to be cleared up. The objection might be made that our Catholic schools already have as many organizations as the student body and teachers can manage. More additions would be useless'~here they would not be a positive.burden. In any case, there is no rriore room for organizations of a spe.cifically apostolic, cl'iar-acter. It will have been noticed in the present review of "apostolized'" speech activities that they were first and foremost,a sodality activity, o In other words, promoting the work of the apostolate among our students can and in most cases.should be the immediate work of school organizations which are riot. 0penly and avowedly "Catholic Actionist." Pius XI is explicit on this point, in the letter which he wrote to the Hierarchy of Brazil iff 1935. Touching this very ques-tion, he says: "Thus also the associations and institutions which have for their purpose the spread of piety, the teaching of Christian doc-trine, or any other form of social apos~01ate, will bec6me ai~xiliary forces of Catholic Action. and without departing in any way from each one's peculiar sphere, will happily secure that concord and har-mony, that organized co-operation, and that mutual understanding, which We have ceaselessly recommended." 323 . ur Lady s Rosary . A Adam C.-ElliS, S.J:,, ". "- ~ . . ~ " ~C~6BER is. t~e', month~ p~ OuE Lady'~ Rbs~ry. Throfighout ~the Catholic ~world pri~st~,,-,.rgligio~s~ and men and~women of,every walk of life vie with ~ach other to,do honor to ~Our Lady by the daily recitation "0f the ros?ry? R may be hel~ful-~as-a ~timulant ~'for 6u~ ~evo~i6n,~'t6~re~all the 6rigin, hature; and onditi6ns of this p0pp[ar devotion. , . .~ ~ . . :, ~- ° ~" " " o The Our Father ¯ T~e most . precl,o, us of~fie 3ral pr ~r~ ~n t~ tr~as~r tb~.~Ch~r~h ,is un~oubt~)y th~ Q6r.Fath~T. ~Cbri~t Him; s~l~ taught this prayer to His,disciples when they ~arn~stly as~d~Hxm.: ;Eord~.;~acb' 6s to pray,~ ~wn as ~ohn~likd~is~ ta~t,~i~ 'disqi~l~s" (U~k~ 1'i": '1~) :~" '~nd'th~'~t~Xv%~ ~or~-s Prayer as g~wn to.us by Saint Matthew m hxs Gos-pel'S( 6:9-.13) became the daffy prayer ~, tile first.Chns~ fiansz.as, w~ll,as,~o~ alhth~ ~a.kh~Ldo~-,.through ,th~ ~n~ "" I( We f&~ll'that :6~"~t3 the~l~ttdr half'of ~ntur~, ~h~ ~h~ art ot p~ntmg. ~s ~nwnt~d, ~only th~ nob~l~t~ could r~ad.an~ wnt~, a r~. not surprised; to l~arn that,th~ p~i~cip~! d~vo~ion~ ~a~th~ul~ at~.larg~was.,th~ r~p~tition~o~ th~ Ofir Fath~i~ th~ 9~ghth c~ntury, th~ p~mt~nt~als, .or books.r~lat~ng t0 p~mt~nts, pr~scr~o~d, var~ous p~nanc~s ot tw~nty,,,ntty, o~ mor~ Pat~r.Nost~rs. ~gain, in th~ cours~ o~ th~ early.c~n-turi~ s o~"t~ ~Middl~ ~.g~s~ w~n-.th~ lay 'brothers "in r~ligious orders b~cam~ .distinct ~mm'~h~ choir mofiks~ th~ ~orm~r, who w~r~ illiterate, r~cit~d on~ hundred and fifty 324 OUR LADY'S ROSARY ISater Nosters in~plhce'ofithe one.hundred hiid fi~ty psalms which were recited .in choir.as part ,of" the~DixCine O~ce. O~rig'in' and U~e of P~r B~ads use of One and the same prayer spon-a methqd Q( counting ~the number of p~ayers recited. At ~st ~e count was kept o~ one's fi~- gers. Then ~he Fathers of t~e ,Desert, following t~e example of St. Anthony, t~e F~rst Hermit, collected a.num-ber of pebbles and laid,them aside one by one as they recited t~e~r prayers. In the West th~ uAe of pebbles was soon replaced by gg~ins of bernes, seeds, bone,~or ~ood, ~attache~ to ~ach other by a cord. In~.the course of time such a string~of grains o~ beads was c~lled a paterno~ter~since it~ .~as. used ~o~t freq~e~ptly~ for the. recitation o~,,the Our Fath~r.~ .In ~be thirteenth centut~ the ~anufac~urers o~_ these,, articles. ,. ~ere known as paternosterersi and, almost everyx~here~ i~, Europe ~hey formed a recognized craft guild of consider. hble importante. P~,t3rnoster-Row in ~ondon preserves the memory of the strest in which th~.ngl~sh craft-fellows ~o~regated. That such beads ~ere in use in the ele~en~lf century is evident fr~ M~lmesbur~-who relates that the Countess Godiva bf Covehtry (circa 1075) left by w~l(to the ~statue of a certain_ monastery."the,,ci[clet 0f precious stones wfiich she. had.threaded on a cord in orderthat fin-gering them qne aft~ a~other Sh~ might count-tier, prayers exactly.'~ .The ._~ilit~rY ~orders, ~otably the. ~nights Templar of St. 3ohn, adopted the paternoster beads as p~art ~f.~he,e~uip~ent of hY members., The~e paternoster beads were also.,used ~by ,the laity in general and were,openly, carried as a s~gn~ of penance,, espdcia~ly bY b~nds of pilgrims who v~sited the ,shrines,~ churches, ~and other holy places, of Rome in procession: ~ : -" ~ 325 ADAM C. ELLIS Review/:or Religious "'Ave Maria" _or "'Hail Mary'" The .Hail Mary owes its'origin to certain pious persons who joined the words of the Angel Gabriel" with those of St. Elizabeth to form a greeti~ng and salutation in honor of the Mother of Christ, hence the name-"Angelic Salutation." It was .repeated many times in succession, accompanied by genuflections or some other.external acts of reverence. Thus a contemporary biographer of St. Albert (died 1140). tells us: "A hundred times a day he bent his knees, and fifty times he prostrated himself raising his body again by his fingers and toes, while he repeated at every genuflection: 'Hail Mary, full of grace, the Lord is with thee, blessed art thou amongst women, and blessed is the fruit of thy womb.' " This form constituted the whole of the Hail Mary as then said, and"the fact that all the. words are set down in this biography seems to imply that the formula had not yet become universally familiar. But by the end of the' twelfth century it was in common use in many parts~ of Europe. Pope Urban IV, who died in 1264, granted an indul-genc~ to all Who added the'words ",Iesus Christ, Amen" to the form quoted above. It was in this form that~Thomas ~ Kempis recited the Hail Mary at the ~nd of the thirteenth cent.ury. The second half of the Hail Mary begins to appear in the fourteenth and fifteenth centuries. St. gernardine of Siena added to the Angelic Salutation the words: "Holy Mary, Mother of God, pray for us.sinners;" And at the end of the fifteenth century, in an ordinance of the Arch-bishop of Mayence (1493) the longer formula, "Holy Mary, Mother of God, pray for us now and at the hour of our death, Amen" appears, perhaps for the first time. The complete form of the Hail Mary, as we have it .today, was included in the various breviaries used by the diocesan 326 September, 1946 OUR LADY'S ROSARY i~lergy and by the religious orders, though occasional ~light variations in form are found. This complete form is recommended b~r the Roman Catechism in 1566. It received final approval when Pope St. Pius V, in'the new edition of the Roman Breviary promulgated by him in 1568, ordered it to be recited by .all priests before the singl~ canonical hours, together with the Pater Noster. From tl~e breviary the complete form passed into general use ~amo~g the faith-ful. Rosary Beads As we saw above, the paternoster beads were used by the laity as a substitute for the Divine Office, and for this reason were sometimes called "the psalter of the laity." At the 'beginning bf the eleventh century, the custom was introduced of adding the angelic salutation to the Our Father, and for a while some of the clergy, religioias, and laity recited 50 or 150 Pater~ and Aves on the paternoster beads. Gradually thecustom of reciting 50 or 150 Aves only on the beads came into vogue, and it was probably this form of prayer which was popularized by St. Dominic at the suggestion of the Blessed Virgin. 'The Roman Breviary, in the fourth lesson for the Feast of the Most Holy Rosary, tells us ~hat when the Albigensian heresy was devastating the country of Toulouse, St. Dominic earnestly besought the help of Our Lady and Was instructed by her (so tradition asserts) to preach the Rosary among the people as an antidote to heres.y and sin. That this form of devotion was known before the birth of St. Dominic is clear especially from two sources. The first is the so-called "Mary-legends" according to one of wl~ich, ~ating bac~k to the early twelfth century, a client of Our Lady who had been wont to recite one hundred and fifty Ayes every day was bidden by her to say only fifty, but more slowly. Again 327 ADAM C. ELLIS Review for,Relioious iu~,the~'~twelfth centur¢ this form bf prayer was, recom-mended' to, the.: anchoresses of~ England-and practiced by. them, as aplSearg from the ancient Ancren Riwte which was written~abotit the middle of' the ~tw.elfth centur~y. In th~ course of:time the one.hundred and fifty beads ivhich the Ave'Maria was recited b~came distribute'd into decades~ or' seriesof ten, separated from one another by a large,grain or bead on which is r~cited a Pater Noster; and by the middle of th~ fourteenth century the use of such beads had spread rapidly. In 1469 Sixtus IV called these beads the "Psalter of Our Lady" and encouraged their u~e by grantin~ ind~ulgences. The° religious orders, notably,~, the Benedi~ctines, .t_he Cartbusians, and the.Dominicans, retaingd the use bf the b~ads made u~'~f fifteen dedades. But amon~th~e,faithful-the, o smaller beads o of. five decades., became;., popular., in¯ .~ the~ c~ourse ot~time~ The Gloria Patti .wa.s-added to each decade 9~n1~i in,~ the seventeentfi ce~n.tu~ry in Italy. The custorfi o~ reciting; the Creed, a Pater, and .three Aves a! the:beg!nnil~g of ther~s~ary, i~ l~udai~ie'; but it . is . not necessary for the g~ining of~any ind~t~lgences. It originated in Germany,'-fir~t by ~cii~i.n~ ,the Creed at the beginning, ~o ,w,bich was,a.d~$,d, about the middle Of tiae 18tb century~, a~ Pa~ter,,, and three Ayes for an increase in the three t.h,eo, logical~ virtues.-- faith, ho~e,o.~and cha~rity. In Spain a~d in Spanish spea.king countries, the Creed, Pater, and three Ayes are addedat the end of the rosary. Meditation on the. Mysteries ,.~ . Thus in its external form the rosary was established little by little; and' it was a long time bef0re.,the custom ~f meditating on the mysteries of Our Lord's ~ind Our Lady's' li~res.while saying it,was introduced.~ At the beginning of the fifteenth century a Carthusian of Wreqes is-~aid to have 328 September; 1946 OUR LADY'S ROSARY "first introduced into '~the: rosary a~mystery of. the-lives~of Jesus and Ma.ry by ~a, ddi~g,~some w~ord~ to the end of the first half .of the° Hail,Mar~;~. His "ros~ar~ ~as composed of-fifty, Ayes arid fifty mysteries. ~ ~s still done ~n Germany and other ~arts of the world today, the firstAve ran thus: ,.-Ha~l Mary, .full of .grace, the Lord.~s w th t~ee, blesped ar~ thou amongst )vomen, ~ndblessed ~s the frmtof thy womb, Jesus, whom, by the message qf.-the angel,~thou didst c0h: ce,ve of the Holy G~ost, Amen. Th~s innovation met w~th a hearty reception and was taken up by the faithful. ~]an ~ Rupe,,~ famous D6~nlcan preacher, CbmpoSed one hun-dr~ d ~and fif[y phrases one for each of t~e Aves of Mary s Psalter. Later these numerous mysteries were lessensd, an~ a~gq~ the year 1500 the Carthus~an Landsberger guid~.f0r the ~i~a~ion 0f ~e~r o~sary (of fi~e dec~des)' "in Wfii'ch ~e.ass~g;s'~o the:first ~tW~'decade~ the m~ditation on the p~incipal joys'6f'Mhry; for ~h~ twd fol10wing, the" meditafion on the sorrows of Jesus and.Mary; and f6r the fifth, ~he mgs~e~es of'the glor~ficatioff'~f Jesus and Mary. In 1483 we find a~'r~sary bf fifteen mYsterieso~ly~ne mys~er~6; ~each decade;" Und they c0rr~spond with Our present m~gtefies ~xqe~t for the ~last, which was the L~st Judgment instead of the Coronation of Our Lady. In~ 152:1 the D6minican, Albert 0~ Ca~tell6,:phbli'~hed ~in Italy his book 6nth~ Ro~afy.~ In it~he' indicates ,various ~ethods'6f'- saying ~he rosary; among others, that of the fifteeff teries in actual ~use today . ~ ~ In his Bu.lk0f September 17,: 1569, P0~e St.~Piu~°V for~he'first ~ti~e 0~ei~l~y~efitions meditad0n on tbe~li~s of~Chrb~'"~fi~::gf H~s M0~ber t0'~ be .m~de ~whiie :s~.in~.~th~ rosary-. ~:H~ states'.~Bat~.~p to tfiht't~me~med~tat~bn~on mysteries was not required; but he also a~rms tha~ from that d~y on'fifteen':Pat~rs ~with,dne hundred and fifty Ayes, distribute~,~in decades~ with ~editation on.rthefifteeh ~mys~ _ 329 ADAM C. ELLIS ~ Review for Religious teries, constitutes the rosary essentially. Indulgences for Saying the Rosary " The Official Collection of Indulgences, ,published by the Holy See in 1938 under the title Preces et Pia Opera lists the following indulgences which may be gained by .any Catholic who recites the rosary, even though the beads used are not blessed (No. 360) : 1. An indulgence of five years whenever a third part (five~decades) of the rosary is recited with devotion; " 2. An indulgence of ten years, once a day, whenever a third part of the rosary is recited in company with others, whether in public or in private; also a plenary indulgence on the last Sunday of each month, provided the rosary has been recited in common at least three times in any of the preceding:weeks; confession, Co~munion,'and a visit to a church or public oratory is also required to gain this plenary indulgence. 3. A plenary in~tulgence, on condition of confession and Communion, is granted to those who piously recite .a third part of the rosary in the presence of the Blessed Sacra-ment, either publicly exposed, or at least reserved in the tabernacle. Note one: The decades may be separated, provided the entire rosary (five or fifteen decades) is'said on one and the same day. Note tu~o: If, while reciting the rosary, the faithful are wont to use a pair of beads blessed by a. priest of the Order of, Preachers, or some "other priest having special faculties, they may gain other indulgences in addition t6 those enum-erated above. Thus far the Official Collection of Indul-gences. It may be well to mention here that ordinarily one can-not gain various indulgences attached.to one and the same 330 September, "1946 OUR LADY'S RO~ARY pious worl~ unless.one repeats the pious work for each indulgence. However, in virtue of a privilege granted by Pius X on Jurie 12, 1907, one may gain not only"the indul2 gences mentioned above but also the Dominican and the Crosier indulgences provided the beads have been specially blessed for these latter; and on February 17, 1922, Pius XI included .the Apostolic Indulgences. Jt would take too long to enumerate all the indulgences which may be attac.hed to rosaries by way of a special bles-sing. Suffice it tc; say here that the Dominican blessing enables one to gain 100 days indulgence for each Pater and Ave;j the Crosier indulgence, 500 days on. each bead. Conditions for Gaining Indulgences To gain the indulgences one must observe the following conditions: 1. One must hold a rosary in one's hand and tell the beads as the Aves are recited. This is the general rule. How-ever, if two or more persons recite the rosary in common, it suffices that one of them use a rosary to guide the recitation; but the others must abstain from all external occupation which would imp~d~ interior recollection and unite them-selves with him who holds the beads (S. Congregation of Indulgences, January 22, 1858). This condition was explained and mitigated by another rescript of the same S. Congregation (November 13, 1893) to mean that the faithful need not abstain from certain small manual tasks which are sometimes performed in .religious h6uses during the common recitation of the rosary, but only from those occupations which impede interior recollection. Even in the case of a person saying,his rosary by him-self, Pope Pius XI (October 20, 1933) "deigned to grant that, whenever either manual labor or some reasonable cause prevents the faithful from carrying in their hands 331 ADAM C. ELLIS Reoieto.[or Religio~s according to prescription, either, tbe-rosary,.'or,a crucifix which has been" blessed for the" g~iining of indulgences of l~he~.r6saby or,of ,the ~,rYray of the C, ross, the faithful ma'y gain. those indulge/aces, provided that, -during~ the recitation of the prayers in ttuestion., they carry with them in,any way,the rosary or crucifix " 2. One must m'editate On the mysteries of the rosary. This was first prescribed by Pope St. Pitis V, and was con-firmed by'Pope" Leo XIII in his Bull,on"theMost Holy Rosar~r (No. xiii). Hence. as Leo XIII~poiiated out, one must meditate on the mysteries prescribed,, not on other great truths, for example the four last things. Nor is, it sufficient to meditate on only one or two of these mysteries during the ~ecitation'of the entire ro~ary. " 'In order to'facilitate the m~ditati0n"on the mysti~ries of the rosary, the custom has been introduced of ari'/it3uncing bfiefl~r, eitlSer .bef~r~ eacl5 ide~ade; or~ after the' firsv?part of each Hail Ma~y/the-mystery of tha( decade.~ Both methods aye usi~ful; 15iat'.'. fleitlSer :is- fiecessi~ty ~f6r gaining~the indul-geflces, ~in~eito~uffices to¯ c6flsider ~h~ m-~csteries ~mentally. " Pope Be~aedict'X~I:I in hi~s coh~ti~ution Pret[osius, ~May 26, .1 727, de~lares that. Simple,pers0ns wtio are incapable m~ditati.rig off the myste'ries 'fiaay conthrit themsel~c~s with the deVou[ reditation of the ro,sa~y in. °order to giin th~ indtilg~rice's: he "adds, nevertheless," hi~-ex'p~ess ffish°th~tt such persons ~raduaily~fbrm the habit.,of meditatin'~ on hol~ mys~fies?ofoOur Redee~e~r-and6f His Bl~sed M6ther'~ con formably" to the purigose of the rosary." In: practice,' a - sincere effort t6 meditate; even if the effort fails, suffices ~ to gain the indulgences." For~ the gainiiig ~f~th~ Crosier/and Brigittine. indulgences, meditation on the mysteries is not required. . " ¯. -Among' the faithful who ,recite the ,rosary of five decades every day the custom has established itself of medi- 332 September, 1946 OUR LADY'S ROSARY tating°ori the joyous mysteries on Monday and Thursday; oh the sorrowful rdysteries on Tuesday and Friday; and'on the .glorious. mysteries on Sunday, Wednesday and Satur-. day. During!Advent one ,may meditate on the joyful mys-teries on Sunday~, -during Lent on the sorrowful mysteries~ 3. Thebeads Used must be of solid material,, not easily broken, Otherwise indulgence~ may not be attached to them. Glass or crystal beads may be used, provided they are solid an~d compact, (S.~ Apostolic Penitentiary, ,December 21, 1925)" The indul~gCriees'~ are~attached to the grains or beads, not to the' cbainor cord which-holds them together. Hence a pair of beads may be restrung in any order without losing 4ts indulgences. A broken bead or two may replaced from-time to time, since the indulgences are put on the beads of the rosary as a whole. Our Lad~t'~s Garland of Roses The word "rosary" means a garland, wreath, or crown of roses. An early legend, which spread over all of Europe and penetrated even-to Abyssinia, connects this name with a story of Our Lady who was seen to take rosebuds from the lips~.of~ a youpg monk, when he was reciting Hail Marys, a~nd to weave them into a garland which she placed uppn her head. Devo.ut clients of Mary like to think that the five joyful mysteries constitute a garlan.d of white roses for Our Lady, the ~sorrowful mysterigs .a garland of °red roses, and the .glorigus mys.t.eri~es a garland o~ g.olden roses. -, .LAndiOur ,Lad~r ha~ show.nher"appreciation.of this devo-tion ~y giv. ing,o,her:protection,to.the Church, at large as well as to~individual memb~rs.ino:every walk¯ of ,life. ,.P0pe St: Plus V-~.~ttributed to her. inter~ession~.~gained, through the public recitation-6f th~ rbsary, by rhembers~of the.~R-osary Confraternity marching through~th,e:,streets ofoRome;, the gte~at~,v, ictory~.0f~ the ~Chtistian forces ino:,the" Battle of ADAM C. ELLIS Review for Religious Lepanto. This battle, in" which~the sea power of the Turks was brok'~n forever, was fought on the first Sunday in October, 1571. In gratitude for the victory, ,,the Pope ordered that a CommemOration" of the Rosary be made each, year on that day. Two years later, Pope Gregory XIII, at tl-ie request 0f the Dom_inican Order, allowed the ,feast to be celebrated in all churches which possessed an altar dedicated to the Hol.y Rosary. Similarly, after the great land victory over the Turks at Temesvar in Hungary on August 5, 1716 (the feast of Our Lady Of the Snows),.,Pope Clement XI ordered that the feast of-the Most Holy Rosary should be celebrated throughout the Universal Church, since the v.ictory was attributed to °the recitation of the rosary by the whole Christian world, as ordered by the Pope, to invoke Our Lady's aid in behalf of the Christian troops. When Our Lady'appeared to Bernadette at Lourdes and -to the children at Fatima. it was not by chance°that she held a rosary in her hands and taught them to recite it, telling them that she would bring peace to the world and to the hearts of herdevout clients'if they practiced the"de~cotion of the.Rosary. Today the Turks are no longer besieging the ramparts of Christendom, but a more "formidable enemy, modern pagan civilization, is threatening not only the Church at large but the hearts of her individual chil-" dren. Hence the need of an enthusiastic revival of the devotion of Our Lady's Rosary. Religious can contribute their share to this revival by renewing their fervor in regard to this devotion, and by inspiring their charges, young and old, with a love for Our Lady's Rosary., To attain this objective, it is .suggested that the various letters' and writings of Pope Leo,XHI on the devotion to the Rosary be read in the refectory or for spiritual reading during the month of October. They have been collected and edited in 334 Septernb~er, 19 4 6 QUESTIONS AND ANSWERS English by "Father William Raymond Isawlor, O.P., and are pub!isB~d by tile St.~Anthony Guild Press, Pate~s~on, New 3erse~: Tile beautiful ,encyclical letter of Pope Plus XI on the Rosa'r~y "i-nay also be-read with p~r0fi~.,~ It appeared in-an English translation ifi the Catholic Mind, November 8.1-9 3 7., -.Our eonsfitutiohs state: "In order that~ they be valid, confessions of ~ellcjious women mus:f be made in a place lawfully deslcjnated for the con-fesslons of women.~'- What. is the superior to do if the retreat master orders that all the confessions will ~be heard in the parlor because of the long hours required for.the many retreatanfs? The statement quoted from your constitutions refers only ~to con~. fessions of religious women made to a priest who has no special faculties to hear the confessions~of religious women. The retreat master, like the.ordinary?and extraordinary confessor, u.sually receives special faculties from the l~ocal ordinary to hear the confessions of the community to which he is to give the'retreat. Hence, as ~ar as the place is concerned, he can hear these confessions oalidly anywhere, But for the licitness of such confessions the place must be one approved for hearing the confessions of women._ Ordinarily the superior may take it for grarfted that the retreat master has obtained permission from the local ordinary to hear con-fessions in the-parlgr during the retreat if he states that he will hear the confessions there.- Should any serious doubts arise abbut the matter, they should be referred to the local ordinary. °3' May a reh~;ous put aside moriey, in the keepin~j of the superior tO be used as an offerln~ for a~ number of Masses to be sa~d' for her May the~ s6perlor general allow Sisters who have received money gifts on the occasion" of their golden jubilee to deposit a part of the money ¯ received with')he tre~surer°inrorder'~o ha\~e Masses sald-for themselves 335 QUESTIONS 'AND ANSWER~ ~S~ Review [or Religio~ aff_er, their death? M~n9 of these Sisters~ rio ,Ionggr~ h.age reJaf~lve~ who would,.;n a!l char!fy, haye the Masses said ~r fh~ [~pose of their .souls. ~ @hough received from different sources, we ~ve, put these two questions t0g~thel, ~i~ce they deal wi~h ~e k~mg~-'~u~jd~t: They differ only with r~gard to 'the source from ~hich the money for the stipend is ~derivgd. ~ ~ To begin wiih: unless the constitutions forbid it, a religious superior may allow her subjects to use small gifts for Mass stipends without any violation of poverty. If this can be done during life, there seems to be no reason why such sums may not be put aside for a fium~er of Masses to be said after the Sister's'death. The prescriptions o~ common life must alsb be considered in this matter. This requires that ordinarily the same permission would be granted tb all the Sisters;u~der the same dircumstances. For instance, it shofild ~e undelstoodthat this permission Wo~Id~ be~ given~tb all jubilarians. Or; ~n ohr first case,-t~e shperior must~be willing t0 allo~,all ~the~istdrs to set aside small~giftsuntil the required amount is reached. All such sums,df'm0ney, should be:d~posited with the treasurer"acCording tb~the regulations of the superior: " ~0~, ~'ln."Qhesqlons and~Answers'~ ~fo~ March, 1946, you slated~ thaf reli- ~i0us I;~;ng~ ih commdnffy ~ay ~alny~he lfidulgen~es ~f the ~onfrafernff~ of the~MosfHolyr Rog~ry, includlng~the tofies quofies~ indul~enc6~ on~ Rosa~ Sunday, by making the visits in thei~ o~n ¢bmmuhffy Chapel, provided they are enr611ed in ~the ~onfr~t~rnit~. ~hls dbes not seem fo bein-con, formity with a reply given by the~Sacre8 Penffegfiary on ~ovember 20, 1923. Please explaln. " ":~ Whe~ the ~nswer referred to above was written, it was based upo~ a,b~ief- dat~ August 1 1, 1871, and on a~escript d~ed~February 8, 1874, gr~ntin~ the privilege mentioned, to me~bers~ of the'Con-fraternity of the Most Holy Rosary. ~ We: mus~, co-bless-that the answer of the Sacred Penitentiary given on November 20, ]92~ escaped us. ~hile it is true that [~is was a private answer which ~as never publishe~ in th~ ~cta ~postoffcae Sedis, the o~cial organ of.the Holy Se~, still from the nature of the reply we most ~oncIude that i~ -is binding upon all, not merely upon those to whom the answer~ was given. This is ~the opinion of Roman canonists who ~ere con-sulted. " For'the benefit of our reade~K, w~ give ~the question propose~ to the Sacred Penitentiary in 1923, together with its teply: 336 September, 1946 .~ Q~/ESTIONS AND ANSWERS "Question: Do ~vords bf such a general import (that is, the privilege of gaining albindulgences in one's owri chapel) ,apply also to the toties quoties indulgence which may be gained on" the feast of the Most Holy-Rosary~ by,thosE visiting 'an image of the Blessed Virgin Mary exposed in a.church in-which the confraternity is canonically erected ? Reply: In the -negative." However; thos~ religious mentione~d above who are impeded from visiting such a church (becauseoof physical or moral disability) may ask ,their confessor ~to commute ~,the required visit to the specified church ,so that"they;-may- make the visit in.their own chapel (Code Commission, 3an. 19/1940): -, ¯ Has ~e Church granted ,an indulgence to relicjious for'the renew.al" of their, vows after receiving Holy Communion? +,Yes.~ On-Ai6ril !0, 1937~; the. Sacred Penitentia.ry granted~ an indulgence of-three years ~'to religious ~ of any order or congregation "who,. after offering the0H61y Sacrifice of the M~ss or after receiv!ng H61WCommunion privately renew their vows at least with a contrite heart." (Preces et Pia Opera, n. 695). ~33~ . May the profits from the sale of stationery and religious articles in a convent school be used to help students who seem to have a religious vocation to finish their education and to provide them with a froi~sseau ~and money for the trip fo the novltlafe? In either case the profits do not revert to the religious community, but actually go back to the students, though not to all of them. St_ill, if the other students are informed that the profits will be u.sed for_ these purposes, and if they do not object, the practice seems to be' permissible;o ¯ - ¯ May the profits of a school store be used fo buy refeE~nce book's, duplicat=ors;'and the like for the use of teachers in that school? May.they be ~pplled for correspondenc~ courses for the religious teacffers,~ especially when.the salaries'of these teachers are, not sufficient tO cover .the expenses for s~ch courses? (There i~ question here only of schools~ that. are :not owned .by rife Sisters themselves, but are'owned by~ the p,~rlsh or the dlo-cese. o ' ° 337 QUESTIONS AND ANSWERS Reoieto for Religious Since reference books, duplicators, and the lik'e are normal schbol equ'ipinent, they should be supplied to teachers by the school, and they remain the property of the school. Hence there can be no objection~(o using the profits of the school store for such items. Regarding the use of'such profits~to pay for correspondence courses for the religious t~achers, a distinction must be made. If these courses ate requi~ed by the,state law or by particular local circumstances to maintain the standing of,the religious teachers in the school in which they are now teaching, then the profits of the book store may be used for that purpose since such special courses may be regarded as a. part of the expense of running the school. By such use the profits are equivalently returned to the pupils, inasmuch as their teachers are better prepared to serve them in the class room in conformity with local regulations. If, however, these courses are intended merely for the personal improvement of the individual religious, the profits~of the book store may not be used to pay. for them, since the religious congregation has the obligation to provide for .~uch'courses. We suppose that the religious teachers are receiving an adequate salary. If the salaries of the religious teachers are not adequate, and the pastor tells them to use the profits of the book store as a supplement to their salary, then such profits" may be used by the religious teachers for any purpose whatsoever since they constitute a part of their salary. ~35~ Can ordinary flour, that is, the same kind of flour "l'ha'l" is used for baking bread, be used for making altar breads? What percent of wheat stated by the company would be valid for this purpose? How can one determine whether this flour has the ricjht amount of Whea~? The principles concerning valid and lawful matter for consecra-tion are found in dogmatic theology, canon law, and certain instruc-tions issued by the Holy See, p~irticularly an instruction issued by the Sacred Congregation of the Sacraments on March 26, 1929 (cf. AAS 21-'631; Canon Law Digest I, p. 353). From these sources we draw the following conclusions concerning the material, for making altar breads: 1. To be certainly valid and lawful material for consecration, altar breads must be made of pure wheat baked with water. 2. If another substance is mixed with the wheat to such an extent that bread made from the mixture would no longer be 338 September, 1946 QUESTIONS AND ANSWERS monly considere~d as wheat bread (for example, if the other substance would be of a quantity equa! to or greater than the wheat)-, this bread is.certainly not valid matter for consecration. 3': If another substance is~mixed with the wheat in a notable, .~hough .not an equal, quantit~,.'the br~ad is:to be ~considered~ dubious matter for consecration and is therefore not to b'e used. - 4. 'If only a slight quantity of some othe_r substance.is mixed with the wheat, the bread is.v.alid, but not lawful, matter for conse-o cration. ~. 5. Th£se who make altar breads should either make the flour themselves or should have some means of being sure that the. flour they procure is made of pure ~vheat.o ~- 6. Those who procure altar breads from others should take .appropriate means of knowing that the makers .of the altar breads are above suspicion and can safely certify that the altar bread~.are made of pure wheat. The foregoing are principles; and we can state them without \ hesitation. But we are hOt'equally prepared to answer the practical points brought;out by our correspondent. The editors have-fried to get some information concerning the contents of ordinary flour, but the information thus far obtained is too vague to serve as the basis for answering the questions. We shall continue to try to get reliable information; but it has occurred to us that in the meantime we might get much valuable information from some of our readers who make, altar breads. Hence, we should like to throw this question "open to the house." Can any of our readers supply us with helpful details concerning such points as the contents of ordinary flour and how to be sure one is getting pure wheat flour? Please send the informatign immediately, as we wish to publish it in our next number. '1646 Saint Isaac Josues Saint CRene ~oupil (164~2) Saint John l~alande 1946 339 THE MYSTERIES OF CHRISTIANITY~ ~ByM. ~J. Scheeben. Tr~nshted by Cyril ¥ollert.-S.J. ,, Pp. ix ~- ,834.,~ ~B. ,Herder, Book Company, It isn't often that~ comprehensive study of dogmatic theology appears in. the English l~inguage, arid much rareP still 'that such work addresses itself to the widest circles of the reading publ~ic, religious, lay, and secular. .,The work now appdaring in a crisp, moder~ English translation was first published in Germany in 1865, and was repeatedly~judged by stich competent seholars as Msgr. Martin Grabmann, Dora L. 3anss~ns, O.S.B.,~and-/~/. M:. Weiss':O.P., as (the Words are those of the last-named), '"'Ehe'rmost: origihal, profound and" brilliant work that recent [nineteenth century] theology has produced." " ~Time Yeas when °the very word th'eol6gical would deter all but tlid 15retlirdn of that ¢r~ft~°from reading, a work. Fortunately that da~r ~s~ passing: and the~non-theologians ~in ever'-greater numbers ar~ treatin~g themselves to the satisfying (and Sanctifying)." experience.' of learning m~,re about the doctrines ot~ theft faith.-~ The ~vieWer: orice encountered a" high-sch6~61~"gifl' ~eading~:athe'r' Ricl~i~by'~ tr~hslati6n of St, Thomas' Cor~tra Get, tiles., Oh being a~l~ed ho~ ~he liked it, she fe151ie~ v~iffi zest: "Oh, there's a lot~in it I don'toundefstand, but wh~t I, d6 ~n~/erstand, I really like!''~ In similar fashion readers of this,Scheeben w~ll find sections they will grasp.but vaguely, for mys-terids aremyster~e~ still .even to the theologically schooled; but they will gratefully go on tsoe'c't~io n"s thrilling ii~ their understandable depth and brilliance: ~ ~ -~ " It w, as the author's aimto deal directly 9nly with the most mys-terious phases of the Christian revelation, and to show how those great wellsprings of verity, when c6nsulted in succession, illumine and illustrate each other. He shows, for example, how the com-munication of the Divine Nature,in the proce_ssions of the Holy Trin-ity is the model, so to say, for the Incarriation of the Word, and how this communication projects the interior life'-streams of the Trinity into the external world of creation. -Man's-primordial integrity and original sanctity is seen to be the four~datio~i for the Godward devel-opment of created rational nature; but the awful drama of sin ("an ineffably great sin" as Augustine said) intervenes and leads in turn '- 340 BOOK REVIEWS~ to.~the detail~d)study of the ~r~atest revelation~ of all, Gbd~great pla.n of redeeming the slave by delFcering~up the Son.~of His love; in whom the.Fat~i~r ',~sees His own' image in a man" (p.~358). ~ ¯ ~_ ' The allur{ng presentation of redemption is straightway follbwed by its fullest realizatio.n,,the Holy, Eucharist. ¯ "Therefore the sig-nificance 'of the Eucharist comes to this;,- that the real union of.~.the Son of'God.with all men is ratified, completed, and sealed in it, a.nd that men are perfectly incorporated in'Him in,the most intimate, real. and substantial manner" (p: 482). " The section on the C~urch is a cogent handlin~ of that _now promin~.nt, doctrine of the Mystical Body, while that on .the_ Sacra-ments is focussed and~ sharpened by a~masterful essay on the. sacra, mental character, But such section-h~adings and short quotations do .s~cant ~ustice to the dept~h~ ar~d~: brilliance of the author's treatme, nr. This is a volume that will be gratefully received and pondered, for dt. enlarges our app~raisal of that pearl of.great price, ours since baptism,. our Catholic faith. I allow myself on~eomore sampling of the.styl~:i "The enlightened Christian need envy no one but ~th~ blessed in heax;enoon account of the ~ficidity, the depth, and the fullness of. their~ k~wledge.~But the same faith ~s that in which we a_~ticipate their. vision holds out to US ~he sure promise that its imperfections and_ obsc'urity will vanish if, ~ollowing its directions, we strive devotedly and persevering.ly.'to reach its divine object. Faith is the prophet within -~ur ~very spir~it, presaging t.he full unveiling of the mysteries oP God, the morning star o~ the da~i of eternity, the bread of.our child-hood in the kingdom of God, which rears us to the maturity of:.the wisdom of Christ" (p. 796.) GERALD ELLARD, S.,J. MAJ~OR TRENDS IN AMERICAN CHURCH HISTORY. By Francis X. Curran, S.J. Pp. xvili -]- 198. The America Press, New York, 1946. $2.so. Most readers of this REVIEW will be interested in Father Curran's sprightly volume, which might be described as a thumb-nail history° of Christianity in the United States. The author was interested in contrasting the steady "fi~suring" of the multiple non-Catholic sects with the continued expansion in our country of Catholic Chris-- tianity~ "Why has the Catholic Church in America the preeminent posii~ion it now holds? Could it have acquired strength, if it were unsuited to American conditions, if it were not as truly American as \it is Catholic?'" (pp. xiv, xv.) BOOK. REVIEWS Re

Issue 4.3 of the Review for Religious, 1945. ; MAy !'5, 1945"' ' ",, ris in rl÷|ncjs~ ampere " ~ ~v~ ~ '~ f~ -";~ ,~ ¯ 7ESUS CHEST IN ~THE WRITINGS OF R~MI~RE--.~" ~,7- '-~ "~ Dominic U~ger,.6.F.M~Cap: . ~. sMEDITATION, . BOOK~ , FOR MINOR~. ~S~MINAKIES Vo1. IV, No~ .3~ ~'/Publish~d 3~onthl¢; Jan~arg, Mar~h,'Mag July'September~and No~ember a~ ~h~ Cdlieg~iPres~ 606 H~ms~n Street, T~peka K~ns~s ~b~ St. Mar7 s College St. M~gs w~th ecclesiastical approbatton. Entered as~second class matter-Januar~ 15 1942 . at thvPost O~ce Topeka Kansas underthe act of ~arch 3+ 1879~' ~'~ *~ . ?"Edit0rih1.Board: Adam C. Ellis, S.J., G. Au~usfifie Ellaid,. S.J., Getaid"Kelly, S J.~: Editorial-Secretary. Alfred F. Scfine~der S J ~ . : Coplright 19~ b7 Adam,C. Ellis: permission is hereb7 grantld for quotations 3"~" of reasonableTl¢ngth,, provided due credit, ,be given this review" and the' author. -("Subscription price: 2 'dollars a,year . ,? . . ~ " ~ ~rmte~ m.U.S;t~; .- ~ . . J' / 89)~.~, ~' Our deification is as certain ds the dogma of the divinity ~;, . bf Christ/of which it is the complement. oit is novmereiy "for itself-that ~l~e:'holy Hiamanity of Jesu.s" has ~e~ei~;ed, tfie ,,_ ~f-ul:nessof the di~Jinity through the personal union with the °~.~ -Wbrd,, bu~ als0.to make all humanity divine b~ granting'a :ihareiof Hii plenitude to all whowish to receige, His ~' ~ 'muni~tion. ~ Wh.en God ~redestined His own Son to be the :i'~7 ._ ¯ S0~a 0[ l~a~ry, "He p~e ~destined us t,o become His ~ad0pfed:sons ,b~y' union~with His onb/-begotten Son. (Ephes!gns~l:5). In becoming incarnate the" W;~d "of Gbd communk~(ed ¯ ~H.is di~iinity inca very personal manner to one soul and one ~ ,body in Christ. But his limitless love, embracing th~ whol~ _ world, mad~ it poss!ble for all,o .men toshare in-tha.tpartici- , . patton of the divine¯life. "His (Christ's) InCarnation ~a~ , -- no other end or aim, than to c6mmunicate His divine" life. ~ - to us: , ,~ . - But if-the'fulness 6f the diyinity!belongs.~shbstantially to.Jesus .- ~ Christ gl0ne (C01. 2:9), all who are united to Him by holy ba'ptis~rri .~'becoNe parta~kers in this fulness each according to his measure (John- ~ ~1:16),.: .-.,Ali o~iaer individual -natures belonging, to o~hd ia~e ~.~ Adaha shall be called, to unite themselve~ to-tBi~ privilqged nature, and to recei~'e by t'his union a very real communication,of its divine~iife. ¯ There shall be but one only, Go~d-Man: but" all men who. shal1~ be ~DOMINIC- UNGER~ Son of the~Heayenly :~E~th~r; but~all those.,who shall be willing-t~ receive~ thii~only Son shall becomethereby thd adopted sons of His Ffither add shall adqfiire - ,g s~rjct, right to share in H)s heavenly inhe/i(affce. "-(Tbe" Ap6stlesbip oLPr~g~r,,~p. 138: and The Laws o~ Prodidence, p. 90.)- ~ . ,"L It is possible for Christ to b~ the Head ~f all men and to i m~ke'~hem divine becahse.He is personally' unit~d"with Go~ ahd because He possesses the fulness of divine life. which He " fofcef~!y stated b~.Father Ram~{rd:- ~ . ~ Jesfis Christ is, therefore,.3n a ver~ real sense, the Head of huma~ ity ~nd of tile w~ole spiritual creation: .for from Him alone~do~s thd 'divine li~e ~our itself forth on angels and men, as really as animal lif~? ~s~reags' fr6m'the h~ad into every ~a[t pf our body." From Himhnd ~'flom Him alon~ proceed all supernatural acts which are d~ne 'io-heaven arid earth. We capnot acquire the least ;merit, do the least ~c~i'on,.conceive the least" thought,pronounce the least w~rd. in the supernatural order, if these different ~mov¢ments are not in-~ur hearts. *~througb~ an ~mpul~e'of His Divine~ Heart. This adorable ~art is 'for: all h~manity, in the order of grace, what ~he sun,.in ~fie physical okder, is for the earth and th~ 6ther planets which'gravitate~around it. - ~- The fact that Christ h~s, made it possibld --;_re~el~eHls o~n Bo'dyafid Blood in~the Eucfiari~t is ~an?- argument that He ifitend~d usto be divine. This union of -man~ith

Guinea-Bissau (S/2018/110) ; United Nations S/PV.8188 Security Council Seventy-third year 8188th meeting Saturday, 24 February 2018, noon New York Provisional President: Mr. Alotaibi. . (Kuwait) Members: Bolivia (Plurinational State of). . Mr. Inchauste Jordán China. . Mr. Ma Zhaoxu Côte d'Ivoire. . Mr. Tanoh-Boutchoue Equatorial Guinea. . Mr. Ndong Mba Ethiopia. . Mr. Alemu France. . Mr. Delattre Kazakhstan. . Mr. Umarov Netherlands. . Mr. Van Oosterom Peru. . Mr. Meza-Cuadra Poland. . Ms. Wronecka Russian Federation. . Mr. Nebenzia Sweden . Mr. Skoog United Kingdom of Great Britain and Northern Ireland . Mr. Hickey United States of America. . Mrs. Haley Agenda The situation in the Middle East This record contains the text of speeches delivered in English and of the translation of speeches delivered in other languages. The final text will be printed in the Official Records of the Security Council. Corrections should be submitted to the original languages only. They should be incorporated in a copy of the record and sent under the signature of a member of the delegation concerned to the Chief of the Verbatim Reporting Service, room U-0506 (verbatimrecords@un.org). Corrected records will be reissued electronically on the Official Document System of the United Nations (http://documents.un.org). 18-05017 (E) *1805017* S/PV.8188 The situation in the Middle East 24/02/2018 2/14 18-05017 The meeting was called to order at 2.10 p.m. Adoption of the agenda The agenda was adopted. The situation in the Middle East The President (spoke in Arabic): In accordance with rule 37 of the Council's provisional rules of procedure, I invite the representative of the Syrian Arab Republic to participate in this meeting. The Security Council will now begin its consideration of the item on its agenda. Members of the Council have before them document S/2018/146, which contains the text of a draft resolution submitted by Côte d'Ivoire, Equatorial Guinea, France, Kuwait, the Netherlands, Peru, Poland, Sweden, the United Kingdom of Great Britain and Northern Ireland and the United States of America. I now give the floor to members of the Council who wish to make statements before the voting. Mr. Skoog (Sweden): Sweden and Kuwait earlier this week put forward a draft resolution to respond to the desperate calls of the United Nations and the humanitarian community in Syria for a cessation of hostilities for an initial period of 30 days, in order to allow for much-needed humanitarian relief. We have been working intensely with all Council members to operationalize the concrete requests of the United Nations, the humanitarian community and, above, all the civilian population on the ground. We have done our utmost to accommodate Council members' concerns. It is now time for the Council to unanimously shoulder its responsibility and show that meaningful action is possible. The key components in our draft resolution are a nationwide cessation of hostilities for at least 30 days, weekly United Nations humanitarian aid convoys to all areas in need, and immediate emergency medical evacuations. The United Nations convoys and evacuation teams are ready to go. The draft resolution also calls for the immediate lifting of sieges of populated areas, including eastern Ghouta. It reiterates its demand, reminding in particular the Syrian authorities that all parties have an obligation to act in accordance with international law to protect civilians and hospitals and other medical facilities. The draft makes an exception for military operations directed against the Islamic State in Iraq and the Levant, Al-Qaida, the Al-Nusra Front and other terrorist groups designated by the Security Council. This in no way relieves the parties to the conflict in Syria from upholding their obligations under international law at all times, including the principles of distinction, proportionality and precaution. The draft resolution is not a comprehensive peace deal on Syria; its aim is purely humanitarian. There are already ceasefire agreements in force for the areas where fighting has escalated the most. They need to be complied with. There are existing monitoring mechanisms that can be utilized. The role of the Council is to push the parties to the conflict to comply with the proposed cessation of hostilities in order to urgently enable needed alleviation of suffering for the people of Syria. If the draft resolution is adopted today, it can de-escalate violence, save lives, alleviate suffering and break the deadlock on humanitarian access and sieges. Since the first call for a cessation of hostilities, the situation has gotten dramatically worse, particularly in eastern Ghouta, as we have heard from the Secretary- General and from Under-Secretary-General Mark Lowcock. After seven years of war, the situation for innocent civilians in Syria has never been worse. But we have an opportunity to turn things around today to avert the disaster unfolding before our eyes. The draft resolution before the Council represents a resolute and very urgent attempt for the Council to take decisive and meaningful action. Today, we count on each and every member to do the right thing. The President (spoke in Arabic): The Council is ready to proceed to the vote on the draft resolution before it. I shall put the draft resolution to the vote now. A vote was taken by show of hands. In favour: Bolivia (Plurinational State of), China, Côte d'Ivoire, Equatorial Guinea, Ethiopia, France, Kazakhstan, Kuwait, Netherlands, Peru, Poland, Russian Federation, Sweden, United Kingdom of Great Britain and Northern Ireland and United States of America The President (spoke in Arabic): The draft resolution received 15 votes in favour. The draft resolution has been adopted unanimously as resolution 2401 (2018). 24/02/2018 The situation in the Middle East S/PV.8188 18-05017 3/14 I shall now make a statement in my capacity as representative of Kuwait. I associate myself with the statement just made by the Permanent Representative of Sweden on our behalf. The unanimous adoption today of resolution 2401 (2018), following lengthy and intensive negotiations, demonstrates that the penholders, Kuwait and Sweden, are keen to ensure unanimity on this important humanitarian resolution. The resolution renews hope in the Security Council's ability to be unified and speak in one voice, sending a clear and explicit message that it rejects any violations of the Charter of the United Nations. I wish to thank all Member States that voted in favour of the resolution, which includes key and specific demands in response to the appeals of the international community, the most important of which are as follows. First, it demands that all parties cease fire without delay throughout Syria for a minimum of 30 days. Secondly, it allows the United Nations and its partners to immediately undertake medical evacuations safely and unconditionally. Thirdly, it requires all parties to ensure the unimpeded and safe access of all humanitarian and medical workers. Fourthly, it calls on all parties to lift the siege of populated areas, including eastern Ghouta. We are totally convinced that, while the resolution may not end the humanitarian suffering in Syria at once, it is a positive message that the Council today is solidary and united to end this humanitarian suffering and hostilities right away. The biggest task now is to ensure the implementation of the provisions of the resolution in order to save civilian lives in Syria and deliver their humanitarian needs immediately. The Security Council still has a great deal to do so as to end this tragic crisis in Syria, which is about to complete its seventh year. The resolution that we have adopted today is only an interim solution, as a political solution in Syria is the only way to achieve a comprehensive settlement of the crisis and meet the aspirations of the brotherly Syrian people, in accordance with relevant Security Council resolutions, especially resolution 2254 (2015) and the 2012 Geneva communiqué (S/2012/522, annex). The State of Kuwait stresses the importance of reaching an agreement among Council members to prevent any attempt to obstruct a draft resolution aimed at stopping flagrant violations of human rights. Kuwait supports the code of conduct proposed by the Accountability, Coherence and Transparency group, whereby Council members would pledge not to obstruct draft resolutions that address crimes against humanity, genocide and war crimes. We also support the Mexican-French initiative calling on restraint in the use of the veto in the event of serious violations of human rights, based on our commitments to abide by the four Geneva Conventions and their Protocols, international humanitarian law and the outcomes of the 2016 World Humanitarian Summit. We call for engagement on general humanitarian issues, such as the delivery of humanitarian aid, the evacuation of the sick and injured, and humanitarian truce, as procedural issues. In order to prevent the recurrence of such tragedies and the great suffering of humankind, the veto must not be used in such instances. I now resume my functions as President of the Security Council. I give the floor to the other members of the Council that wish to make statements. Mrs. Haley (United States of America): I want to thank the penholders, Sweden and Kuwait, for their work, their sacrifice and their time in the negotiations. As we look at the negotiations, I think it is also important that we bring the Council some of the voices of the Syrian people in eastern Ghouta, who have suffered so much while waiting for the Security Council to act. A doctor treating patients in a makeshift hospital described the conditions she is facing: "We are mental and emotional wrecks. There is nothing more we can do. We are bled dry." In a haunting video, the doctor walks into a room with a crying mother as she says, "I am waiting for my son to die. At least he will be free of pain. I was just making bread for him when the roof fell in. He is going straight to heaven. At least in heaven there is food." Another message we received yesterday which I think was relayed to Council members in the closed consultations, but which I think it is important to repeat again — was an emergency call from a doctor in eastern Ghouta, who said: "We have a horrible situation here. We are being targeted with all kinds of weapons, non-stop. We lack everything: water, food, medical supplies, S/PV.8188 The situation in the Middle East 24/02/2018 4/14 18-05017 shelter. This is a disaster. Everyone is just waiting to die." Today, the Security Council finally took a step towards addressing these devastating levels of human suffering in Syria. The United States wants nothing more than to see the ceasefire in resolution 2401 (2018) implemented immediately across the country. It is critical that the Al-Assad regime and its allies comply with our demand to stop the assault on eastern Ghouta and immediately allow food and medicine to reach everyone who needs it. All of us on the Council must do our part to press the Al-Assad regime as hard as we can to comply. But we are late to respond to this crisis — very late. On Wednesday, the Secretary-General made an emotional plea for an immediate ceasefire in Syria to allow the very basic necessities to get to the people. Kuwait and Sweden had a version of the resolution ready to go for a vote, but Russia called for a delay. On Thursday, in an effort to stall, Russia called for an open meeting on the humanitarian situation in Syria. At that meeting (S/PV.8186), 14 members of the Council were ready to impose a ceasefire, but Russia obstructed the vote again. And then yesterday, the Council sat around for hours, ready to vote, only to have Russia delay it again. Every minute the Council waited on Russia, the human suffering grew. Getting to a vote became a moral responsibility for everyone, but not for Russia, not for Syria, and not for Iran. I have to ask: why? At least 19 health facilities have been bombed since Sunday. As they dragged out the negotiations, the bombs from Al-Assad's fighter jets continued to fall. In the three days it took us to adopt the resolution, how many mothers lost their kids to the bombing and the shelling? How many more images did we need to see of fathers holding their dead children? All for nothing, because here we are voting for a ceasefire that could have saved lives days ago. And after all of this time, hardly anything has changed in the resolution except a few words and some commas. The Syrian people should not have to die waiting for Russia to organize its instructions from Moscow or to discuss them with the Syrians. Why did the Council allow this? There is no good reason we should not have done this Wednesday, or Thursday, or Friday. We may not know the faces that we are talking about. We may not know their names, or these people, but they know us. And we all failed them this week. I guess there is unity in that. Today, Russia has belatedly decided to join the international consensus and accept the need to call for a ceasefire, but only after trying every possible way to avoid it. The resolution marks a moment of Council unity that we must seize and maintain beyond the 30-day timeframe. We hope that the resolution will be a turning point, where Russia will join us in pushing for a political settlement to this conflict and take action to re-establish real accountability for the use of chemical weapons in Syria. Progress starts by adhering to the ceasefire with no excuses. After so many years of defying the Council's demands, the Al-Assad regime must change course. None of us should be so naïve as to accept that the Al-Assad regime can continue indiscriminately bombing schools, hospitals and homes under the fake excuse of "counter-terrorism". Al-Assad's bombing must stop. The ceasefire must be given a chance to work. We look to the Al-Assad regime's backers, especially Russia and Iran, to address what the Secretary-General rightly called a "hell on Earth". All eyes will now be on the Syrian regime, Iran and Russia. Our goal with this resolution is clear. The Al-Assad regime needs to stop its military activities around eastern Ghouta, and for once allow humanitarian access to all of those who need it. We are deeply skeptical that the regime will comply, but we supported the resolution because we must demand nothing less. We owe that to the innocent people of Syria begging for help. In the days to come, our resolve to stand by our demands in the resolution will be tested. All of us must rise to the challenge of maintaining this ceasefire, just as we came together today. All of us must do everything we can to make the demands of the resolution a reality. That is the only way to restore the credibility of the Council. The Syrian people have been waiting long enough. Mr. Nebenzia (Russian Federation) (spoke in Russian): Following lengthy consultations, during which the overwhelming majority of delegations demonstrated a sincere focus on seeking joint solutions — for which we thank them — the Security Council has unanimously adopted the humanitarian resolution 2401 (2018), on Syria. I wish to particularly thank the penholders, the Permanent Representatives of Kuwait and Sweden, for their tireless efforts 24/02/2018 The situation in the Middle East S/PV.8188 18-05017 5/14 and resolve to reach a compromise up until the very last moment. Russia supports the resolution because it encourages the Syrian parties to work as quickly as possible to bring a halt to the hostilities, comply with previous agreed-on decisions in that regard, engage in negotiations on a general de-escalation and establish extended humanitarian pauses throughout the country. The reason it took us so long to reach agreement on the resolution was because we did not support the directives it included for an immediate cessation of hostilities for a relatively long period, and the reason for that was simply because it was unachievable in that form. A ceasefire would not have happened if we had adopted the directives without any concrete agreement between the warring parties, and any approach so removed from reality would definitely not help to address the pressing humanitarian problems in Syria. It will be crucial to ensure that the Security Council's demands are reinforced by concrete agreements on the ground. It would be naive to think that any of these complicated issues can be resolved overnight. We trust that all the external stakeholders with influence will work to bring that about. We can see that some foreign sponsors of the illegal armed groups have either fallen very short in that regard or have been deliberately flouting their obligations. Russia is working with all the parties to the conflict and doing everything possible to normalize the situation and actively assist the humanitarian efforts. Iran and Turkey, our partners in the Astana process, have taken on a major part of the work, and we are preparing for an important meeting in the Astana format next month. In the southern de-escalation zone a fairly decent level of cooperation has been established with Jordan and the United States, although we have been seeing tension rising in some areas owing to activity by armed groups. The resolution clearly states that it does not apply to military operations against the Islamic State in Iraq and the Levant, Jabhat Al-Nusra, other Al-Qaida-affiliated organizations and various groups that the Security Council has recognized as terrorists. That struggle that will continue. We call on international stakeholders to coordinate closely on this issue, including with the Syrian authorities, and in strict compliance with international law and with respect for Syria's sovereignty and territorial integrity. The goal of combating terrorism must not become a pretext for solving this or that geopolitical issue of dubious legitimacy, which is exactly what the United States is doing in Syria. Instead of being drowned in rhetoric about Russia — and by the way, next time I am going to count the number of times Ambassador Haley mentions my country — what we are insisting on is a prompt end to the occupation-style efforts of the so-called coalition, which, among other things, would have a definite humanitarian impact, enabling the Syrian Government to address the issue of restoring normal life in all the areas that have been liberated from terrorists, including in the north and the east of the country. Closing the coalition's Al-Tanf military base would solve the problem of the internally displaced persons in the Rukban camp. In that connection, we would also like to point out that every effort should be made to deliver aid via the most direct routes, as provided for in the humanitarian resolutions on Syria. It is important that today's resolution calls for speeding up the immediate deployment of humanitarian mine-clearing operations throughout Syria. It also reiterates the demand that all parties demilitarize medical facilities, schools and other civilian infrastructure and refrain from establishing military positions in residential areas, something that the illegal armed groups have frequently been guilty of. The conflict's flashpoints are more clearly identified, and are not limited to eastern Ghouta and Idlib, and that includes Raqqa, which the coalition has laid waste. It also expresses indignation at the militias' shelling of Damascus, in which our Embassy has been hit several times. We know that the humanitarian situation in Syria is dire and in urgent need of effective measures, but we can see perfectly well that the propagandistic picture being painted of eastern Ghouta is identical to the loud campaign in late 2016 during the counter-terrorist operation to liberate eastern Aleppo. We must engage not just with eastern Ghouta, but with Raqqa, Rukban, Foah, Kefraya and Yarmouk. Every area of Syria should get help. The resolution emphasizes the importance of supporting the restoration of stability in the areas that civilians are returning to, which in our view sends an unambiguous message to those capitals that continue to make restoration assistance conditional on a specific transitional direction in the political process. It stipulates that the humanitarian priorities for Syria in 2018 are not limited to Under-Secretary-General Lowcock's five requests. The agenda is far broader. We S/PV.8188 The situation in the Middle East 24/02/2018 6/14 18-05017 hope in particular that the specialized United Nations agencies and their partners will be sensitive to requests from the Syrian authorities. In conclusion, I would like to express my deep concern about the public statements by certain United States officials threatening aggression against Syria, a sovereign country. This is a warning that we will not countenance any arbitrary interpretation of the resolution that has just been adopted. We demand an end to this irresponsible and hateful rhetoric. Rather, there should be joint efforts to settle the conflict in Syria on the basis of resolution 2254 (2015). Mr. Delattre (France) (spoke in French): France welcomes the unanimous adoption of resolution 2401 (2018), which demands that a cessation of hostilities be established without delay throughout Syria, in order to enable humanitarian personnel to evacuate the wounded and to gain access to the population. The negotiations were arduous. However, despite their differences in approach, the members of the Security Council managed to prevail in the name of the humanitarian imperative. The resolution is vital in the true meaning of that word, since halting the shelling and evacuating the wounded are matters of life and death for thousands of Syrian people, especially in eastern Ghouta, which has been under siege by the Damascus regime for days. I would like to thank the delegations of Kuwait and Sweden — which introduced the resolution, with our support — for their efforts, perseverance and outstanding work in arriving at a robust text. As by President Macron and the Secretary-General forcefully recalled last Wednesday, it is imperative and urgent to end the shelling of eastern Ghouta, Idlib and the whole of Syrian territory immediately. That was the thrust of yesterday's joint call by President Macron and Chancellor Angela Merkel to President Putin during their demanding and close conversation on the issue. It is also the reason for our vote today. The resolution is the outcome of our concerted efforts, as well as a belated response to the violence unleashed against civilians in eastern Ghouta and elsewhere. Let us make no mistake: a cessation of hostilities for an initial 30 days to enable humanitarian access to meet vital urgent needs is only the very first step. It is the minimal response to the repeated demands of both the United Nations and humanitarian actors, which have been conveyed for months by Council members, in particular by France. It is now up to the regime's supporters to ensure full compliance with the cessation of hostilities without delay and to respond to all requests for access to humanitarian assistance and medical evacuations in accordance with the text we have just adopted. We specifically call on the guarantors of the Astana process to assume their responsibilities and effectively ensure that the Syrian regime immediately cease its hostilities and ensure respect for the basic principles and rules of international humanitarian law and human rights law. It is urgent that humanitarian assistance reach without delay the people who need it. Every minute counts because every minute can lead to the loss of lives. Nothing would be worse than to see this resolution remain a dead letter. That is why France will be extremely vigilant on all those points over the coming hours and days. We all know that a return to stability in Syria is the only way to put a definitive end to the humanitarian crisis, for which a political solution is required. More than ever, therefore, we must redouble our efforts to establish a neutral environment that will enable a credible political process and elections to be held in Syria, as part of the Geneva process and resolution 2254 (2015). France is ready to continue working tirelessly with its partners to that end. As we said yesterday in this forum, the elements for a regional and potentially major international confrontation have coalesced today. That is a risk that must be taken very seriously. We must therefore come together, as we have done today, to put an end to the humanitarian catastrophe under way, prevent a spillover of the conflict and seek an inclusive political solution in Syria. These are three indissociable priorities, and our generation will be judged on whether or not we are able to put an end to the Syrian tragedy. This text is a potentially important step, but it is obviously not the end of the road. Let us be frank: the hardest part has yet to be done. Therefore, on behalf of France, I would like to launch a two-pronged appeal. The first is a call for the resolution to be fully and immediately implemented. We are all aware that pitfalls and obstacles abound. This is a reflection of the extent to which resolute and coordinated engagement by all members of the Security Council is crucial to ensuring that the provisions we have just adopted are implemented on the ground without delay. To put it even more clearly: if we do not put all our resources 24/02/2018 The situation in the Middle East S/PV.8188 18-05017 7/14 and energy behind the full implementation of this resolution, we know that it will not work. Above all, that applies to Russia and the Astana guarantors. The second call is to use this truce as leverage to put an end to the spiral of violence in the Syrian tragedy and create positive momentum towards an inclusive political settlement in Syria. That must be our common ambition. There is a glimmer of hope today in that regard. Let us seize this fragile moment to begin to reverse the course of events, despite the magnitude of the difficulties ahead. As the Council knows, France is fully committed to that goal. Mr. Hickey (United Kingdom): The United Kingdom welcomes the adoption of resolution 2401 (2018). In particular, we applaud your work, Mr. President, together with Sweden, as co-penholders. But this is not a moment for self-congratulation. It has taken us far too long to agree this resolution. While we have been arguing over commas, Al-Assad's planes have been killing more civilians in their homes and in their hospitals, imposing unbearable suffering. Despite the amount of time we have spent in this Chamber over many years discussing the devastating humanitarian crisis, we have still not been able to achieve the peace and security that the Syrian people so desperately need. As the conflict enters its eighth year, the situation in eastern Ghouta and elsewhere in the country is far worse than we ever thought imaginable. The barbarity and depravity of the Al-Assad regime shows no limits. We must never lose sight of the fact that the pictures we see and the stories we hear from this comfortable Chamber are the agonizing reality for hundreds of thousands of civilians — for men, women and children who are being forced to eke out an existence underground to avoid being killed by a regime that commits daily atrocities against its own people. I have heard some say that the information about the situation in eastern Ghouta is propaganda. A doctor in eastern Ghouta, having heard such comments, said this morning: "Amid the chaos and the bombs, it is the not being believed that almost hurts the most. We are dying here every day. And when people say that they do not believe us, that is pain upon pain." This is not propaganda. It is a living hell for hundreds of thousands of residents of eastern Ghouta. As we have repeated many times, the intentional and systematic targeting of civilians and civilian objects not only violates international humanitarian law, it is a war crime. The United Kingdom will be unrelenting in our campaign to ensure accountability. By having voted in favour of the resolution today, we are standing up and saying that we will not stand by and let this happen. In the face of escalating violence, devastation and suffering, we must all now take practical steps to improve the situation for those living and dying in a hell of one man's making. The resolution demonstrates our resolve to put a stop to the brutal violence. It demands that all parties cease hostilities without delay. That means right now, immediately. The role and responsibility of the Council does not end with the adoption of this resolution, quite the opposite. All States Members of the United Nations, but particularly Council members, must now take responsibility for ensuring that the resolution is implemented in full, without delay. The resolution calls for the Council to review its implementation within 15 days, but we must all be active in supporting and monitoring implementation from the moment we step out of the Chamber. If we see any of the parties violating the terms of the resolution, we must bring it back to the Council immediately. Those with any influence over the Syrian regime — Russia, Iran — have a particular responsibility to ensure that the ceasefire is respected in full and without delay, that all sieges are ended and that humanitarian aid is delivered. This is the absolute minimum that the people of Syria deserve. As much as we welcome the adoption of this resolution today, it is only a small step. Just as one aid convoy in three months to a besieged area cannot even begin to address the humanitarian crisis, one resolution alone cannot solve the situation in Syria. We must do everything in our collective power to ensure that this resolution is effective in delivering for those whom we have failed to date. We must all send a clear message to the Al-Assad regime: abandon your attempt to pursue a military strategy, stop fighting and engage seriously in United Nations-led political talks in Geneva. In conclusion, let me reiterate the words of my Foreign Secretary. The entire world is looking at the Al-Assad regime, Russia and Iran. They hold the keys not only to the end of this obscene conflict, but to the safety, humanitarian aid and basic medical treatment S/PV.8188 The situation in the Middle East 24/02/2018 8/14 18-05017 that is being denied to millions of people right now in Syria. For the mother giving birth underground in eastern Ghouta, for the child unable to learn as schools are closed for yet another day, for the doctor battling air strikes to treat patients in Idlib — all of us sitting here today owe it to the people of Syria to work together with renewed and unyielding energy to achieve a political solution that will bring peace to the Syrian people. Mr. Ma Zhaoxu (China) (spoke in Chinese): The recent escalation of conflict in the affected areas of Syria has caught the attention of the international community. We acutely feel the suffering of the Syrian people as if it were inflicted upon us. China condemns all acts of violence that target civilians and civilian property and destroy innocent lives. China welcomes the Security Council's unanimous adoption of resolution 2401 (2018), which is the result of Council members' patient consultation and hard work to find consensus. The resolution includes positive elements such as calling for respect for Syria's sovereignty, independence, unity and territorial integrity; demanding a cessation of hostilities by all parties; easing the humanitarian situation in Syria; supporting mine action throughout Syria; and continuing to combat terrorism. As an active party to the consultation process, China made unflagging efforts and played a constructive role in facilitating consensus-building in the Council. China appreciates that, thanks to the concerted efforts of all parties concerned, the Council arrived at a solution that reflects the broadest possible consensus among Council members. I would like in particular to thank Kuwait and Sweden, as co-penholders of the resolution, for their tireless efforts. By speaking with one voice on the humanitarian situation in Syria, the Security Council is helping to alleviate the situation as a whole, helping to consolidate the momentum towards a ceasefire, contributing to counter-terrorism efforts in the country and serving the overarching objective of arriving at a political settlement of the Syrian issue. Going forward, the international community should work together to ensure the full implementation of resolution 2401 (2018), so that it can play a positive role in improving the humanitarian situation in Syria. The only way to fundamentally improve the humanitarian situation in Syria and to lift the people of Syria out of their suffering is to find a political settlement. The international community should support the Syrian parties in seeking a swift solution that is acceptable to all parties in the context of a United Nations mediation through a Syrian-owned and -led political process in order to end the suffering of the Syrian people as soon as possible. China is keen for the Council to remain united and forge consensus on the Syrian issue. The Council must push the Syrian parties to consolidate the momentum towards a ceasefire, strengthen cooperation on combating terrorist groups, advance the process towards a political settlement and play a constructive role in maintaining peace and security in Syria and across the region. Mr. Umarov (Kazakhstan): The delegation of Kazakhstan voted in favour of resolution 2401 (2018), on the cessation of hostilities in Syria. I express my gratitude to the co-penholders — Sweden and Kuwait — for their determined efforts to find common ground among the Security Council members. I also thank the members of the Council for their constructive approach towards the resolution, which has many significant provisions. The position of Kazakhstan is very consistent — that stability in the Middle East can be achieved by reducing violence for peaceful means and avoiding the emergence of new tensions. In the past few days, Heads of State and Government from around the world have called on the Syrian Government to observe human rights and on both sides to exercise restraint. Simultaneously, external incitement that fuels tension should stop immediately so that it does not endanger regional security. We see a Security Council united today in demanding that all parties cease hostilities without delay. We now expect all countries that exercise influence on the ground and conduct military campaigns against international terrorist groups in Syria to interact and find common ground for fighting terrorism jointly, while taking practical steps to implement the resolution. Kazakhstan calls on all forces that support an early settlement of the Syrian conflict, including the Government of Syria and the armed opposition, to fully comply with the ceasefire regime and the resolution. All the parties must ensure safe and unhindered access for humanitarian assistance to reach the affected areas, as well as the evacuation of people in need of medical assistance. The Foreign Minister of Kazakhstan hopes that his colleagues — the Foreign Ministers of the guarantor States of the Astana process — will take additional constructive steps to strictly implement the 24/02/2018 The situation in the Middle East S/PV.8188 18-05017 9/14 ceasefire agreements and support the de-escalation zones in Syria, at the meeting scheduled to take place in the capital of Kazakhstan in mid-March or earlier, if need be. These were difficult, but successful, deliberations. We should all work collectively to find a peaceful solution. The unity shown today in the Security Council should continue, since we have yet a lot to accomplish in Syria and elsewhere. Mr. Van Oosterom (Netherlands): On Wednesday, during the high-level debate on the Charter of the United Nations, I quoted one of the founding fathers of the United Nations, Ambassador Stettinius (see S/PV.8185). He said that the members of the Security Council had the obligation to agree so that the Council may be able to act and act effectively. Today we finally managed to agree to end the atrocious violence in eastern Ghouta; to end attacks against hospitals; and to end the killing of innocent civilians, including women and children. The Kingdom of the Netherlands welcomes the unanimous adoption of this crucial resolution — resolution 2401 (2018). Let me thank the co-penholders in particular — Kuwait and Sweden — for their tireless efforts and skilled diplomatic work. We pay tribute to them. Today we have a resolution, now we need to see action on the ground. All United Nations States Members have an obligation to make sure that the words of the resolution are implemented without delay. The Syrian authorities in particular have a specific responsibility towards their own people. The resolution means that all parties must cease hostilities without delay. All parties must engage immediately for a sustainable and durable humanitarian pause of at least 30 consecutive days throughout Syria to enable the safe, unimpeded and sustained delivery of humanitarian aid and services and to enable medical evacuations of the critically sick and wounded, in accordance with applicable international law. The implementation of the resolution means the cessation of hostilities, the delivery of humanitarian aid and urgent medical evacuations. It is a first step in the right direction, but much more is needed — a political solution, accountability and the return of refugees. The Council should remain seized of the matter and closely monitor the implementation of the resolution, starting today. The Council should reconvene without delay if the situation demands it. Ms. Wronecka (Poland): We highly commend the work of Sweden and Kuwait as co-penholders on the humanitarian resolution for Syria — resolution 2401 (2018) — who did their best to accommodate the concerns of all Security Council members. On Wednesday I stressed that it is the Council's responsibility to not fail in stopping the ongoing human tragedy in Syria, and in eastern Ghouta in particular (see S/PV.8185). Today we have managed to reach compromise and adopt the resolution by consensus. I would like to thank all my colleagues for their very constructive attitude. However, the innocent people of Syria have waited far too long for that. Now, all of the parties, especially those with influence on the ground, must make every effort to implement it. In that context, we reiterate our call on all sides to comply with international humanitarian law, cease all hostilities against civilians and allow for free humanitarian access. In conclusion, it is not only our legal obligation to act now, but also our moral duty. Mr. Ndong Mba (Equatorial Guinea) (spoke in Spanish): Following the unanimous adoption of resolution 2401 (2018), I take the floor on behalf of the Republic of Equatorial Guinea, whose Government closely followed the whole process leading up to its successful conclusion with the unanimous adoption of this humanitarian resolution. At the outset, I pay a well-deserved tribute to the penholders, Kuwait and Sweden, for all their efforts, patience and dedication to the goal of drafting a resolution that was ultimately deserving of a favourable vote. We commend the unanimous support of the elected members for the penholders throughout the duration of that process. In Spanish, it is often said that "it is never too late if the outcome is good". This positive outcome is the result of the contributions of all members of the Council, to which we extend our gratitude and commend for the fruitful end. What lies ahead now is the effective implementation of the provisions of the resolution with a view to achieving the objective the Security Council has set out to achieve, namely, an immediate ceasefire throughout Syria in order to facilitate the safe, unhindered and sustainable delivery S/PV.8188 The situation in the Middle East 24/02/2018 10/14 18-05017 of humanitarian aid, services and medical evacuations of all severely injured and ill persons. The Republic of Equatorial Guinea energetically calls on all parties, the United Nations and those involved in the devastating conflict to do everything possible towards the noble end of saving human lives and alleviating the suffering that has been endured far too long by the people. The adoption of the resolution partially spares all members of the Security Council from embarrassment. We will save ourselves completely from that shame if the ceasefire takes effect in the next few hours and if humanitarian aid and medical care begin to reach the affected persons over the upcoming days. Mr. Inchauste Jordán (Plurinational State of Bolivia) (spoke in Spanish): Seven years have elapsed since the beginning of this war, and the suffering of the Syrian people continues to worsen. The numerous human lives lost in recent weeks add to the more than 500,000 lost since the beginning of the conflict. We believe that while military tactics prevail over a political solution, there can be no lasting peace, and consequently it will be civilians, especially women and children, who will continue to be subjected to unnecessary suffering. For that reason, we commend the adoption of resolution 2401 (2018), and hope that its timely and effective implementation will help to alleviate the suffering of the Syrian people. My delegation underscores and commends the arduous work undertaken by the penholders. The delegations of Sweden and Kuwait have demonstrated strong leadership and resolve up to the very last moment to reach an agreement. Similarly, we wish to acknowledge the effort and commitment shown by the Russian Federation and the parties involved, as well as all members of the Security Council during the negotiation process. In recent days, my delegation has expressed its position on the matter at hand, and today we do so once again. Consensus and unity within the Security Council are pivotal if we are to improve the humanitarian situation in Syria, which is why we commend the consensus reached today. We reiterate that there can be no military solution to the situation and that the only way forward is through inclusive political dialogue. We thefaffirm our support for the Geneva process and the achievements made in Astana, of which the agreements must be upheld by all parties. Moreover, we have high expectations that the various forums of dialogue, such as the Sochi dialogue, can contribute to the achievement of a final and lasting peace. Mr. Alemu (Ethiopia): We welcome the unanimous adoption of resolution 2401 (2018) on the humanitarian situation in Syria. We voted in favour because we believe that the resolution can make a positive difference on the ground in the alleviation of the continued tragedy of the Syrians. Having discussed the severe humanitarian crisis in Syria almost weekly, it was clear that what was required from the Council was concrete and collective action that would contribute to alleviating the intolerable suffering of Syrians in all areas of the country. We are pleased that the Council has acted and sent the right message to bring about a cessation of hostilities that will allow the United Nations and its humanitarian partners to have safe, sustained and unimpeded humanitarian access to deliver the much-needed humanitarian assistance to all Syrians in need. I wish to express our sincere appreciation to the delegations of Kuwait and Sweden, which effectively and efficiently led the process of negotiations. We all know that it was not an easy task, but they did excellent work in accommodating the concerns of all delegations with a high sense of responsibility and patience. We also thank all delegations for their flexibility during the negotiation process. We hope that the positive spirit that led the Council to adopt the resolution will prevail, not only in ensuring its effective implementation, but also in laying the bases for greater mutual understanding among all those with enormous influence over developments in Syria, whether in the humanitarian or political and security domains. We know, given the realities, that this is a tall order. One matter needs to be stressed on this occasion. The security situation in Syria is perhaps more complicated today than it has ever been over the past few years. We should not overlook the fact that the source of the humanitarian tragedy that we see today is the result of the difficult political and security situation in the country. We trust that all those, including those whom Ambassador Delattre referred to, will continue to play a role in contributing to the creation of the basis for progress in the peace process. That is extremely critical for ensuring that the humanitarian tragedy is Syria is brought to an end. We can only hope that what the Council has achieved today will lay the basis for averting an even greater humanitarian tragedy in Syria. 24/02/2018 The situation in the Middle East S/PV.8188 18-05017 11/14 Mr. Meza-Cuadra (Peru) (spoke in Spanish): We wish to thank you, Mr. President, and your team, as well as the Permanent Representative of Sweden and his team, for the tireless efforts made to achieve this important consensus, and we also thank the members of the Council for their flexibility. This commitment will allow for an immediate cessation of hostilities in Syria and the urgent and necessary provision of humanitarian assistance. We underscore the need to maintain unity within the Council in terms of its responsibilities to protect the civilian population, in accordance with international law and international humanitarian law. Peru, a sponsor of resolution 2401 (2017), which we have just adopted, will closely monitor its urgent implementation and compliance therewith by all parties involved. We wish to express our sorrow concerning and solidarity with the victims of the conflict in Syria, and our support and admiration for the United Nations humanitarian workers and those of other agencies deployed on the ground. We hope that the important step that we have taken today will help to achieve a lasting solution to the Syrian conflict in line with resolution 2254 (2015) and the Geneva communiqué (S/2012/522, annex). Mr. Tanoh-Boutchoue (Côte d'Ivoire) (spoke in French): Côte d'Ivoire, as a sponsor of resolution 2401 (2017), which we have just adopted and which is purely humanitarian in nature, commends its initiators, namely, your country, Mr. President, and Sweden. It welcomes the adoption of the resolution, which demands the cessation without delay of hostilities. This demand on the part of the Council must be upheld by all actors on every battlefield in Syria. Côte d'Ivoire also welcomes the efforts undertaken by all parties to arrive at a consensus within the Council. It thanks in particular the Russian Federation for its spirit of compromise. The contribution made by all parties to the adoption of the resolution is aimed at saving the Syrian people from the horrific war plaguing that country, which is imperilling the lives of thousands of human beings, specifically civilians, including women and children. Côte d'Ivoire remains convinced that only a definitive end to the Syrian conflict through negotiations can enable all Syrians to restore peace, achieve reconciliation and rebuild their country, with a view to relaunching its economic and social development. We hope that the 30-day truce demanded by the Council will be the beginning of a process that will bring peace to Syria on the basis of the relevant conclusions and recommendations of all negotiations held in Astana, Sochi and Geneva concerning the country. The President (spoke in Arabic): I now call on the representative of the Syrian Arab Republic. Mr. Ja'afari (Syrian Arab Republic) (spoke in Arabic): Over the past two days, 10 of the thousands of missiles that have fallen on the Syrian capital landed on the headquarters of the Red Crescent in Damascus, the main headquarters of the Syrian Red Crescent, in the Abu Ramani neighbourhood of Damascus. Those missiles were launched by the moderate armed groups in Al-Ghouta. Thousands of people died, including Dr. Hassan, a professor at the Technological Health Institute in Damascus. A French colleague and friend, Thierry Mariani, said: (spoke in French) "Like hundreds of others over the past five years, Dr. Hassan Haj Hassan was killed by shells fired from Ghouta on Damascus by these moderate rebels. Those dead and are not entitled to media compassion; they are on the wrong side of history. When will there be balanced coverage?" (spoke in Arabic) This French citizen accurately described the suffering of the Syrian people as a result of the launching by terrorists of missiles against Damascus. He had visited Aleppo in 2017, and as he was leaving Free Syrian Army gangs fired rockets at the airport. Luckily he was not hurt, but since then the Aleppo airport has been closed because it is unsafe. Also. the head of the Syrian Red Crescent in Idlib, Dr. Muhammad Al-Waty, was kidnapped by moderate armed groups. My colleague the Permanent Representative of France said that we must observe a truce, and I agree with him. However, I think that we also need to implement the 29 other Security Council resolutions on the situation in Syria, of which 13 relate to the fight against terrorism. We need not only a month-long cessation of hostilities; we also need to see the implementation of the 29 other resolutions that the Council has adopted. My colleague the British Ambassador told us horrific stories that he heard from other people. Perhaps S/PV.8188 The situation in the Middle East 24/02/2018 12/14 18-05017 he has not heard about what the British forces have done in Iraq, Palestine and Libya. The British Government went to the Malvinas and fought Argentina for an island that it does not own and that is situated tens of thousands of kilometres away from the United Kingdom. However, I say to my British colleague that his Government — and I am not using the term "regime", because I respect international law — is preventing us from countering terrorism in our own territories. We are not going thousands of kilometres away, we have not been fighting in other countries. It is in our own territories that we are combating terrorism — terrorism that is supported by the Government of the United Kingdom. During the meeting on Thursday (see S/PV.8186), I explained the reality of what is happening in Syria — the suffering of civilians as a result of the actions of armed terrorist groups. I assure members once again that the Government of the Syrian Arab Republic has taken all the de-escalation initiatives seriously and has observed them so as to protect the lives of its citizens and to stop those who have been trading in their pain and blood. In that regard, I note that the Syrian Government has complied with the Astana agreement on establishing de-escalation zones and stipulated a number of commitments, including compelling the signatory armed groups to sever any ties they have with terrorist organizations, especially the Islamic State in Iraq and the Levant (ISIL) and the Al-Nusra Front and all other affiliated groups. At the same time, the Astana agreement gave the Syrian Government the right to respond in case of any violations by those armed groups. It was not at all surprising to us that those terrorist armed groups would not comply with any of those initiatives, but would use them as an opportunity to reorganize their forces and their terrorist fighters, acquire more arms, military equipment, human and logistical support and perpetuate their crimes against the Syrian people. They are receiving instructions from certain States members of the Council, as well as regional actors that are practicing State terrorism to ensure the obstruction and failure of those initiatives and agreements. Since the signing of the agreement on the establishment of de-escalation zones, these armed groups have systematically violated it. In responding to the violations, the Syrian Government has exercised extreme self-restraint to protect the lives of civilians and salvage the agreement that terrorist armed groups and the countries that sponsor them have been trying to obstruct since the moment of signing it. However, these violations have become repeated and serious and have affected the lives of 8 million civilians living in the capital, Damascus, and its suburbs. Attacks have been waged by launching rockets and missiles and using car bombs, with Syrian military sites being targeted. All this has led to an unbearable situation that we cannot condone. As a State, we bear a responsibility towards our citizens and we have a sovereign right to counter terrorism. We are also receiving repeated appeals from Syrian citizens for protection — their families, their children, their schools — from the acts of these terrorist armed groups In the light of these violations and terrorist acts, the Syrian Government has had to take the necessary steps to protect its citizens. We exercised our legitimate right to defend them. At the same time, we have taken all the steps necessary to ensure the safety of the civilians who have been taken hostage by these groups and used as human shields inside eastern Ghouta. In cooperation with our Russian friends, we also ensured the safe passage of civilians out of danger from 4 to 14 February. We have provided shelter and food and necessary medical care. The Government has paid for all that assistance. We have called upon armed groups to lay down their weapons and stop their terrorism from residential places and neighbourhoods, and instead engage in national reconciliation initiatives. Of course, the appeals of 8 million Syrians do not reach the Secretariat or the representatives of the United States, the United Kingdom and France, although they receive appeals from their proxies — terrorist armed groups and White Helmet terrorists, the new legitimate representative of the Al-Nusra Front. It seems that these countries decided today to replace the black flags of ISIL and Al-Qaida with white flags in Iraq and the White Helmets in Syria. We are therefore done with using the black colour; we are using the white colour now, white flags in Iraq and White Helmets in Syria. According to General Assembly resolution 46/182, which we all negotiated and reached consensus on, the basic principle that governs the delivery of humanitarian aid is respect for the sovereignty of the country concerned as well as coordinating with it fully in any activity in which the United Nations is engaged on the territory of the country in question. However, such principles lose all value when they are 24/02/2018 The situation in the Middle East S/PV.8188 18-05017 13/14 subject to the political whims and double standards of the Secretariat and some more influential countries, particularly when it comes to implementing them in Syria. How else can we explain that some countries submit draft resolutions on the situation in Syria and negotiate them for many weeks with all actors, but excluding the country concerned? This is what I asked the day before yesterday. How do we explain that the Resident Coordinator in Damascus sends a note to the Syrian Foreign Ministry on 14 February stressing that the aid convoys reached 2.3 million Syrians in the so-called besieged and hard-to-reach areas in 2017, while the Under-Secretary-General for Humanitarian Affairs presented completely false figures yesterday to tarnish the image of the Syrian Government and to give Western countries in the Security Council justification for targeting the Syrian Government and its partners? The Resident Coordinator said that aid had reached 2.3 million Syrians. But just two days ago, Mr. Lowcock said that aid had reached only 20,000 people. Along with some members of the Council, we have said repeatedly over the past seven years that to end the suffering of civilians in Syria we do not need non-consensual draft resolutions, nor do we need to adopt new resolutions or hold regular or emergency meetings. We do not need to deplete United Nations resources to prepare periodic reports that rely on unreliable sources. We do not need to establish a committee here and a body there. We need to implement the 29 — now 30 — Security Council resolutions that have been adopted; it is quite a coincidence that by adopting resolution 2401 (2018) today we have reached 30 resolutions. These resolutions should be implemented. The Governments of some countries should stop spending billions of dollars to support and finance armed terrorist groups and provide them with arms. The latest we have heard is that the United States of America has allocated $4 billion to ublically fund the terrorists in Syria. Those countries must stop opening their borders and airports to facilitate the flow of terrorist fighters to Syria. They must allow the Syrian people to shape its future and restore its security and stability without any foreign interference. You said, Mr. President, that the Council rejects anything that violates the purposes and principles of the Charter. Yes, this is very precise. You called also for the implementation of today's resolution in all parts of Syria, which is how we interpret this resolution in Damascus. Resolution 2401 (2018) must be implemented in all parts of Syria, including Afrin, United States-occupied areas and the Golan. In addition, let me make it clear that the Governments of the United States of America, the United Kingdom and France and their enablers in the region should stop holding meetings in Washington, D.C., Paris and London, establishing groups, bodies or forums and devising what they refer to as strategic plans reminiscent of colonial times. Following a meeting in Washington, D.C., they announced that they had drafted a plan to divide Syria within a year — I am just recounting what they said. The strategic plans contained in the document adopted in Washington, D.C., are aimed at dividing Syria, changing its political system by force, spreading terrorism and maintaining an illegitimate military presence in our territories. I say to my colleague the Permanent Representative of the United States, who threatened us here at the Council a while ago and no one has responded to her, that none of the plans will succeed; they will backfire sooner or later. According to Article 51 of the Charter of the United Nations, my country has the right to defend itself with all of the legal tools available. A United States occupying military presence exists in our territories, and we have the right to resist it. The representative of the United States has threatened us. We, in turn, give her a warning from this Chamber because, according to Article 51 of the Charter, we have the right to defend ourselves. We again stress that double standards will continue to mar international efforts to counter terrorism as long as there is a partial approach to addressing the threat of armed groups in Syria. Some members of the Council claim that they are concerned about an area controlled by terrorist armed groups in eastern Ghouta. The size of that area is 50 square kilometres. They continue to ignore three illegally occupied Syrian territories covering 50,000 square kilometres. They focus on 50 square kilometres and ignore an area of 50,000 square kilometres, of American, Turkish and Israeli occupation. That simple comparison reflects the political hypocrisy of some Member States, and the inaction of the Security Council and of other bodies of the United Nations, as the Organization succumbs to the political and financial polarization that has become the main feature of its working methods. S/PV.8188 The situation in the Middle East 24/02/2018 14/14 18-05017 In conclusion, we will continue, with the support our allies, to counter terrorism regardless of where it exists in Syria — I repeat, regardless of where it exists in Syria. We are exercising our sovereign right of self-defence and a constitutional right in our territory and within our national borders. We do not send forces to conquer areas thousands of kilometres away, as the so-called illegitimate international coalition does in my country, Syria, today. We do not follow the example of French forces in Mali, the Niger and other African countries, or of the United States and United Kingdom in Afghanistan, Libya today and Iraq previously. We defend ourselves and counter terrorism within our borders. We did not go to Mali, the Niger or the Malvinas. We need serious commitment from Governments that issue instructions to armed terrorist groups. The groups should be given orders to immediately stop targeting civilians and perpetrating terrorist acts — I repeat immediately and without delay, as the resolution stipulates. I stress that the Syrian Government will reserve the right to respond as it deems appropriate if such groups target civilians in any part of Syria with even a single missile. I take it that we all understand that paragraph 1 of resolution 2401 (2018) also applies to the aggression of Turkish forces in Afrin and the repeated acts of aggression by the international coalition against my country's sovereignty and territories. Of course, resolution 2401 (2018) applies also to the continuous violations by Israeli occupation forces against Syria's sovereignty, by supporting terrorist factions in the occupied Syrian Golan. That is how we interpret the resolution just adopted by the Council. The meeting rose at 3.35 p.m.

Transcript of an oral history interview with Philip R. Marsilius, conducted by Sarah Yahm on 20 May 2015 as part of the Norwich Voices oral history project of the Sullivan Museum and History Center. Philip Marsilius was a member of the Norwich University Class of 1943. The bulk of his interview focuses on his military service in World War II as well as his continuing relationship with Norwich University as a student, alumnus, and trustee. ; Philip Marsilius, NU '43, Oral History Interview May 20, 2015 Sullivan Museum and History Center Interviewed by Sarah Yahm SY: So let's start out with, where were you born? And when you were a kid, what did you want to be when you grew up? PM: Well, I was born in Woodstock, Illinois in 1921. My father was running a company there. And my family consisted of a brother four years older, and a sister two years older. The sister and I were born in Woodstock. My father had been in World War I, and an ordinance making French 75 guns. And after that, was hired by this Woodstock typewriter company, which is older than the old typewriters, who was owned by the Sears family. And they made in addition, calculators and typewriters. And so I grew up there for two years. And then my father took an opportunity in Bridgeport to run a machine tool company, hence we moved here and lived in the north end of Bridgeport. Grew up there, went to public schools. Went to Harding High school, and from Harding, then to Norwich. SY: And did your father talk about his experiences in World War I? PM: Yes. He was a Norwegian immigrant. Came over from Southern Norway when he was 14, and learned his English in Boston at the YMCA. And then was hired by a company that made shoe machinery -- big, big company. And then they recommended he go to MIT, and he went and graduated as a mechanical engineer. And went immediately into the Army, and came out as a captain. And he was in machine tools all his life. He came here, and through the younger years -- then -- and when I was at Norwich, my folks moved to Trumbull, built a house there. And I spent a little time there, but we were accelerated in our senior year at Norwich. We went out early because they wanted us in the service. And we couldn't go to summer camp in our junior year, which was the standard routine. We were horse cavalry in those days. And we would take a trip through the back roads of Vermont up to Burlington area to the fort. And they had too many trainees at that time, so they ended up saying, we can't take you. You're gonna have to go to OCS. After four years at Norwich, we still had to go to OCS. SY: So, were you mad? PM: No, because we got out early. We got out end of February. SY: And I've heard stories of everybody on campus marching down and enlisting, was that what happened? Or? PM: Well, everybody -- a lot of them left early and joined -- volunteered for the Air Force. And some went to Canada to get in the Canadian Air Force when, like, might not be able to go in the US. And then a lot who had not finished Norwich, left and enlisted. SY: So were you eager to sort of get overseas? Were you eager to kind of get into the war? PM: Very much so. Would've left early after December 7th when Pearl Harbor hit. We went -- several of us went and volunteered. They said, you're not 21, you can't go without parental approval. And my folks said, finish your college, and then you can -- you're on your own. SY: So there was no part of you that was sort of frightened to go? PM: No. I was anxious to go. SY: And why? What was your -- why -- PM: Because I'd had good military background. The war was a devastating war. And in my mind, if we didn't stop what was going on and prevail, life would not be the same -- not be. So it just made sense to go in, and I volunteered for armored. Went to Fort Knox, and there were three others from Norwich. They had room in that class -- 110 candidates. SY: And how -- let me rewind a little bit. How did you adjust to being at Norwich? How did you adjust to being a rook? Did you take to the military lifestyle or was it difficult for you? PM: It did -- wasn't difficult. I had more -- I had more fun as a rook. And we had to come out in our pajamas. I had bought fancy pair of pajamas because I had heard about -- so I just said -- you know, they did a lot of nonsense. Bracing and all that stuff. SY: But it didn't faze you? PM: Didn't faze me. And second year, I was president of the class, and I stayed president of the class for all three years. SY: So, you did well there? PM: And I was valedictorian in addition. SY: In addition. OK, so how was the decision made that in February -- oh, tell me what you remember about Pearl Harbor. How did you hear about Pearl Harbor? PM: Oh, it was basically on the radio, and I just finished a book -- and it's in my car right now -- returning it. A Day of Deceit. FDR, and not letting Hawaii know he knew it was -- he wanted the Japanese to attack so he could declare war. And I've been through that whole book. But we knew it right away, obviously, from the radio news. Everybody knew it pretty fast. SY: Did you have radios in your room in Norwich? PM: Not in our room, no -- not. I can't -- I don't think we had radios. Today, they have everything. SY: Today, they everything. Exactly. OK, so then February, were you all called together into the Amory and told that you were gonna go to war? How as the decision made? PM: Oh, we were -- what we were told to do was, we had -- we actually had a graduation, and then we had a week off. And then we were told to return to Rutland for induction. And they made us corporals, of all good things, when we were supposed to be second lieutenants. And then we departed by train to Massachusetts, and then they went through the induction shots and all that -- get you prepared. And then they scheduled wherever you were gonna go. Some went to Riley in Kansas. Some went to chemical warfare, some went to electrical. So it was -- but four of us, I was able to get a car, and so I had a car. And the four of us drove from Florida, Massachusetts -- I can't think of the name. But that's where we were told to meet, and went through five days of basic nonsense. KP duty and all that kind of stuff. And then we drove from there, I picked up the other officers. They weren't officers then, they were corporals. And we drove all the way to Camp Polk, Louisiana, where we were entered into -- well, back up. We were at Fort Knox for three months, and then battle training for a month in Elizabethtown, Kentucky. And then we were assigned -- the four of us from Norwich were assigned to the 11th Armored Division. That's when I got my car, and we drove from there down through Alabama over to Louisiana, and we arrived. And the next day, we were ordered to come to the commanding general's office. And low and behold, he was a Norwich grad, General Brooks, and a very decent individual. He came out as lieutenant general. And we went from -- they were ready to move the whole 11th Armored to the desert training in California. But we had to go to an interim location, temporary post in Texas -- Abilene, Texas. And at that point, we had six weeks wait until the other armored division that was in training had completed. And then we moved out there. What happened when we were out there, typical of -- they have -- each company has a normal staff of say, five officers. But when they're in training, they had maybe two extra lieutenants, so you all get involved. And then about every couple of months, they go by and say, boom, boom, boom, boom. You're out, you're going to overseas, or you're going someplace. SY: So did you take a ship? I'm sure you took a ship. Obviously, everybody took a ship. But do you remember the name of the ship you took overseas? PM: No, I don't really. What I did was the second the go-around in December, I went to my colonel and volunteered to go to be one of the select. I wasn't pulled out, but I volunteered, because I didn't think 11th Armory was gonna get over there for the fighting. So I volunteered, and that's a tough decision because then, you're on your own. You go -- you go back to the East, and you go to wherever they direct you. And then you get assigned to a fort, and you go as a replacement officer. And you have hundreds of enlisted men, you don't know anybody. SY: And you don't have a relationship with them. PM: You end up having to do duty on the ocean crossing. And I had about 50 men in the lowest deck, most every one of them sick all the way over. Four bunks high -- it was a mess, but you spend 8 hours on duty with them. But anyway, we got to England, and then we went from Liverpool, went on down to Frome, England, somewhat east of London. When the officers went and replaced officers, they enlisted them and went to another post. And then you waited for your assignment. And I with another officer, made a [forayed?] to the Rangers to volunteer to join our Rangers, knowing they needed officers. And both of us were accepted physically, but they made a stipulation, we can't change orders if the time you get back to your camp. If you have orders directing you to another unit, that's it, forget us. And that's what happened. I was already assigned to the 106th Cavalry Group, which was a recon outfit. And it turned out I was -- because I was Cavalry, I was in light tanks. So, I was in tanks the whole war and it was good. You know, and we got over to Normandy in late June. Not D-Day, but mostly, we joined first Army. Patton hadn't already -- his Army hadn't been formed. And we had an interesting time in Normandy. We were right on the east end, right where the water was -- and the channel. The tide would go out a mile, and we had to send a platoon of troops out every night to collect stragglers. People trying to -- were around. And right across -- SY: Who were the stragglers? PM: Well, people who wanted to get away from the Germans. French people. You didn't know whether it was spies or what they were. Could be anybody. And we had to collect them, and make sure that they were the -- had credentials and know who they were, so that they wouldn't cause trouble. If they were just going home to join friends or family, that was OK. But there were a lot of them. And the Germans were -- got quarter of a mile from where we were, and there was a river in between, flowing out. And we had to send patrols down the beach, and one other patrol across to make sure the Germans were there. And they -- we got fired on, and fortunately got back. But -- so we did all that kind of stuff while they were waiting for the breakthrough. And when we first arrived, we -- the first combat we had was with the 82nd Airborne. And they were cleaning up a couple of villages, good size villages. And that's where they -- we broke in with them, and then they left. And then we moved over to the coast. SY: So, I've interviewed a lot of Norwich grads who were in combat, and they -- a lot of them have very intense and vivid memories of their first experience with combat. Do you have intense and vivid memories of the first time you were under fire? PM: We were under fire every day. SY: Do you remember what it was like the first time? PM: Oh sure. SY: What was it like? PM: Where I mentioned about the beach area, at one point even though we were in tanks, we got out of the tanks and went down on foot with carbines and tommy guns to stop any infiltration by the Germans 50 yards in front of us. And dusk, day, and nighttime -- well, yeah, you do what you have to do. SY: Were you frightened? PM: I never was frightened. I was -- tried to be sensible, and you couldn't go into combat and be frightened all the time, because you had to lead 30 men, and I had five or six tanks. So if I was frightened, it'd be -- that wouldn't work. SY: Some people also talk about everything being very slow, and the colors being very bright, and things sounding different. Do you -- you don't remember that? PM: No. Guns sounded like guns, and they were noisy. And -- but recon, we were out in front of everything. We were the first contact, and we have to fight then until we developed how strong the enemy is. And then if we can't handle it, we move aside and bring the heavier stuff up -- infantry or armor, who are close by. So that -- that's -- and when it's under heavy fighting, often we as recon would be on the flank. We'd be making contact with the next American unit. SY: I read the sort of memoir you wrote, briefly. Your short memoir about your time at war. PM: I tried to stay away from the gruesome stuff. SY: Yeah, but I think it's important to sort of -- you know, to talk about it. Just sort of talk about what every day was like and what sticks with you. What sticks with you now? What -- do you think about your time at war now and throughout your life, did you? PM: Not really. No. Just another episode. Once in a while, you can't help but go back. But after the war, there were about eight officers in our unit, and we had a -- the original 106th was Illinois National Guard -- that's where they started. And they had a reunion every year, and we went to the reunions for about three years. And finally decided that it made more sense for us to get a group of the officers together, because half of the enlisted men we didn't even know. And they were having a good time, but we didn't want to invade their fun. So what happened was eight officers, a couple who were in our squadron and a couple that were in the other -- there were two squadrons. And we would meet in California, Texas, Kansas. I had them to my summer home in Maine twice, and usually wives were, are all part of it. So we had a nice good time. They're all dead now. SY: It sounds like in some ways, the most intense experience was in late September at the Foret de Parroy. Am I pronouncing that right? PM: Oh yeah, Foret de Parroy. That was a tough one. SY: Do you want to talk about that? PM: Well, I think I mentioned the minefields. SY: Yeah, but why don't -- I mean, I've read the description, but people who are going to be reading the oral history won't have. So what happened there? PM: Well, we as a recon unit, were asked to take the left side of the woods, and 79th Infantry had the rest of it. It was one muddy road and fortunately, the tanks could maneuver in the light wooded area. So we find our own. But it was dense wooded, rainy, mud, and the Germans were shooting into the trees. So the shrapnel was coming down on you from wherever. And the minefields were never laid in any rational form, you just didn't know. And I don't know if I mentioned, but I called one of my tank commanders and asked him to go to headquarters for the recon group. Because we were all -- five or six tanks were all here in a line. And he jumped off the tank and right on a mine, and dead just like that. And the same -- the next day, we called on the radio and said, well, it's a minefield we're in. We need the engineers to come down with the magnetic mine finders, and they came down. And had fire breaks, and they found a way to get in. But they get there and they tripped one of these what they called a Bouncing Betties, and the shrapnel goes out at three feet. I think a dozen of them were down. And I had to go with a knife blade on hands and knees to crawl in there, with a doctor behind me. And I did a lot of the shots while he was cutting off legs and obviously tourniquetting, and Novocain for pain, and then whatever else we could do. We saved them all, but it was -- it was a messy ordeal. Fortunately, we got -- we were able to get them on stretchers, and put them on the back of the tanks and get them out of there. So anyway, we were all alive, but not in good shape. SY: And it sounds like a bunch of your sergeants asked to be relieved, what was that? SY: Yeah, two of my National Guard guys. Well, this was toward the end of that month in the woods. And these were big stoic National Guard from Illinois, and I thought one was my sergeant major and the other was a sergeant. Surprisingly to me, they came one day and said, lieutenant, we've had it. We just can't handle it anymore. And I thought these guys would be sturdy and strong, and I was wrong. But I told them there's no -- if you're not up to it, you're -- got the shakes, you're not gonna do me any good. SY: Did they have the shakes? PM: Yeah, there was -- kind of think they just couldn't handle it anymore. SY: And had they been there a long time? PM: Well, they'd been with us all the way through to that point. SY: And had they -- PM: But they were in the National Guard for years before. So I thought, you know, these are guys that know it and have been promoted up the ranks. Ones I was not expecting to lose. But I replaced them with corporals and made them -- and they stayed with me the rest of the war. SY: And did the sergeants get sent home? Was it shell-shock? Was it -- PM: I never knew what they -- I wasn't gonna follow. They weren't shell-shocked, but they were just at the point of no return, I guess, best way of stating it. SY: I know, you know, it's much more common to talk about the difficulties of combat and the aftermath, but your generation doesn't talk about it that much. It wasn't something that you guys talked about with each other, and it doesn't sound like you really have lasting effects from that difficult time. PM: I don't think so. I would say that on all of the gatherings we had -- the eight officers, we never refought the war. We never get into that. We talked about things of our present day life, family, and just enjoyed each other's company socially. SY: OK. So then it sounds like you moved through, then around the Battle of the Bulge, what happened? PM: They -- by that time, we were -- then our whole corps had moved, the 7th Army. Seventh was the Army that came up from the South. And they had a couple of corps, and they split us off from Patton, and we moved. So 3rd and 7th ran parallel through France and most of Germany, but when the Bulge hit, they were the closest. So two of their armored divisions and the recon -- similar to our recon, they moved north and went, I guess, 40 or 50 miles. We had to fill that gap they left, and we had to spread our troops out, and that's what we did. And I was in touch -- one of the four officers that had gone to Fort Knox from Norwich with me, Hal [Solon?] was in that armored group -- recon group. And I sent him a note, and he was already -- he had lost a leg, and was already on his way home. So I got a note back when it caught up with him, what had happened. So he never got up to the Bulge, he had already gotten -- but I saw him afterwards. He was active with Norwich after the war. He did fine. SY: And then it sounds like, you know, by spring, the tide has turned, right? And you're having very different experiences, all of these sort of bizarre experiences that make for good stories, right? Like, rescuing the king of Belgium. PM: Well, that was the end. And that was a happenstance and -- because the town of Strobl was -- we were told to stop here in St. Gilgen, the town of Strobl was eight miles down on the lake. And this was a gorgeous lake, about 10-12 miles long. Across from where we were in St. Gilgen, was six-seven foot high mountains. Gorgeous scenery, and Wolfgangsee was where we were. And Wolfgang town was down here, and Strobl was here, and we were here. And these -- two of the prince in Teylingen, bicycled up to St. Gilgen on an afternoon. And we were staying in this hotel, which obviously, we took over. And they come up on the porch, and we offered them a scotch. And they, sure, that'd be nice. But our mission is we want you to come to Strobl and liberate us. We've got a lousy mayor who's a tough Nazi, and he's made it -- made life miserable in the community. So we said, well, we don't have any orders. But we said, well, maybe it doesn't matter. We'll just get four officers, and we'll take my tank, and we'll just go out it. At dark, got out of the motor pool. And since we're officers, we tell the guards what we're -- where we're going. So we did. Out we went about 10 o'clock, and about 11 or before that, we arrive. And they met us at the entrance of the town. It took us right to the mayor's office, where -- but it was really fun because one of the officers had been translating for the -- some part of the government. Translating German and French, censoring material. So he could speak better German. I could speak German, but not that well. And so Nat hopped out and told the mayor that he was a no-good son of a gun, and he was through. He was our prisoner, and we were liberating the town. But the whole town was out in their pajamas having a real celebration. And then they had a nice -- Teylingen had a lovely party for us. And I think we mentioned it -- SY: Because it was you or the Russians, right? In terms of getting liberated. PM: Well, the Russians would've gotten there if we hadn't gotten there. SY: And so the town was hoping it was the Americans not the Russians. SY: Oh, they certainly didn't want the Russians. And we did send a couple officers to meet the Russians. I don't know exactly where they did, but they did meet them and got drunk on vodka. But so I can't remember exactly how far they were from. But we then learned about Leopold the next day, and that's how that all -- SY: So then you already had done one thing without orders, and then you did the next thing without orders, right? PM: Well, we didn't take the tank the next day. We took that Von Ribbentrop's six-wheel Mercedes, the staff car. All full leather seats, a gun rack in the assistant driver. The driver was on the left side, same as our cars. Not like the English. And had a rifle rack right there for the assistant. And then you could have five seats in the back to (inaudible) [00:34:20], and beautiful. And we went to Prince Von Furstenberg's house. First thing he asked about 10:30, can I get you a drink? And we had Bloody Marys, and sat there and talked, and his mother came out. And [Gerhard?] was a real gentleman, and we did see him after the war. We went back again 30 years, and he as in Vienna then, and he came out to have a reunion with us. SY: This was the Prince of Belgium? PM: He was the Prince of Austria, the Von Furstenberg family, famous family. He had been fighting on the Russian front, and he'd come back -- by that time, he'd come back. SY: Fight with? PM: With German. He had a fight with a German Army against the Russians. SY: Right. So it's odd that you were -- PM: He was out of the army by then, and back in Vienna. But he had a summer home in Strobl, and that's how he -- I don't know whether he was injured or what, but he had the -- something happened, because he had been in the fight earlier. So -- SY: Was it strange to spend time with somebody who had been on the other side? PM: Oh no, he was in -- he wouldn't have been -- he wouldn't have been in the Army if he hadn't been force to be. That, he wouldn't. It's when Germany took over Austria. SY: Yeah, yeah, the Anschluss. And then there are some other things that were really interesting. First of all, you talk about hearing about Dachau. PM: We sent one our men to go to Dachau. SY: And then when he came back, did he report to you? PM: To tell us what he saw, and the horrible scenes that he saw. I have no interest in going, because I knew -- and couple of places we found -- graves with 20-30 people. They hadn't been buried, they just laid in the graves. So we saw enough of that without even -- for me, wanting to go. SY: So you weren't surprised to hear about the concentration camps? PM: No, no. We knew about that before. You know, we were well aware of the horribleness of the Holocaust. The genocide, if you will. SY: Because people back in the US didn't really know yet about the Holocaust. PM: No, they didn't. I guess they didn't realize it. I -- maybe they didn't publicize it, but of course, I was here and knew about it. And there were more than a few, because they were in Poland and Germany. What was it, six million Jews that they killed? SY: At least six million. And then there were -- and then, you know, there were other groups that they killed as well. So we don't know the total new number. So I'm wondering if there were any other distinctive memories of your time in Europe that you sort of want to get in the record. Have we talked about the highlights? Are there any other sort of, you know, critically important moments? PM: Well, there were a lot of them important moments when I got hit -- when my tank got hit with a 75 shell, bounced off, didn't hurt us. But if I'd stayed there any longer, the second shell would've gotten me. You know, we had close calls like that. And mines were really the worst, because we could find the fighting units, the guns, and avoid them if we could. But the mines, you just had to be on the alert, and suspect that this might be a place that -- fortunately, my recon guys were pretty sharp. And we noticed areas and checked them before we just ran over them. And so -- but I lost two tanks to mines, teller mines. And both cases, my guys lost their legs, because the whole plate of armor came -- folded right up, and just cut them off here. But we, again, saved them and -- with plasma and tourniquets. And I went to visit one of them after the war, and he was already outfitted with a brand-new Oldsmobile. You didn't need any feet, you could do everything from the hydra-matic drive. And so he was -- he had been a truck driver, and he was -- but my -- I had one episode when -- I don't know if I mentioned in there, when we were attacking the town, and one trooper cavalry was on the hardpan road. And we had gone up the back woods overlooking the town from another direction. We thought we'd coordinate two troops with -- and they got stopped by a road block that they couldn't penetrate. And they were fighting, and we jumped off from the woods. Turned out, the field was mud, and two of the tanks just went right in the mud. Couldn't go, they got stuck. My tank, I just told my driver, I said, George, take your hands off the laterals. Don't try to control it. Just keep the full speed. And it kept moving, and we did get to the one single road across. Fortunately, I did, because I had a platoon of the recon troops who had taken over some trenches close to the town. But they had kicked the Germans out of it and taken over, but they needed someone there to support them. So I had to stay there for about five hours, and the Germans were shooting at me. And I bet at least I had 200 rounds shot at me, but we kept moving the tank. Didn't keep it in one place. And I was firing up where I knew they were shooting. So they claim I might have gotten one of the guns. I don't know, never would worry about that. But I stayed with them until dark. When they withdrew, I withdrew. So we saved them. They -- SY: What happened to the two tanks that got stuck in the mud? PM: When I -- I called them on the radio and told them to abandon, but put grenades in the gun and blow the guns. So they were disabled. After the war, they were still there. Still there for -- I don't know where they are now. SY: Did you go -- did you see them? Did you go back to Europe and see them? PM: I didn't go back. We went back 30 years later, but someone who had been there said the tanks were there. But they were no -- well, they were no good, because the guns were ruined. SY: Right, you disabled them. I wonder how they got rid of those tanks. I wonder how they moved them eventually. PM: Well, they had to wait until there was solid ground, and they'd have to go in with a crane and pull them out. But -- so they might be in a museum somewhere around. SY: They might. Who knows? Do you think you were a good leader, and do you think Norwich prepared you well for war? PM: Oh, I think Norwich -- everything regarding the military and Norwich was fine and appropriate for what we needed as officers going into combat. We had --- even though we were on horseback, we still had a lot of background and realized what was involved in fighting. And so I have no bad feelings at all about anything that I learned at Norwich. I think I could put it to use and -- SY: And do you think you were a good leader and a good officer? PM: Well, I ended up as a captain, so I didn't -- and I couldn't get promoted. Because at the time when I was a platoon leader -- because we had three platoons, 17 tanks, and each platoon was assigned to one recon troop. So when they were out -- I usually was B Troop because I was 2nd Platoon. But the company commander and the exec officer never fought. My tank company, they were at headquarters all the time. They never were fighting and -- because 1st Platoon was A Troop, 2nd Platoon -- B Troop, and C Troop, and they -- we never fought as a tank company. So they just were -- but there were no promotions either. You couldn't get to be the company commander because -- but in the econ troops, there was movement, because they can move to headquarters. And from -- and a number of them did. They could go from captain to major, and be at headquarters in another role. And then -- and that's what happened in B Troop. Lieutenant Bennett, who was with me -- who I fought with, he got promoted to captain when his company commander moved to headquarters. But there was no movement in the tank. SY: No, that makes sense. So let's talk about -- because I know, you know, we don't have endless time. So let's talk about you getting home and what it was like. First of all, did you -- what made you decide to leave the Army? PM: I didn't. SY: You didn't? PM: I didn't. I stayed in the Reserve. SY: Oh, you did. OK. But you didn't want to be career Army? PM: Oh no. I had no idea of career Army. SY: What was you thinking about that? PM: Well, I had no intent, but since I was in the Reserve, I was part of a tank battalion that met in Stanford, Connecticut every two weeks. And I was serving -- well, I was a captain, but I was serving in a major's role. And we did training, and we did -- and I was in until '51, I guess it was. So I was still active. But right in the middle of that the Korean War was just getting going. Two business came to me and asked me to go to Washington on a dollar a year assignment to handle the tool and die industry. They hadn't had a director of the tooling industry in World War II. They'd had machine tools and related, but they never had tool and die. And then they realized that they needed that because there were about 3,000 tool and die shops, and those tools were put on machine tools. So you can't have a machine tool, you got to put the molds and dies in the fixtures. So because I would -- I had finished -- I had gone back to MIT after the war. Because I had advanced degrees -- these businessmen who ran beautiful businesses, you know, had come through apprentice route, didn't have college background. They felt they wanted a -- should have a college person down there. So I ended up doing it for a year, and it that was what I called a graduate degree in government. You learned about Washington. I was there five days a week. Came home Friday night, flew back, and then went to my office all day Saturday and Sunday morning. Got on the Sunday night train out of Bridgeport, got into Washington Monday morning at 7:00, and went right to the office. SY: That sounds exhausting. PM: Well, it was so -- it was a busy year. SY: Did you have a family at that point? PM: I had one son, and a wife, and a little house here in Fairfield close to water -- and very pleasant. And she had her own car, and we had two cars. And -- but most the time, she drove me to the station, and then she'd pick me up in Newark when I flew back. So bring the youngster down with us. But -- SY: Oh, sorry. PM: Go ahead. SY: When you first came back, what was it like to adjust to civilian life again? PM: Well, it was -- I had 90 days of leave. I got out of -- I had to go back to Massachusetts at the camp -- oh, I forget. And we had to go back there to bust her out. But -- and my sister drove up and picked me up. And I was engaged at the time, and by February, I got married. And we took a week's long honeymoon down south and visited some of the World War II officers I had served with. And then a week later, I was at MIT, and grad work for two years. And my wife and I lived in Boston in Needham, and she went to Boston University and took courses. So -- and then we had our -- we had our first son in the last semester of the second year. And -- but I had the company business where I had agreed to join the business when I was in the war. My brother -- four years older, had come back. He was in ordinance in India, and he was a major, and they sent him back to command school in Leavenworth to become a lieutenant colonel. But while he was back, he took time and took a look at our factory and what was going on. And he wrote me a -- about a 10 page letter describing what's happening, and inviting me to consider joining him as a partner if I was interested. SY: And was it -- had it been your father's business? PM: My father was the president of the business, and -- not the major owner, but he had three other owners. And what happened was I got the letter when I was in heavy combat, and I couldn't even read it for a couple of days. But then eventually I got around to answering it, and then right after, I got another letter. And I said, you know, I think two things. I've got to go back and go to MIT, and get up to date on business management and engineering. And then if I do that, I'm willing to join you, but I want equal ownership and I want equal salary, but I don't care about titles. But he was senior, and it worked for 45 years. SY: And over the course of your career, you witnessed, you know, the decline of American manufacturing. How did that affect your business and -- PM: Well, our business was -- well, I'd been out 25 years now. But the second generation -- my son who died, and my nephew who still runs the business, we didn't just -- we bought another business in Bridgeport and merged the two. And then started a whole new technology business in New Hampshire, which is doing fine. And the -- what's left here in Bridgeport is 20 percent of what it was, but the New Hampshire business has been booming. Mostly Asia and Europe, 25 percent here in America, but 50 percent at least, Asia and 25 here. And we have another third business out in New York State, and that's in small tools, and that's doing fine. And I had a business in Mexico for a while, and I started one in Canada for a while. They both -- I gave one away, and the other one just finishing up after 65 years. Winding it down, so that's gone. But the businesses are fine, and fourth generation is in it. My grand-nephews are now in their late 30s, early 40s, and they're digging in. So things have done very well. I'm out of it completely other than just life insurance -- should be. SY: So let's talk about Norwich. So when did you start getting -- when did you get on the board of trustees, and why did you want to back in -- you know, involved with Norwich again? PM: Well, when I was at Norwich, in addition to being president of the class and valedictorian -- as I told you, I was one of the trouble makers. With the fraternities, the old rules were that the freshmen would pay for the orchestra for carnival week, but not be allowed to attend. And I, for one, said that's nonsense. Either you let us in the fraternities before carnival week, or we're not about to pay a couple thousand dollars for a New York orchestra coming up for you guys to have a good time. Well, they didn't think that was -- the class ahead, who became juniors, they -- us -- they agreed to change the fraternity rushing to November. In fact, around Thanksgiving or after Thanksgiving. But they wouldn't rush the class after us, because we screwed it up. So they didn't want us. But -- and one of my father's business partners was SigEp, and he wanted me to go to SigEp. And -- but these guys were, we don't want you guys. Eventually, they invited me to Theta Chi, and I was happy. Then I became president of Theta Chi. And then later, I was president of the inter-fraternity counsel, which was quite a turnaround from screwing them up three years before. Anyway, I enjoyed it, but I -- we had bought land with Theta Chi across from where SigEp -- is where the president lives now. We had -- and Theta Chi is over there -- a new house. We were in an old three story big house on Central Avenue. We had the money and bought the land. And when I came back from the war, I wanted to find out what happened to the funds we had. Well, they had screwed around with it, and we raised hell. And finally they got back on track, and began to put some money aside and build a house. So I stayed with it. And for some reason or another, I stayed in the alumni association, but I was not president of it. I was vice president at the time. When typically, the president was invited to the board as one of the alumni, and Harmon asked me to do it rather than the president. Which was a little embarrassing. So I can came on for a five year stint. And then -- I don't know exactly what day it was, but 1970 was when I took over as chairman. And -- SY: And what was going on at Norwich in 1970? PM: Well, Harmon was the president. And at that time, we didn't have ladies in the corps, and Vermont College was independent. So a lot of things were -- I think we were 600 or so cadets, and now horses -- tanks were replacing the horses. And Norwich had built several new buildings, it was making good progress. The upper campus was -- I don't -- SY: And then Hart became president. PM: Well, Harmon -- this was let's see, 70 -- SY: Was is Hamlett after Harmon? PM: Hamlett came first. Harmon stayed until '65, and then the Vietnam War was a big factor. SY: And how did that change the climate of campus? PM: Well, I wouldn't say it -- we had to elect -- Harmon had -- I think had 15 years or whatever, and he wanted out. And we were able to get a four-star general, Hamlett, who was vice chief of staff of the Army, and a wonderful man. And -- but it was Harmon -- oh, and Bill Adams, who was chairman of the board, and Louie Cavat of the Cavat family. They left the board meeting when Bill Adams said, it's my turn to step down. So the three of them became a nominating committee of whatever we had -- 25 member board. They came back and selected me. I don't know why, because there were military officers there. There were others -- guys that -- SY: So what role -- so the Todds say you played a really critical role in kind of keeping Norwich together in hard times. So can you talk about those hard times and -- PM: Well, that was the Vietnam War, for one. And when Barksdale Hamlett had cancer in the back, and he had to leave for health reasons. It was a hell of job finding a replacement. Who in the Vietnam era at '72, wanted to be president of a military college. And we had search committee, a good search committee, and one was lieutenant general. We -- but he wasn't -- he said he's not up to doing that job. He was a good, wonderful person. And we interviewed a number of people, but military people weren't interested. So we came back to Loring Hart, who was head of the English department. And I had a difficult time -- one thing, the chairman and the president have got to have a good rapport. You got to work together, and got to understand each other. And Hamlett and I had had excellent communication, and there was never any problems. And he knew that I wouldn't interfere with his role, and I knew where the limits were. And faculty often would come to me and ask -- I'm not gonna bypass the president. You go there, not to me. And I told him explicitly and a matter of fact, I met the whole -- the staff faculty senate and told them. I'm not interfering with pay scales or tenure or anything, that's not my role. So we made that clear and -- but finding a new president, Loring was the best we could do. Well, you're on your way. SY: Nice meeting you. PM: OK. She's out to dinner. So that was an awkward period, and Loring was -- he wasn't good at selecting -- F1: Your car is blocking me. SY: Oh no. No problem, let me move it. F1: I should have thought of that sooner. PM: Anyway -- SY: So yeah, so what happened under Loring Hart? PM: Loring was a wonderful person, but difficult in selecting subordinance, putting them in the role. And that was true all the way through. And I just don't think he was a good enough administrator. At one point, I told him he had to go to -- back to -- I'm trying to think, the American -- anyway, they have courses for corporate executives. I said, you got to go to one of these for at least a week, and get some background in executive authority. And he did, because I lectured him time and again. You've got to get the right people in the right positions who are qualified to do what needs to be done. And you can't just select people because you like them. You got to know what they're capable of. So he got the message, and he did it, he went to San Francisco to let's see, American Association of whatever. I had been to courses up in New York State for corporate executives, and they were wonderful. They really helped you. And I met some Fortune 500 companies heads there. Made longtime friends with them. Anyway, we got that done, but at the end of eight years, we -- by then we had brought women into the corps. And that meant, you know, we had to clean out our barracks and allow that strictly for women, and we had to integrate them. And then Vermont College got in trouble, they didn't have sufficient endowment. And the president decided he was ready to leave, so there wasn't any conflict. And it made sense to us to merge with them, so we went through that merger during Loring's administration. And again, that was difficult because we had to change key people over there. And two or three times, he made the wrong choices. But finally at the end of eight years, I talked to the executive committee and said I think it's time we begin looking for a new president. Obviously, he and his wife resisted very much. SY: And were probably hurt. PM: Oh yeah, yeah. And -- but I said for the good of the university, we got to do -- got to do something. And it took two years to flush it out. And we were in the executive committee meeting in Boston, at the Ritz, and we had a vote. And the vote was that -- I don't know but the executive committee was probably 11 people then, and only one voted for him. And then we decided we needed to get a new president, and we had already had a search committee. And we had identified Russ Todd as the potential. And I can remember at that -- after we had made the decision on Loring, and we already had looked at and settled on five candidates, that Russ Todd was the best. And we went through a very rigorous procedure of criteria -- and of his background. And then also laid out an eight-point plan that he had to agree to as far as running Norwich, and what had to be done. SY: It seems like you two worked very well together. PM: We did. Yeah. The same with Barksdale Hamlett. SY: So what enabled you and Russ Todd to work so well together? PM: Well, because he knew right from the start that we had laid out what he had had to agree to to become president. And he didn't mince any words, he was very forthright about everything he did. Russ, you could depend on, no BS, he told you right straightforward how he felt and what he would like. And -- but as I said at the outset, you got to have a relationship -- SY: And he said, you know, that he'd call you and you'd talk for an hour -- for hours, and you'd give him advice. So what advice were you giving him? How did you sort of -- PM: Well, I can't tell you that, could I? SY: You can't tell me that. PM: Well, I don't know because whatever the issue was -- SY: And then how did -- it seems like Norwich got back on its feet, so what happened? How did it get back on its feet? PM: Well, one thing we -- when I finished as chairman, we really went after campaign fundraising. We had very little endowment back in the early days. The first job I took as I stepped down as chairman was a 16 million dollar fundraising drive to get us launched, and we did. We raised that 16. And then we had a very strong investment committee with Fred Weintz because of his Goldman Sachs background. He had connections and contacts, and so we were doing a thorough job of investment management. You know, using the right resources, and then continuing. And now -- of course, back then -- it was 40 years ago, we started doing that. A dollar is a little different today. And the new generation of business leaders and Norwich grads are much better off. And -- SY: So, I'm just wondering -- you know, I didn't ask you at the beginning of the interview why you decided to go to Norwich, but that question connects to sort of why does Norwich mean so much to you? You've dedicated a lot of your life and time to the institution. So why? What's special about it? PM: What's -- two things that started me, my family and my high school principal, Dr. -- Mr. Hedges. His sister was the registrar at Norwich. And I had grown up with horses. Two things. They felt I needed discipline, and I enjoyed the horse life. And I played polo with Norwich and things. So I -- and they had a good chemical program. And one of my dad's partners had suggested that maybe chemistry was a good start, because he had done a lot of work for DuPont. Knew about them, and said, maybe. So I said, well, why don't I take a chemistry course, and Norwich has a good one. And so the combination of all three. SY: Yeah, sure. But then why did Norwich continue to be meaningful in your life? A lot of people are like, yeah, I went to school there, who cares. But you really dedicated a lot time to it, so what is special about the institution? PM: Well, I think everything is special. Particularly, to see it prosper and grow, and begin to really have a place in the academic world -- strong place, and one you can be proud of. And comparing to Citadel and VMI and Texas A&M, and not -- nobody -- the officers that I was with in the service were Texas A&M. So they all were cavalry background too. So we had a lot of commonality. But just to -- well, the fraternity was one thing, and when we got rid of the fraternities, Harmon was still there. He called me on the phone and asked me to -- his -- my advice about the fraternities. And since I'd been head of the counsel and head of the Theta Chi, I said, well, sympathize what you're saying -- because they were disregarding the discipline. So I went up to Norwich and went to Theta Chi unannounced, and just observed and talked to few of the cadets. I called Harmon and said, I'm with you, let them go. They're a distraction for the university. And they did, and I'm still on Theta Chi's list because it's the Alpha Chapter. And I had given them some money, but I don't now. SY: How do you feel about Norwich as it is today? It's very different than it was then. I know some alumni aren't thrilled about there being civilians on campus and things like that. How do you feel about all that? PM: Well, I helped the merger, so I was there as part of -- and a lot of -- well, first, VC was in trouble. When we merged it, we were not planning to bring it over to the campus. But it became obvious after a few years that us commuting back and forth from classes and all of that, just you better have one campus, because you're not that huge a school. And I was happy at the second civilian dorm was finished -- 285 people, so that's pretty good size. And I also -- you know, this -- our society is not just the military. And I'm happy that we have civilians, but I think because of our military program and honor code and discipline, it rubs off on the rest of them. I think it makes them better than -- better students and better people, and their -- the value system. SY: Interesting. I don't know if I have any other questions for you. Anything you want to add? PM: Oh, I had not planned -- when I took the job, I -- usually, it's a five year term. And I had another board member whose father had been to Norwich, and White Chapel was -- that's the father that -- a name for him. And Bill White was a year behind me, and he was on the board then -- replaced his father. And I think we all agreed that Bill would be the next one to follow me. And I -- because I think because of his father's background and all of that, he thought maybe he would be the selected one, and he wasn't when Harmon and the others asked me to do it. But I said to him, five years is fine. He came down with cancer with four years later, and was out of it within a couple years -- he died. So then I was in deep trouble with Loring and getting into that part. Then we were into the school mergers and the women combat. Things were just ramping up, but we managed. But again, I say it's a relationship, and we had some wonderful people on the board that -- Walter Juckett who was vice chair with me. And I was a member of his foundation, and we ended with -- he had some stock in foreign companies that he'd gotten almost gratis -- Finland, Sweden, Norway, Canada, in the wood industry. And when either Goldman Sachs or someone went over and evaluated the value of all of what they all had, they came up to many millions. And when they were bought out, that went into the foundation. And when I was having lunch with Walter in Boston one day, I said, what do you think the foundation -- a portion was coming to Norwich. Oh, he said, probably a million. It ended up to be four or five million, because he had no idea what they were gonna pay. What they'd appraised it for and what it was sold for. So I stayed on his board, and he was in foundry and machine building for the paper industry. And I had a commonality of interest, and -- but Walter and I were just very good, good friends. And he was just a wonderful person, and I could go on with anecdotes about Walter. But we did a lot of things together, including lunch at the Waldorf. And when he went to Waldorf, the waiter came in, said, oh, Mr. Juckett, you want this kind of bread? And he didn't come there every day, he -- but he was very specific about what he wanted to eat. I can remember that. But anyway, those were little anecdotes of life with -- and John Charles Daly, who was on the board -- he was "What's My Line?" He was on TV. You remember that name? Goes back, you know -- SY: I think it's before my time. PM: -- 35 years. How old are you now? SY: Thirty-six. PM: Yeah, see that goes back. He was television "What's My Line?", and he was on the board of Norwich by virtue of one of the trustees. He was chairman of the -- of a boys' school in New Hampshire, and that person recommended him to come on the board, and we became close friends. And I played golf with him down in Washington where he lived. And his wife was the daughter of the former chief of Supreme Court justice, but that was his daughter. But he was -- you know, his English language was perfect for (inaudible) [01:23:19]. And he just -- he was very serious about important things, but he was just full of fun when you got through all the heavy business. He just had a good time. So -- SY: So you had a good time on the board? PM: Yeah. Those were the kind of -- but we had a 30 member board. We brought six from VC onto the board, and they were good people. Then we had -- well, we had a lovely group of women on the board, who -- one was a lawyer in Washington, who -- topnotch person. We had -- SY: Were you involved in the decision to sell VC eventually? PM: Oh, that was over -- past my time. With -- once we moved over here, there was no reason not to sell it, and it was sold to good people. So there was no question about -- it was great property. And if someone who -- from Cincinnati -- SY: Well, they actually sold it just, you know, 10 years later -- less than 10 years later. But it's doing fine now, because it's now independent, Vermont College of Fine Arts. PM: Yeah, I don't know what it is now. SY: Yes, Vermont College of Fine Arts, it's actually doing very well. But Union Institute, that was short lived and not actually great, but -- PM: We also took part of the Marshfield College -- SY: Goddard. PM: Goddard. We took the graduate program from Goddard, and they were unionized. And we got rid of the union, brought those professors over, and they were excellent professors. They were topnotch people. SY: And they were at VC. PM: At VC? SY: Yeah. PM: Yeah, but they wanted out of Goddard too. SY: They did, because it was so unstable. PM: Well, it was a commune. SY: Well, actually, because I've interviewed a bunch of them, they didn't -- they -- a lot of them believed in Goddard's educational vision, but it wasn't economically sustainable for them and their families. PM: But they lived out in the woods with a -- I went to the campus, and I agreed that they wanted to keep their undergrad program. Yeah, that's fine. And it fitted for a certain type of people, so I was happy with that. SY: Sounds like a lot of really important decisions were made during your tenure on the board. PM: Well, I think it eventually stabilized. And in perspective looking back at it, it's hard to know how we would have done it differently in light of the circumstances. Vermont's a little different state than some others, you know? Not an easy state to do things in. So you have to put that in reasonable relationship to everything else that happened. But it -- you know, it's a changing society. It's a changing technology, which I used to be involved with. When I think back when I finished work, and where the technology is today, and then when you think of the social media that all you guys fool around with -- iPhones and oh, whatcha -- Twitter and Facebook and -- you know, I say fine, that's -- social media's great. It's done a lot of business and advertising and all that. I personally prefer person-to-person discussion, either a small group or big group. I don't want to be texting -- driving along, texting. That's not -- you know, I'm not gonna do that. Period. I have a cellphone, and I don't use it much, but I have it for safety if I need it. But when you're 93, you don't -- SY: You're certainly not gonna text and drive when you're 93. PM: I still drive, but I wonder whether I should sometimes when you get on the road. The way people cut you off and zoom, zoom. SY: Yeah, it's a fast part of world too. All right, well speaking of person-to-person contact, let's let you get to your dinner with your neighbor. PM: Well, yeah. END OF AUDIO FILE

Transcript of an oral history interview with Priscilla Dole Hatch, conducted by Sarah Yahm on 11 June 2015, as part of the Norwich Voices oral history project of the Sullivan Museum and History Center. The bulk of her interview focuses on Priscilla Dole Hatch's family and their long-standing relationship with Norwich University; also discussed are her experiences as an elementary school teacher and her memories of Northfield, Vermont. ; 1 Priscilla Dole Hatch, Oral History Interview June 11, 2015 Interviewed by Sarah Yahm SARAH YAHM: Hmm. Well, we'll keep trying. This may not work. We might need to reschedule but we're going to give it a shot. I've been having some trouble with my equipment. Um, okay, so you've been here for eighty-something years? PRISCILLA DOLE HATCH: Eighty years actually. SY: Eighty years. Was this the house you were born in? PH: No. No. When my family bought this house when I was four years old. SY: Wow. But you were born in Northfield. PH: Born in Northfield. SY: And where was your, what house were you born in? Where was your original house? PH: The house up on, um, the corner of Stagecoach and Route Twelve. SY: Wow. PH: Right across from the library. SY: Okay. So, you've seen a lot of big changes in your lifetime. PH: Oh, yes. SY: Yeah. So, I guess I'm wondering, so your family has a long-standing history with the University. Right? Could you talk about that relationship a little bit? PH: Okay. Which one? My grandfather? SY: Both. PH: Both of them. Okay. My grandfather Dole, Charles Dole, was acting president for two years. It was at a time when Norwich was having financial difficulties. So, he used his own money to pay the instructors. Of course, there were fewer instructors then than there are now but, um, he did that and then he had, four boys went to Norwich, his four sons. And then he had two brothers I believe that went to Norwich, at least one, maybe two. And then, my other grandfather, Ira Holden, he went to Norwich, I think, two years, because he liked to play football. That was the 2 reason. But then he had to go back and work on the farm. So, he only stayed in for two years. SY: So, I'm wondering, okay, so you were born in Northfield. You grew up here but I'm wondering what your first memory is. PH: My first memory. I don't know if it's from pictures or really a memory but I remember living on Cross Street. And it was a duplex house. We had a family living beside us. Excuse me. We had a family living beside us and there were two boys in the house. And they were, we all played together and had a good time. And let me tell you what I did. Uh oh. One day, I decided to take a walk and I was three, I think. So, I, my mother discovered that I was gone. And so, she started looking for me and they were digging a cesspool line all the way down Vine Street at that time. Of course, they're pretty deep. So, she went the whole length of the cesspool trying to find me. She thought I was fallen in there. Anyway, in the meantime, I had walked down Vine Street but didn't fall in the sewer, walked down Vine Street and then I went down over the bank, walked the tracks until I got into town, into the depot. And then, I went across the, I went across to, um, East Street. Now, I went to visit my mother's hairdresser. That was my point of travel. So, she, of course, was just about crazy and she went to, she finally got the telephone call from her friend, saying, "I have a little girl down here. She walked in just a little while ago." P.S. then, when I got home, I was put on a rope and I was able to, it was on a run and I could, I could move around that way. But I had to stay on that. The little boy next door, the reason I mention him, the little boy next door came running into the house one day, that day, and he said to my mother, "Don't worry, Mrs. Dole. Don't worry, Mrs. Dole. She's all right. I let her go." (Laughs.) SY: Uh oh. PH He thought was, that's pretty much, that's the first big memory I have. SY: How old were you when that happened? PH: About three. SY: About three, oh. So, that was a young memory. PH: I was young. Yes. SY: So, what was Northfield like as a kid? What were your favorite places? What did you do? Where'd you go? PH: Well, we had the, we had the concerts down on the common. We used to go to that in the summer. My father played in the cornet band and as he did at Norwich too. And, oh dear, what else did we do? We didn't have a lot. I mean, we just pretty 3 much played together as kids. My father worked in the post office. And so, he was busy all the time. We didn't have long vacations or anything like that. We pretty much lived at home. And then, I used to go up to my grandmother's, up on Twelve A and they had a farm. And that was when I really had fun, up there too. That was great, great sport. SY: What would you do? PH: Well, if you were really good, you were allowed to ride the hay, what do you call it? SY: Wagon? PH: Wagon! Thank you. The hay wagon, back from the field, when my grandfather was, you couldn't ride it when there was any hay on it. He was too nervous about that. But you could ride once. You could ride down. And so, we used to do that and in the summer, once in a while, I could take a friend and go up there. Then, in the winter, we used to go up to the sugar house because he made maple syrup. You went up over the tracks there and up on the hill behind the, I don't know how to describe that, um, he had a bridge that went across Dog River there and that he had built himself. And then, because he had to take horses upwards to draw the sap. Anyway, he had the sugar house up there and I was allowed to go up there. We would take an egg, one egg with us and it had to be a raw egg. We took that up. He'd put it in the sap. And then, come lunchtime, we had a hard-boiled egg that was cooked in the sap. SY: Oh! Did it have a maple-y taste? PH: Just a tinge. And if it didn't, we thought it did. (Laughs.) SY: Of course, it doesn't matter if it did for real. Yeah. PH: Right. SY: Absolutely. So, I'm wondering what your impressions were of Norwich were as a kid. Did you have much interactions with the cadets? Did you ever get on campus? Do you have any memories? PH: Oh, yes. Yes. Yes. Of course, they were always around. They had more freedom then. They were off campus more. Once we moved here, I don't know how it always happened but they used to come here and, you know, they'd get sick of campus food and they'd come over and have dinner or something like that. My father was acquainted with quite a few of them. And so, you know, I'm just talking three or four, something like that. But they, this kind of got to be their second home. 4 SY: And how did your father know them? Just through the post office or because he was an alum? PH: No. I think through the Masons. He was a Mason and they were learning to be Masons. So, they'd come over here and study, study the, whatever it is. Then, of course, they'd stay for dinner. I can remember my mother making homemade English muffins. They were so good. They would sit down and have those and coffee after their lessons. And they would come. It was interesting. They just seemed to be glad to have a home atmosphere and feel like they could come over whenever they want. Sit on the porch or what have you. So, I knew quite a few of them that way. Of course, we used to go the football games and the basketball games. Then, when I got older, I knew a few of them. Let's see. What did we do when I was older? I dated some of them. SY: Yes. So, you did. You dated indecipherable. So, what did that mean? Going to the balls? PH: I did. Some. Mm hmm. Went to the ball and to the fraternities. They had the fraternities there. We would have parties. One of the boys that I met that I really thought a lot of, after graduation, he came back to visit. On the way back, he was going to grad school in Ann Arbor, Michigan. And on the way back, he was on a flight that went down. So, he was killed unfortunately. Great, great, great cadet. Really nice, nice young man. Anyway, uh. SY: That's very sad. PH: Pardon me? SY: That's very sad. PH: It was terrible. SY: And how old were you when that happened? PH: I was, oh, by then, I was, I had dated him so I was, how old was I? I was nineteen, twenty. SY: And when were you allowed to start dating cadets? PH: It was interesting because then, if you dated a cadet, the town boys wouldn't date you. SY: Why was that? PH: They were jealous, I think. There was a definite demarcation there. You went with one of the other and you didn't go with both. You always had to make a decision. 5 SY: What, why'd you make the decision that you made? Do you remember your teenage thought process about it? PH: Actually, until after I got out of school, I did not date any cadets. I did date the town boys. But then, after that, I don't know. I don't know how it happened. A lot of the boys went away. That was '48 and it was getting close to the Korean War. A lot of them went in the service. Then, I met some through them coming here. I met two of them when they came here. And one of them I dated and we went to the ball, the junior, what was it called, junior. SY: The ring ceremony? PH: Pardon me? SY: The ring, uh, I always forget what it's called. The junior weekend. PH: There was junior weekend but there was a special name for I can't remember what it was. But anyway, it had the king and the queen and the whole nine yards. SY: Yeah. Yeah. PH: Yeah. SY: Would town boys be sort of mean about? PH: No. They just wouldn't date you. It was kind of a, a hidden thing, you know. Nobody talked about it. Nobody said, "I won't date you if you date." That wasn't even part of it but it just happened. That's the way it was. SY: That's very interesting. Let's rewind a little bit and let's talk about, because you're a teenager during World War II. Let's talk about what it was like during World War II in town. Do you have any memories of that? PH: I do. I do. SY: Could you talk about those? PH: I do because I had an uncle and two cousins that were in the War. They were Marines. I was, let's see, at that time, I was trying to think the other day how old I was when the Germans marched into Poland. That was '39, so I would have been eight. I can remember lying in bed and this was a direct route for the planes to go over from Portland to, I think, Massachusetts. I used to worry. I'd hear those planes and I think, "Oh. Are they going to?" You didn't know who they were. Whether they were our or theirs. I used to think about that, lying in bed and I used to think about my cousins, worrying about them, where they were and what they 6 were in to and so forth. Plus, other boys that were in town, you know. You worried about them too. It was an interesting time. I can remember when I heard that the Germans had gone into Poland in 1939. I was walking to school and I met up with somebody who had heard it on the radio and they mentioned it. It was a shock. It was a real shock. Because, of course, we didn't have TV and all of that to get instant information. So, it was hard to take. SY: Yeah. Do you remember deprivation during the War? Do you remember rationing? Do you remember blackout curtains? What was the day to day life like? PH: We had all the curtains on all the windows were all blacked out. SY: So, in this house, all of these windows were blacked out curtains. PH: All the windows were blacked out and, uh, then, they had the civil patrol. What was it called? I think it was called civil patrol. They would go out and canvas the town to see if they could see any light. If they did, they knocked on your door and told you something was leaking somewhere. SY: And was it your job to pull down the curtains? Whose job was it to pull down the curtains? PH: Whoever was near them at the time. Not anybody's job really. SY: Were those blackouts scary? PH: No. No. You just had them all the time. You pulled them down all the time. No. We got used to it. My mother and father were spotters, up on the hill up here. They would go up. Now, my father and friend went from six to twelve because they were working. My mother and the friend's wife went from twelve to six in the morning. So, they were up there all night. SY: Looking for planes? PH: Yes. When a plane went over, they had to notify. If it was going this way, they had to notify if Massachusetts. If it was going that way, they had to notify Portland. SY: And did they have phones with them? How did they? PH: Mm hmm. They had phone service up there. SY: Wow. PH: Mm hmm. SY: And they did that every night? 7 PH: No. Once a week. SY: Once a week. PH: They were scheduled. Different people were scheduled once a week. SY: And it was rotated. PH: It was rotated. It was constantly covered. Somebody was up there. SY: Anybody ever see anything? PH: Just the planes going over, you know. Yeah. No. Nothing happened. Thank goodness SY: No. Nothing did. Do you remember when all of the Norwich cadets left campus and enlisted? Do you remember that? Could you describe that? PH: I do. And then, the ASTP came in. SY: Yes. Could you describe that and tell that story? PH: Well, it's all of the sudden they just were, they left and there was no fanfare, not much fanfare anyway. There was more fanfare when ASTP left. They marched to the train and they went that way, as I remember. SY: Did you see them marching? PH: I think so. I know I saw the ASTP when they went down. SY: What does ASTP stand for? PH: I knew you were going to ask me that. SY: Ha! Ha! PH: Army training service? They were soldiers. SY: Yeah. PH: They were soldiers that, non-com soldiers, you called them, I think. They were up here to, I think they had different stretches like six weeks, six months, I mean. I don't know. I'm not sure what their schedules were. But they were up here and that was time we still had horses at Norwich. They had to, they had to take care of them. In fact, we had two friends, two of the AST people, their wives came and 8 stayed here. One, she could only get away like weekends. So, she'd come here. And then, the other one, she was, oh God bless her, she was only eighteen years old. She followed her husband up here. What the people did around here, they took them in. And they could live with, we had one that lived with us, the one I mentioned for room and board. And they just worked, you know, did the dishes. SY: And they weren't associated with Norwich? They were associated with the Guard or something else? PH: No. They were with ASTP that was up there. SY: But that was up on campus? PH: That was on campus. The boys were on campus. SY: Oh. I see. So, all the Norwich cadets left. And then, the campus was used probably to do some training for the military. PH: Exactly. SY: Okay. Now I understand. Okay. And you remember when they left. And you're a little kid, at this point, watching this happen, watching the country mobilize for war. What were you thinking watching all this? PH: Right. I had to, I don't know. It was just something else that was happening, I think mainly. I don't think, I mean, we knew about it and it was talked about and we were concerned. But we didn't really know what was happening, you know. We couldn't visualize. SY: Was there part of it, because when you're a little kid, any event is sort of exciting, even if it's scary. It's a little bit like a snow day like, "This is a new thing that's happening!" Do remember being excited by all the fanfare? PH: It wasn't that much fanfare, really. It really wasn't. Everything just sort of happened, you know. The fanfare was when they left and I can remember going down to the train with the girl that lived here. And, of course, she was weeping because he was going off. He was going to war then and she was going to have to go back home. She was very distraught. I can remember walking with her down to watch them march down, follow them and to get on the train. It was tough. It really was tough. SY: Was she waving? PH: Yeah. SY: Yeah. And crying? 9 PH: Crying. SY: That sounds hard. PH: They all were. All the girls that were here. Many, many people took the girls in so they could be near them. It just, they were friends forever. SY: Yeah. You stayed in touch with them? PH: Mm hmm. SY: Yeah. PH: Yeah. SY: Wow. Do you know what happened? PH: Went to visit them in Florida many, many years afterwards. SY: Oh. Look at that. So, what about rationing during the War? Were you able, what foods weren't you able to get? How did that, how did daily life change? Did the town feel empty without men? PH: Well, we didn't, we didn't have much trouble as far as meat was concerned because my grandfather had a farm and he butchered the cows or had them butchered. So, we were all right with that but butter and sugar were the two things that were difficult. And, of course, you had your stamps and your little coins that you use. It was an interesting time. You'd go to the store and, oh, and we'd take our fat, fat that you had that you dried out like if you had bacon, if you were lucky enough to have bacon. If you had bacon, then you'd dry that out and you'd take the fat down and they'd give you maybe two cents. SY: For the lard. PH: It was like a donation almost for the lard. SY: And what would they use it for? PH: They turned it back in for, they remade something with it in the war effort. SY: Interesting. Was cloth hard to get? I know that cloth was sometimes rationed. PH: I, probably, probably it was. I know my mother, my mother made everything. She made all the clothes and everything. I don't know if cloth was hard to get. I really don't. 10 SY: Okay. So, you remember your little ration book and stamps and going around and getting things. And was cooking different? Did you cook differently than you had before the war? PH: If you had a pound of bacon, you stretched, I mean a pound of hamburger. You stretched it. You put an egg in it because eggs we could get. You put an egg in it and you'd put some breadcrumbs in it. You really stretched it to make it go. SY: Do you feel like you kept some of those habits throughout the rest of your life? PH: Some of them. SY: Because you also were a Depression baby. You were born during the Depression. PH: Right. SY: Yeah. So, did you feel that that influenced you as an adult, those early years? PH: Oh, it has. SY: How so? PH: My children tell me is has. (Laughs.) SY: Oh, yeah? They're like, "Mom!" So, what types of things? PH: Oh, dear. Well, I'm frugal. That was one thing that I learned. Make it work. What other things? I don't know. Maybe the way I cook. I think that might have some influence on that. And making food go. When you're first married, you don't have much money no matter where you are. You tend to fall back on those old ideas. SY: Yeah. So, were there a lot of men missing in the town? Did it feel empty? PH: Yes. Quite a few. Quite a few of the boys went. Yeah. SY: And boys you grew up with too. PH: We lost one. Tom. Tom Mayall. We lost him. He was missing in action, finally declared dead. They had a funeral for him here. His body wasn't brought back. They had a funeral here. And then, about two years later, he came to life. He was not dead. He was prisoner. I think he was a prisoner. And he surfaced. SY: Do you remember how that news was spread? Tell me that story. That's a great story. 11 PH: Everybody was excited. Everybody, whether they knew Tom or not, they were excited. SY: And had you known him? PH: I did know him. SY: Yeah. So, do you remember where you were when you heard that he was alive? PH: I don't. I don't remember. SY: Do you remember when he first came back to town? Did he come by train? PH: I don't remember how he came to town. I remember just having him here and his mother being so excited and, oh, she was so excited. She had other boys that were in the service too. SY: What a reprieve! Can you imagine? Every mother who loses a son is like, "Maybe it's a mistake." What an incredible thing for it to have actually been a mistake. PH: Yeah. SY: Wow. You said your uncle and cousins were in the War and they were okay? PH: Yes. SY: Any aftereffects? Things like PTSD? Were they different afterwards? PH: No. SY: No. Did they talk about it or did they not talk about it? PH: They didn't a lot. No. My husband didn't either until shortly before he died. I mean, it wasn't that he wouldn't talk about it. He just didn't talk about it. If you asked him something, he would answer you, but he was not, he just didn't make a big deal out of it. That's the only way I can describe it. SY: But then, before he died, he felt the need to talk about it. PH: He did talk about it more. Yes. He was an avid Marine. He was very proud to be a Marine. The other two cousins, actually I had several, my favorite cousin, he was in and his brother and his father was in. And they met over in Okinawa. We have a picture of them where they met, the three of them in Okinawa. Uncle Ray, I think he was a general at that time. He graduated. He's on the flag up there at Norwich. Are they still there, the flags in the chapel? 12 SY: I think so. PH: And his two sons. He met his two sons over there. That was kind of nice. SY: So, he had been a Norwich graduate as well. PH: Mm hmm. SY: So how did you meet your husband? PH: In college. SY: And where did you go to school? PH: At Castleton. SY: You went to Castleton. You met him at Castleton. After the War? PH: Yes. Oh, yes. SY: What did you study? PH: On campus. SY: No. What did you study? PH: What did I study? Oh, teaching. I was a teacher too and he was a teacher. SY: What subject? Or did you teach elementary? PH: I taught elementary and he taught junior high. Then, another interesting thing that happened to me, I laugh about it now. They had a course. I don't know if you've heard about it. They had a course here in Norwich in aviation, in the summer. You've heard about it? Okay. I can't think of his name, the one that taught. Oh, he was wonderful. All of them were. Anyway, I took that course. One day, it hit me. I said, "I'm the first girl to go to Norwich, to take a course and go to Norwich in our family." It was like, okay, so there was my uncle, my grandfather, and my father and brothers. And then, I had the chance to go. SY: You might have been one of the first girls ever to take a class at Norwich! PH: That's right. SY: So, what year was this and tell me what it was like? 13 PH: I think it was 1950. Oh, we had a wonderful time. It was all teachers. I used the material a lot afterwards. I wish I could think of the man's name. SY: And what were you learning? Were you learning to actually fly? PH: Aviation. Mm hmm. Well, we had an hour, two hours in the simulator, the simulator here. We did a lot with, we learned how they studied air currents and all of that and the principals of flying. Enough so that we could take it back and give the kids an understanding of it. They loved it. I did a unit on it afterwards, the first year afterwards. Oh, it was so much fun because they got so excited to be able to do something so different. We had to make planes. They had to fly. I can't remember how long they had to fly but they did. We had to pass that. That was very important we passed that. SY: So, you had to make planes, like miniature planes, and they had to fly successfully so that you could demonstrate understanding aerodynamics. PH: Right. Right. SY: And you got to be in a flight simulator. PH: You got to be in the flight simulator. We took a trip to Sikorsky in Connecticut where, you know, they were building, they were building, I think, helicopters. Maybe they're doing that now. I'm not sure. Anyway, yeah. We had to fly. It was just a wonderful course. Nobody could ask for a better course. They were working so hard to make it successful. They really just put their all into it. SY: And it was other teachers. So, there were other women in that course. PH: Oh yes. SY: Lots of other women in that course. I wonder if you guys were technically the first group of women to take a course at Norwich. PH: I think we were. SY: Huh. How did that feel? PH: I was excited because I liked the idea of going there. SY: And your whole family had gone there. So, it makes sense that you were like, "What about me!?" Yeah. PH: It was really fun. It was a different experience. I'm trying to think how many were in the class. It must have been, I don't know. There were twenty-five of us, maybe. 14 SY: I wonder how long they ran that course for. PH: Only a couple, three years. They dropped it. I never knew why. I always felt bad that they did. SY: Yeah. PH: Because it was a wonderful teaching tool. SY: And it's exciting that they were also attempting to connect to elementary school teachers, right, and create an aviation curriculum. So, it sounds like you worked for most of your adult life. PH: I taught until I went down to New York. And then, I stopped teaching when I went down there. I substituted. That was all. And then, I decided I wanted to be home when my children came home. So, I stopped working. I didn't stop working. I stopped teaching. (Laughs.) SY: Yep. Let's not make that mistake. PH: No. SY: You were working hard. PH: But anyway, yes. That was it. We were there twenty-five years. Then, we came back here, retired back to this house. Been here since '82. SY: I have some more questions. I'm wondering, when you were a little girl, what you wanted to be when you grew up? What were your dreams of what you were going to do with your life? PH: You're going to laugh. I wanted to be a teacher. SY: I'm not going to laugh! And why did you want to be a teacher? PH: Probably because my mother was. I suspect that was my motivation. SY: Where did your mother get her teaching degree? PH: She got it at Montpelier Seminary. There's a seminary down there. SY: So, that was Vermont College, wasn't it? PH: And then it was Vermont College. Yes. But she did not want to teach in village schools. She only taught in the country schools. She loved it. She absolutely loved it. 15 SY: Why not the village schools? Why the country schools? PH: The children are entirely different, entirely different. They're so appreciative, everything you do. You can't do enough for them. They don't have a lot, you know. They just are super kids. SY: So, she was never your teacher. You were going to the village school and she was teaching in the country. Or did she stop teaching when you were born? PH: The way it happened was the superintendent came to her and he wanted her, because right after she got married, she was teaching down in Braintree. After they were married, she came, they came back here. About five years later, I was born. And then, she wanted to stay home with me. I guess I was four at the time because I was going to be five when school started. The superintendent wanted her to teach and she said, "No. I'm not going back in to teaching until Priscilla goes to school." He said, "Well, maybe I can arrange that." He said, "I can't put her in the village school because the cut-off date is six." And I would have been five. He said, "But maybe I could put her up here in the center across from the library, up on the hill." He said, "Maybe I could put her in there and it won't cause a ruckus. Then you could teach." (Laughs.) Who'd do that? SY: So, is that what happened? PH: That's exactly what happened. I went to school up there for a year. And then, I came back down and I went to second grade in the village school. SY: So, you come from a, your mother loved teaching, it sounds like and you love teaching. I guess, where was your first teaching job and what were your joys and failures? I've taught, so I know there are joys and failures. PH: There are. My first teaching job was right here in Northfield. SY: Where you'd gone to school. PH: Yep. And I had what I'd call the best class that ever went through the Northfield school system. 1957, the class of 1957. And they were, oh, they were just wonderful kids. I've kept in touch with them all these years. I go to their reunions. They're just wonderful. SY: What made them so great? Well, what grade were you teaching? PH: Then, I was teaching sixth grade. I was teaching in an overflow class, an overflow group, because there were so many, they divided them. So, I only had nineteen. Perfect! 16 SY: Oh, because this is the baby boom. This is the post-war boom. That was the first year of that. If they were twelve, then. PH: That's why there was so many and that's why they divided them. I really considered myself lucky. To have such a class. Oh! All just wonderful and they've done very, very well. SY: What types of stuff did you do with them? Do you remember some of the curriculum you did, some of your projects? PH: Oh, dear. We had to stick pretty much to the, you know, one time, it was a Friday afternoon and everybody was like this, you know. And so, I said to them, we had to do, it was a literature, world literature. We had a little unit on that. And so, they were working around the Australian area. So, I said, "How would you like to learn to sing Waltzing Matilda?" Well, they thought that was a good idea and I figured it was good for anything else, right. So, the only way that I could do it was by rote, because I had nothing to do it with. I was singing to them and there were two doors on either side. The superintendent could come in. Of course, anybody could come in either door. So, I'm singing away there to them and then, I'd have them do a part of it and then I'd sing some more and then we'd do all of it. I did it that way. I happened to be singing and I didn't have the voice I have now. I happened to be singing and Walt Gallagher was the superintendent and he came around the corner and I looked up and I saw him and I don't know what, there must have been a look on my face or something. He said, "Oh, I won't bother you now. I'll be back later." (Laughs.) SY: (singing) Waltzing Matilda! Waltzing Matilda! PH: That's exactly what I was doing. It was fun. I loved it. I did. I loved teaching. That's all I can say is I really enjoyed it. SY: Yeah. Yeah. Yeah. It must have been nice to teach in the school that you had gone to. You probably knew the, there were probably just a couple families and you knew all the families. PH: I knew the families but I also taught with some of the teachers that taught with my dad. SY: That's a strange experience, huh? PH: It was very strange. In fact, the eighth-grade teacher, I mean I always called Ms. Lyon, Ms. Lyon, you know. That's what you call her, I mean. She was very strict. When she was the principal, you know, you were scared to death of her. One day, she said, "Priscilla." And then she paused, she said, "Priscilla, call me Vesta. Don't call me Ms. Lyon anymore." Okay. (Laughs.) 17 SY: Yeah. PH: And it was the hardest thing for me to do. The others, there were a couple of others there, I didn't have any trouble with. But to call her, it was really wicked. Oh. I was so nervous. SY: That's hilarious. PH: I had been afraid of her in school and it sort of carried through. SY: What was your biggest challenge as a teacher? What was the thing that was hardest for you in the classroom? PH: What was the what now? SY: Your biggest challenge as a teacher. What was hardest for you in the classroom? PH: Discipline. SY: Yeah. What the expectation then of how you were supposed to discipline kids? PH: Well, of course you didn't harm. I wouldn't think of hitting them. No way. But, it just, I don't know, I never had that much trouble with it really. I had one incident and he's a graduate of Norwich. No names. He was a challenge personified, really. I knew I was going to get him. The others teachers had so much trouble with him and I determined, right at the beginning, I determined, "I'm going to win this child over." So, he came in. He did a couple of things but he came in one day and, uh, I don't know what he did. Oh. Yes. I had already put his desk down beside mine. I was headed this way and he was headed this way. So, he was sitting there for several things he had done and then, I don't know what he did now. I can't remember. I sat down and I put the children to work. I sat down and I wrote and I wrote and I wrote and I wrote. I put it in an envelope. And then, I put his mother's name on it and I put it on the corner of his desk. This is in the morning. He's got to look at this until lunch time. So, I guess you'd call it torture. I don't know. He sat there and looked at it. So, he went home. When he came back, I said, "Did you give your mother the note?" He said, "I threw it on the table as I was leaving." I said to him, "Well, that means you've got to wait all afternoon to find out the result. That's going to make it even worse. Isn't it?" And so, that was that. The next morning, I went in. He's sitting at his desk. Now, I went to school about 7:30. Early. I did my best work with planning in the morning. I went in. There sits Gary. I said, "Did you get locked in last night?" He said, "No." He said, "The janitor let me in this morning." I said, "Why are you here so early?" He said, "I just had to tell you," he said, "I didn't know how much you cared about me." Because in the note, I had written, "It's only because I care so much about so much about, that I really want him to do well. Seventh grade is very important because it will be the start of his really having to buckle down in high school and learn to do well. I 18 know he can do it but he's doing too much extracurricular fooling around." He said, "Nobody's ever liked me in school." SY: What a success that is! What a success! PH: It really was. I consider it the biggest success I had in all my teaching. I had written on the bottom to ask his mother to please come in to see me. She came in and we talked about it. She said, "What can I do? What can I do to help this along?" I said, "Well, I don't know." I said, "He's very fond of his football equipment." And so, she took his football equipment away from him and told him he couldn't have it back until I wrote a note saying that it was possible. So, I let him go about six weeks. I was going to win this one. Finally, one day, I sat down and I wrote a note. Put it on his desk. He took it home. The next morning, I came in, same time, there sits Gary, full football uniform on, hat, all this stuff they wear, ball under his arm. SY: That's very sweet. PH: Is that a wonderful story? I love it. I just love it. SY: And how did he end up doing? PH: All I can say is he now, I think he's the registrar of one of the biggest colleges in the country. SY: Look at that! He did all right, that kid! PH: I wish I could tell you his name, but I shouldn't. SY: No. Oh, you shouldn't. That's a very sweet story. PH: Oh, it was wonderful. I was so pleased. He was so cute. After I left teaching, he even wrote me. He would write me letters. He was one of the ones, when we had the, when I had the units on aviation, he really got into it. He did so well on that. He really did. He was interested and excited about it. I remember him probably being the most excited than any of them. SY: It sounds like you were a wonderful teacher. PH: Oh, I don't know about that. We did have a good time. We had a good time. Hopefully, they learned. SY: Were you sad when you were moving to New York, to leave teaching at the village school? Did you teach? PH: I did. I was. Yeah. 19 SY: Did you have a send-off when you left? PH: No. Not really. Not really. SY: So, why and you lived in Northfield your whole life so you must have been sad about leaving Northfield or were you excited about moving somewhere else? What was the, I assume your husband got a job. PH: I was excited about going down there. I just wanted to do something, you know, outside. I knew I could always come back. I liked New York. I really did. Teaching was different. SY: How was it different? PH: I had, I was called in to teach first grade one day and I was pregnant with my youngest son. And so, I kind of hesitated but I said, "Okay." I would go in. I had this little kid who, I had put them all to work and when you go in, you don't have any lesson plans and you've got to figure out something quick. You've taught school. You know. So, I worked on that and then, I was walking up the aisle, between the, of course, the seats were all together. I was walking up the aisle and this little kid stuck his foot out, tripped me and I just barely, just barely held myself up and got out of it. I got home that night. I said to Stanley, "That's it. No more. Not now." SY: What was, you know what? I'm just realizing your chair is kind of squeaky. I'm wondering if maybe we should switch chairs because the squeak is coming up. PH: Is it? SY: Do you think this chair is less squeaky? PH: Could be. SY: Let's try. We'll just move my chair over and hope it's a little less squeaky. Trade. PH: This one's more solid. SY: That's more solid? Okay. Then let's do that one. There we go. So, what was it like to live in Huntington after having lived in Northfield? How was life different? PH: We lived in Northport but he taught in Huntington. It was different but I had very nice neighbors. That made it, you know. SY: And it was suburb then, right? 20 PH: Yes. We even had some potato fields. SY: Really? PH: Yes! SY: Wow! PH: Not now. SY: I was trying to figure out where Huntington is. PH: North Shore. SY: North Shore. And where's Levittown? PH: Levittown is closer to the city. SY: Closer to the city. PH: And it's in the middle. SY: But these were, like, some of the early post-War suburbs, right? PH: Mm hmm. SY: Were all the houses kind of alike? Were they designed neighborhoods or were they older than that? PH: No. You know, Huntington was, Northport especially, they had a lot of cottages out there. People went out there in the summer. A lot of them were converted cottages. Now, they're McMansions. SY: Of course. Yeah. PH: It's entirely different. Even the house that we had, it was built in the fifties. When I go by, I can't believe it. They just sold it so I was able to look at the pictures of the inside and they've done some beautiful work in there. Good ideas. No. They're not side by side really. Now, it's condos and big senior units and things like that. SY: So, how did you like being a mom? PH: Oh, I loved being a mom. SY: You did? Some people like staying at home with their kids and some people don't. You liked it. 21 PH: I did. SY: You really like kids, it sounds like. PH: I do. SY: How many kids do you have? PH: Pardon me? SY: How many kids do you have? PH: Three. SY: Three. Okay. Are they still living out on the island or are they scattered? PH: They are. They're all down there. SY: That's good. So, you can spend winters down there with them. PH: Right. I said, "We left and they didn't." SY: Yep. What made you and your husband decide to retire back up here? PH: After my mother passed away, father passed in '60, after my mother passed away in '75, the house was ours. We'd come every summer, just doing the work that had to be done to keep it up. Other than that, we closed it. He was from Vermont. He was from Calais and I was from Northfield. It was just a given to do this. Get back to where it's quieter and less expensive to live. Right now, it's horrendous to live down there. Awful. SY: Were any of your old friends still around when you came back? Did you still feel like you knew people? PH: Oh, yeah. SY: So, it was easy to slip right back in. PH: Right. Oh, yes. No problem. Between relatives and friends, it was easy. SY: Yeah. PH: That's why I say I have the best of both worlds because I go down there for six months and I see all my friends down there and then I come up here and I have all my friends up here. 22 SY: So, of course, Northfield has changed over the course of your life but I bet there's also ways in which its stayed the same. I'm wondering your thoughts about that, ways it's different and ways it's similar. PH: Well, if you take this street, for instance, every house on this street, except for the one's that painted purple, every house is the same as it was. Off this here, we now have another street off it. That wasn't there. It wasn't spruces. It was grove up there of fir trees. It was gorgeous. They took them down. SY: Oh, that's sad. PH: It is. The Common, the Common down there has changed. And, of course, Norwich has changed. That's what we watched. SY: How have you seen Norwich change? PH: Oh, my goodness! As the buildings go up, it's just amazing. And all we ever had was the, you know, Plumley. SY: The armory. PH: Couldn't think of it. Yes. Plumley. But now they have Kreitzberg. It's just amazing. It's amazing what they've done. And that's all been since, except for the building up on the Quad, all these other new buildings have all been built since the '50s. SY: Yeah. Do you remember how you felt when you heard that girls were going to be allowed to come to Norwich? PH: Oh, that was great! Yeah. I thought it was great. Nothing wrong with that. And I was so glad when we had a girl cadet colonel. I was excited. Didn't know her but I was excited. SY: Yeah. What about it excited you? PH: Oh, I just thought it was wonderful. She did so well that she could do that. SY: Yeah. PH: She had to go over some hard bumps probably to get there. SY: I would imagine. For sure. Yeah. PH: That's, you know, the Common and Norwich, that's basically the changes that have been made around here. Not too many. 23 SY: No. I guess not too many. And, I guess, the house hasn't changed that much. No. PH: No. We haven't changed it. I had the kitchen redid. We made the kitchen larger. There was a sunporch out there and a little pantry. We put that window in which was just like this window. Did that when we first came back. Other than that, no. We haven't changed it much. I like a kitchen where people can sit when you're cooking and you can talk to them. SY: Who doesn't? That's what a kitchen is for. PH: That's right. SY: That's what a kitchen's for. I wonder if you have any last thoughts or reflections about Northfield, about Norwich, about I don't know, last thoughts. You're at this point where you're probably looking back on your life and thinking about it in some ways and, I don't know, what are you proudest of? Are there things that you regret? PH: Hmm. SY: That's a hard one. PH: That's a hard one. Yeah. That's a hard one. I probably do but I can't think of. SY: But mostly, it sounds like you feel pretty good. PH: Oh, I do. I do. SY: Yeah. PH: I don't have much to, I don't have anything to be upset about or sorry. Just getting older. SY: Yeah. PH: I said, "I don't mind." My son's going to be 60. I said, "Gee, I didn't mind when I was 60. That was a good age." I said, "70 wasn't bad either but 80 has been…" (Laughs.) SY: Yeah. It's been hard. Yeah. PH: Awful. SY: Really? 24 PH: Yeah. SY: Yeah. PH: But oh well. It's all a part of it. SY: It's part of the process. PH: It's part of the process. SY: Yeah. Exactly. PH: Nothing you can do about it. SY: No. There's nothing you can do about it. PH: I have such a marvelous support group here. SY: Yeah? Tell me about it. PH: Oh. I'm so lucky. I mean, everybody looks out for me. When I go away, of course, you see my one cat has been roaming around. Got a couple of those, another one, I mean. I have a cat sitter who comes in and lives here. He's very good. He just looks out for the cats. They like him I think better than they do me now. (Laughs.) That's what I tell him. He looks out for me. I get phone calls. "Anything you need at the store?" I am going to have a woman that I go to the store with because I don't have the stamina now to lift everything and put it in and do all of that so. She'll help me with that. At the end of the street, I have Bill Lyon, who, anything goes wrong, he's right here, fixes it. I had a leak in the basement down here along the edge. I have a friend that, her husband's an engineer and she said, "Oh, he should look at that. He can tell you what to do." So, he came down and looked at it. He said, "It's really bad. It's going to cost about $3,000 to fix that." And I go, "Okay." I'm thinking, "Oh, gosh!" Then, Bill said, "Let me take a look at it." He takes a look at it. The next thing I know, the next morning, I wake up and I hear pound, pound, pound. What is that? I go around and I look and he's down there. He's working on it. He's fixing it. He fixed it! All fixed. SY: They're taking good care of you. PH: Yeah. SY: Yeah. I know another question I have – town/gown relations. How have you seen the relationship between Norwich and the town change over time? PH: Very good question. Very good question, because there's always been, the only word I can use is jealousy, a bit of jealousy of Norwich. I always say, "If it wasn't 25 for Norwich, Northfield would be Bethel." You know Bethel? Northfield would be Bethel! I said, "I don't know how you can say that because, I mean, yes, they've taken a lot of the houses over here, down." They've done things that are maybe not to everybody's liking but the good they do. Helping with the EMTs. There's just so many things that they are responsible for, helping with the police department, the money they give for that. Sure, granted, they use them. I think people resent the fact that there's no tax and nothing coming in to the tax indecipherable, but it's a college. SY: Did the cadets also have a reputation for being kind of wild at different points in time? PH: Yes. SY: Carousing in town. PH: But it depends who you ask, you know. It really does. They were boys! (Laughs.) They would do some things some times. I don't know if you ever notice the centennial stairs had chips on them. Those chips were made, if I can remember, those chips were made, I believe, I'm going to say 1950 but give it a couple years either way. They did things like that. They rolled a cannonball down those stairs. SY: Oh my. PH: That was bad. SY: Wow. PH: It was bad but it's kind of funny now. SY: Do you remember when all the horses, during the War, all the horses left at one point, didn't they? Do you remember that? Visually, what was it like? How did the leave? PH: They must have put them on a train. Must have. SY: You didn't see it? PH: I didn't see that. That was right after the ASTP left, about that same time, '40s that they left. Oh, I know what I wanted to show you. SY: Okay. I'm ready. I won't go anywhere. I'll stay right here. PH: Oh. I'm sorry. Are we still working? SY: No. No. Is it something that should be on tape or not on tape? 26 PH: Not on tape. I don't think so. It's about the drum. SY: Oh. PH: I mentioned the drum. SY: And where does the drum come from again? PH: Will that be all right? SY: Yeah. Okay. So, tell me again about William Holden. PH: He was in Gettysburg. He came back here to Northfield. He was a very active man. It will tell you some of this in there. No. Maybe it won't. He ended up having a farm up on 12A. He was in the slate business with my other grandfather that lived on Dole Hill. That's where that comes from. I forgot how hold he was when he went into the Corp. Anyway, he was there for the duration of that. Then, he came back. He did a lot of things but he was a great part of the town business, things that went on. I believe he was also in the legislature. He just kind of had his hand in every pot. SY: Did you hear stories about him growing up? PH: Let's see. I was pretty young when he died. I can just barely remember him. SY: This is Holden or Dole? PH: Holden. SY: Holden. So, your grandfather you remember? PH: Yes. SY: Yes. PH: Well, not very well. Grandfather Dole, no not very well because died in, actually I can't remember him. He died in '29 and I was born in '31. SY: Okay. So, you never met him. PH: Never met him. SY: Yeah. 27 PH: No. I just know stories about him. Change the subject here, there's a book. There are two journals, big fat books like this. You know them. I think they go from 1885 to – SY: This is Norwich history? PH: Yeah. SY: The Ellis? Ellis? Yeah. PH: Okay? All right. It tells you about Dole. SY: About Dole? Yeah. I actually wonder about your father too. Do you know what his experiences were like at Norwich as a cadet and did he enter the service afterwards? PH: I could tell you a story. SY: Yeah. Tell me a story. PH: When he was at Norwich, he used to go home on the weekend. You could go home on the weekend. His mother made all sorts of goodies, little pies, cakes, and everything. He'd come down and he'd sell them to the cadets. There's stories about him coming back with great big boxes of goodies. They'd all be waiting for him when he got there. SY: He was a little entrepreneur. PH: Yes. He was. SY: Do you also remember, after the War, when married Norwich students were living in this sort of family housing? Do you remember that? PH: Mm hmm. SY: And it was, I guess it was over by the intersection with Route - PH: It's on 12A. SY: Yeah. Do you remember that? PH: Mm hmm. SY: What was that like? 28 PH: They were little duplex houses. There was one bedroom, one living room, sort of a dining room, and the kitchen was off that. That's what they were, pretty crude, but livable. That's where, they lived there. A lot of professors lived there too. SY: Yeah. PH: For housing. SY: For housing. People were desperate for housing after the War. Well, I don't think I have any other questions. That was great. Then, this article about the drum, where was this from? What newspaper? PH: Okay. I don't know. See, my grandmother, great-grandmother, W.W.'s wife, so that's in the late 1800s, she would take anything that was happening in the paper about them. See, even down here, there's something, I think. Isn't there? SY: Yeah. PH: Right here. Were they celebrating a – SY: Yeah. PH: She had a book, a medical book and I wish I had it downstairs. She would paste articles in it. So, I don't know whether that came from a Vermont paper or, doesn't look like a Northfield paper. SY: No. It doesn't. I don't know. Well, I'll hand it over and we'll see if we can figure it out. PH: I figured it's documentation. As you read it, you'll see, because they never had anything to know. SY: Anything about the drum. PH: Anything about the drum. SY: Your family donated it but they don't know anything about it. PH: W.W. donated it. SY: I'll go find out what the deal is with it. PH: I'd love to know when you find out. SY: I will. 29 PH: Because I've never known. I mentioned it once when I was up there and they didn't have a clue. SY: There's a new registrar. He's very conscientious. End of Recording

PI'S RELIGIOSITY IN YANN MARTEL'S LIFE OF PI Yektiningtias English Literature, Art and Language Faculty, State University of Surabaya yektiningtias@gmail.com Drs. Much. Khoiri, M.Si English Literature, Art and Language Faculty, State University of Surabaya Much_choiri@yahoo.com Abstrak Agama merupakan istitusi mengenai ketuhanan. Agama berisi sekumpulan pengertian dan kebiasaan yang mengacu pada individu. Individu tersebut adalah individu yang religius, pernah religius, atau bisa jadi religius. Partisipasi dalam suatu hal yang berbau religius didefinisikan sebagai religiusitas. Individu yang memiliki religiusitas tidak berarti mereka menganut sebuah agama. Selagi mereka melakukan hal hal yang sebuah agama perintahkan terhadap para pengikutnya, seperti percaya kepada Tuhan, mencintai ciptaan Tuhan, dan melakukan tindakan religius, individu tersebut dapat dikatakan religius. Life of Pi, sebuah novel karya Yann Martel, menggambarkan religiusitas seorang anak laki –laki, Piscine Molitor Patel atau Pi. Sejalan dengan hal tersebut, tujuan dari pernelitian ini adalah untuk menggambarkan religiusitas dari Pi dalam hidupnya dan mengungkapkan faktor-faktor yang mempengaruhi religiusitas tersebut. Metode analisis secara tidak langsung berdasarkan teori psikologi remaja karya Frederick Tracy karena sebagian besar novel tersebut menyuguhkan kehidupan Pi ketika dia masih dalam masa remaja. Hasil penelitian menunjukkan bahwa Pi telah memenuhi tiga komponen religiusitas-keyakinan, perasaan, dan tindakan. Terlebih, ada lima faktor yang mempengaruhi religiusitas Pi. Faktor tersebut adalah pengaruh keluarga, pengaruh pekerja professional, kebutuhan, ketertarikan, dan rasionalitas. Kata kunci: agama, religiusitas, komponen religiusitas, remaja Abstract Religion is the institution of godness. It contains a set of meaning and behavior referring to individuals. The individuals are religious, were religious, or could be religious. The participation in religious things is defined as religiosity. Individuals who have religiosity do not mean they commit to a religion. As long as they do what a religion tells its followers to do, like believing God, loving God's creation, and doing religious action, the individuals are considered religious. Life of Pi, a novel by Yann Martel, depicts the religiosity of a boy, Piscine Molitor Patel or Pi. In line with that, the purpose of this study is to depict religiosity of Pi in his life and reveal the factors that influence it. The method of the analysis indirectly works mostly based on Frederick Tracy's psychology of adolescence theory because mostly the novel presents the life of Pi when he is in adolescent period. The result of this study shows that Pi has fulfilled three components of religiosity—knowing, feeling, and doing. Moreover, there are five factors that influence Pi's religiosity. They are family's influence, professional workers' influence, needs, interest, and rationality. Keywords: religion, religiosity, component of religiosity, adolescence INTRODUCTION Fiction, by its definition, is describing imaginary events and people. The contents of a prose literature which are included in fiction are drawn from imagination that shows creativity or original thought. An unrealistic plot like a boy who flies by a broom, talking animals, aliens, or monsters that attacks the earth often cause delusion. Thus, an author puts truths to make the work more realistic although as the mentality history, a work of art can be a manifestation of reality, critic of reality, and alternative thought of reality (Supaat, 2008: v). A modern literature has a notion that art or literature is a matter of creativity. Often the creativity is bounded with the legalistic and formalistic doctrines of religion. Thus Western societies put the religion aside from their literature. The literature is free and free from religious matters. On the contrary Y.B Mangunwijaya in Supaat (2004: 175) stated that basically all literatures are religious. T.S Elliot in Supaat (2004: 166) added that the value of literature must be seen from the ethic and religiousness. If there is an idea or agreement of a society of a religious ethic so the literature must be 'good' like the religious ethic. Religion within a fiction is based on religious ideas from the real world. The religious ideas can be included into a fictional prose because basically fictional characters are imaginary. Although the characters are made up, they still have people's same willingness, needs, and drives in the real world. What people do in real world includes seeking religious understandings. (http://altreligion. about.com/od/artandculture/a/Religion-And-Fiction.htm retrieved on March 7th 2013). Based on the explanation, art works often raises religious issues to make the story becomes more real. The issues contain the truths from real religious ideas. The authors put more understanding to the issues from the facts. A character seeks for religious understanding for some reasons. The character may find peace and satisfied feeling towards his or her life in religion. Although religion is a term for conceivable religions whether formal or informal (Ferm, 1959: 647) a character does not always practice what a particular religion that he or she commits' rules. A satisfaction is found deep inside a feeling. Because it is related to feeling, it can be related to religiosity. Stolz (2009: 347) defines religiosity as what an individual chooses, feels, believes, and acts that refer to a religion that already exists or to a self-made religion. Religion itself is a cultural symbol-system that responds to problems and possibilities that are related to a very important reality. This system influences everyday life and cannot be controlled directly. Stolz continues with religiosity is when an individual prays, sacrifices, believes, loves or fear his god while the religious symbol-system or religions are like Christianity and Islam (Stolz, 2009: 347). An author may put his understanding about religious things to his works. 'Literature going behind God' is an effort of a man in letter by his works in which nuances in religious with his total comprehension of faith , so that he could comprehend fully of his seeking of God, his Creator, and literature is a dynamic, productive, and creative media (Supaat, 2004: 176). Yann Martel puts his idea of religion and religious things into his fictional work, Life of Pi. "Pi is interested in religions: so am I. Pi is open to all faiths: so am I. Pi is comfortable in different Godhouses: so am I. There is a sociocultural component to religions. Just as there are different ways of feeding the body, there are different ways of feeding the soul. Each religion is one group of people's attempt to understand ultimate reality. I think in each one there is a portion of truth and a portion of error. So I see in all great religions the same frame of being, only seen from a different perspective." (http://abcnews.go.com/GMA/Books/story?id=124838&page=5 retrieved on March 7th 2013) Life of Pi mostly presents such unrealistic things and events. The carnivorous trees and an impossible 227 days survival of a boy together with a Bengal tiger floating on a boat in Pacific Ocean seem hard to dissolve by mind. Although these things are in some ways unrealistic, Martel puts Gods and religions ideas into this work. The Author's Note in the beginning of his novel states that the story comes up from a man named Mr. Patel. Yann Martel, the author of Life of Pi, was in India in searching for inspiration here he met a man in a café who then tells him to meet a man with great story i.e. Piscine Molitor Patel. He then says that the story will make him believe in God. Life of Pi is uniquely presenting its adventurous content with religious values and zoology. Yann Martel was intelligently put those different things into synchronized single unit. The coordination of the true story of Mr. Patel told in first person is incredible. The story begins about Mr. Patel's education and working life which serve with the fact that he was a student of religious studies and zoology. Then it shifts to his life when he was a boy, son of a zoo owner. In this part, the story provides facts about some animals' life inside the cage or out there in the wild. The story next progress is story about Pi's religious life when he was in his teen that reveals his strange religious practice. The 227 days survival in Pacific Ocean on a boat with a Bengal tiger is the next part of this incredible story and it is closed with he is survived. This novel once comes up with controversy of its originality. Some critics come up with their idea that this novel resembles Scliar's Max and the Cats, a story about a family of German zookeepers sets sail to Brazil. The ship is shipwrecked and only a young man survives after floating at sea with a wild jaguar. This issue then goes down as a discussion between Scliar and Martel done. But Martel had been firstly mentioned Scliar's name in his Author's Note part of his book. (http://www.sparknotes.com /lit/lifeofpi/context.html, retrieved on February 12th, 2013). This issue affects the outstanding content of this novel. Some critics, however, still appreciate the novel. This novel makes the reader recalls the story of Ernest Hemingway's The Old Man and the Sea Yann Martel was an author of seven awards in literature. His first book entitled The Facts Behind Helsinki Roccamatios and Other Stories was a collection of four short stories published in 1993 deals with themes like illness, the anguish of youth, grief, and loss that blend with the lunacy of 20th century history. This book achieved Journey Prize in Canada. Martel's second book, his first in the form of novel Self published in 1996. This book succeeded to win Chapters/Books in Canada First Novel Award. This novel's theme was study of sexual orientation and identity. Also Martel was the author of a collection of letters to the prime minister of Canada, What Is Stephen HarperReading? (http://Literature.britishcouncil.org/ yann-martel on 17 oct 2012) After the publication of his novel in 2001 Life of Pi, his name was widely recognized by literature world. This novel was able to win five different awards. In 2001, this novel won Governor General's Literary Award for Fiction in Canada and also Hugh MacLennan Prize for Fiction. A year later, it won Commonwealth Writers Prize in Eurasia Region as the Best Book although it won over the shortlist. Also in the same year, Life of Pi was able to get the Man Booker Prize for Fiction that made him create much of literary splash rather than with his first two books and it also won the Boeke Prize in South Africa. As the recent achievement, Life of Pi has been filmed in 2012 and achieved a great success. Martel's works have been praised seven different literary awards although his life began with various odd jobs after he graduated for a degree in philosophy in Trent University in Ontario. He ever became a tree planter, dishwasher, and security guard before he committed in writing at the age of 27. Although he began his life with various odd jobs, his decision to write books after that was a right decision. He got praised for his ability to make multi themes and problems that are not common to be bound in to one. For his ability to combine uncommon multi themes and problems, he succeeded to make Life of Pi to become a novel of great combination of religious values, zoology, and adventurous life. As the opening of the novel, it is told that the novel will make you believe in God. This story reveals Pi's journey of life since he was child until he was mature and graduated from university. This story provides about Pi's religious life which is strange and it affects his understanding about his life and God's destiny for him. The combination of religious theme and zoology of the novel is purposely done for enriching Pi's religious life portraits. Pi is kind of person with maturity in his mind to combine his understanding about God of his religions towards the objects around him although he is still young. As human life is divided into four divisions (Tracy, 1920: 10) in which the first period is the period of childhood. The second is period of youth where this is the period of procreative function to the process of self maturing. The next period is the period of manhood and the last is the period of decay that is being dead. As the character of Pi in Yann Martel's Life of Pi is in the second period of life, he experiences great things in his religious life. In his adolescence that is ranged from 12 up to 24 years of life, Tracy (1920: 187) points out that, youngsters seek for spiritual meaning in religion as well as from the objects of nature, events, and their relationship with other fellows. Piscine Molitor Patel or Pi is originally a Hindu. He lives in a Hindu neighborhood when he was kid until he is adolescence. His religious practice has become strange when he meets two religious people i.e. a priest and an imam. Thus, this introduction constructs his understanding about other religions, Christianity and Islam. His decision to commit three religions, Hinduism, Christianity, and Islam simultaneously is also influenced by Bapu Gandhi who said that the most important thing is to love God. Pi has a strong love towards God although he is still a young man. Pi is having a disliking towards his biology teacher who does not believe in God's existence. Pi sees the doubt on the important of religion and the existence of God as just a while. Every man will pass it someday and reach a happy life. Although Pi is still young, he has already experienced his deep feeling about being religious and to religion itself. The feeling creates him to experience religious flaming. This deep religious feeling or religiosity happens in his teen. His religious feeling seems have mutualism with his personality as adolescence. His life whether they are individual or cultural and social more or less influence personality and affect his decision in understanding religions as the way to love God and being a religious on his multi religions practices. This religiosity that is seen from his religion combinations stresses the importance of individual factors, including social background and personal history. Those backgrounds are to build up his mind of committing three different religions at the same time. Thus this study is to reveal the form of his religiosity in the novel and the influencing factors. RESEARCH METHOD The source of this study is taken from a novel by Yann Martel, Life of Pi reprinted and republished in New York in 2012. The data collection is by analyzing the quotations, phrases, dialogues, or monologues in which reveal thought, speech, action, and attitude that reflects the idea of religiosity of the main character, Pi, from the novel Life of Pi. This study of religiosity will be applied by the concept of religiosity with its components, modes, dimension, orientation, and changes that often experienced by people. The religiosity used to determine and explain about the main character Pi issues of religiosity. To analyze the background of his commitment, it is used psychology of adolescence concept that consists of several psychological points of view about relationship between adolescence and family and religious life of adolescence. Close reading of the novel is done first to determine the major issue of it. The major issues are collected and proposed into a topic of the study by seeing the conflict, the monologue, the dialogue in the novel. After the topic is already decided, it is tried to figure out what should be analyzed with the topic. Thus it is collected two statements of problems. There are the depiction of Pi's religiosity and the factors that influence his religiosity. The next step is searching related information about concept of the topic and to figure it out, it is used religiosity concept and theory of psychology of adolescence for the analysis and the conclusion. CONCEPT OF RELIGIOSITY Religiosity is a concept that has a bound with religion. This concept of religiosity can be defined in some definitions that relate to the religion itself. Supaat (2008: 175) defines religiosity as an aspect which lies inside the deep heart, flaming in the inner heart, personal attitudes which more or less are mystery for the other people, because are based on intimate psychology i.e. universal totality, that includes human's ratio and feeling, inside the personal being. This religious attitude is pointed on personal side of an individual toward his God, and having attitudes as what God wants. Stolz (2009: 347).continues with religiosity is when an individual prays, sacrifices, believes, loves or fear his god. Religiosity can also be defined as participation in religious rituals, various behaviors, and attitude in group or society by an individual (Theodorson, 1969: 345). Rituals are usually what a religion tells the adherents to do. Whitehouse (2004: 4) explains rituals as actions that have lack of intrinsic meanings although there are possible interpretations or symbolic motivations that may be the background of the rituals. Although these actions are lack of intrinsic meaning, the ordeals are ritualized and the speculation of their significance and meaning are still present. Focusing on implicit motivations of people doing the behaviors has some tactical merits (Whitehouse, 2004:24). The explicit religious concept that ethnographers interpret is often difficult to differentiate that the concept is the interpretation of the ethnographers or the people's actual explicit religious concepts. The other reason is from the psychological point of view, implicit concepts are better predictors of behavior. The people can also be manipulated to do the actions because they are not consciously aware and will of their response to the stimulus. This leads to explicit reason to do the behaviors instead of the real motivation of them. The explicit knowledge is likely consisting of post hoc rationalization rather than a guide of the motivation for the behavior (Whitehouse 2004: 25). On the contrary, Fazio stated in Whitehouse (2004: 25) says that the conflicts between the implicit concept and explicit concept are not always true all the time. He says that explicit belief can also be a guide to the motivation. People who do the same ritual procedures regularly results in habituation. Those automated habits can make the people to have less reflection of the symbolic meanings of the rituals (Whitehouse, 2004: 6) for example in religious speech. People can be feeling bored of the doctrinal repetition. Rituals are the main things to do in order to get merits and not being sinful. As Tracy (1920: 183) stated that religion involves man's attitudes towards the Supreme Being without age differences and the main thing is to do positive attitudes towards the Being. To support these, an adherent often does various behaviors like fasting and to behave or keeping his or her good attitude by helping other people and doing good things. God is the invisible but owns the highest power and attitudes towards the Being, as sacred and profane. Durkheim (1915: 37) states that there are two divisions of world. They are sacred in which is the one containing all and profane which is the other all. These are the distinctive characteristics of religious thought. Sacred thing is not only about the personal beings called gods and spirits but a rock, a house, a tree, or anything can be sacred. Profane is what relates to daily life experience of human beings. For example, it is about someone's attitude that results in sins or the way a religion teaches human being to have a meaningful life by giving charity and helping one another so it will result in man's goodness. The representations which express the sacred things, the virtues and powers that they have, or the relation with profane things are like beliefs, myths, dogmas, and legends (Durkheim, 1915: 37) As well as Theodorson, Tarigan (2007:11) supports that. The definition of religiosity for him is as the human attitude which comes from God's blessing. God blesses human to believe in God, to enjoy modest life, to give charity, to help other people, to be lovable, and to be friendly. Because of the participations, behaviors, and attitudes based on particular religion that an adherent must do, sometimes these will cause strain to the adherents. They may feel under pressure because if they are not doing them, there will not be merits that they will get but sins and being afraid of God. God is someone who watches you to see that you behave yourself. (Powell, 1963: 289) The concept of religiosity is also generally accepted as multidimensional phenomenon. The phenomenon happens in the society related, influenced, or caused by many dimensions. The dimensions come from cultural, social, or individual contexts. Religious as the result of practicing and believing religion is also influenced by the religion's system of beliefs, rituals, and practices. Thus, individual actions are often influenced by the religion. Because of factors like afraid of being sinful person or to be considered as a religious person, adherents may do more than what a religion tells. This actualization of excessive religious, religiosity (Concise Oxford English Dictionary Eleventh Edition), besides to show that they are religious by doing it excessively, it also can be deviated from the real doctrines. It is agreeable that religion has to do with the relationship between man and his Maker or specifically it is the relationship between man's attitudes towards whatever he believes to be the owner of the highest power in universe (Tracy, 1920: 183). Because of the existence of attitudes, it needs to differentiate religion and religiosity although they bound each other. Religiosity is something that adherents do from what a religion orders. Then, religion defines as follows A religion is a set of meanings and behaviors having reference to individuals who are or were or could be religious. (Ferm, 1959: 647) The statements means that a religion is a container of what an individual must do or must not do either the individual is religious, was religious, or could be religious. Thus, it is only a term that contains all formal or informal religions in the world (Ferm, 1959: 647). Religion is the institution of godness which is unified system of beliefs, rituals, and practices that typically involve a broader community or believers who share common definitions of the sacred and the profane. (freebook.uvu.edu/SOC1010 retrieved on 18th October 2012) Supporting Ferm, Evans (1978: 305) has a definition of religion in which also has relationship between things or power which are uneasy to explain. Because religion freely allows a man to relate himself to the outer power that cannot be explained with science, quality and intensity of man's religiosity of his religion can be low or high. A man considered himself as religious man not only because he believes on religion , he can be considered as religious without doing religion's doctrines or a man who does it but is considered as not religious one as explained as follows that it needs a deep understanding to consider a man as religious person or not. To be religious is to effect in some way and in some measure a vital adjustment (however tentative and incomplete) to whatever is reacted to or regarded implicitly or explicitly as worth of serious and ulterior concern. (Ferm, 1959: 647) Supaat (2008: 175) stated that someone who is religious is defined as human being who has serious inner heart, pious, careful, and with deep spiritual considerations. GENERAL COMPONENT OF RELIGIOSITY For the social psychologist, religion has five main facets. They are the ideological or beliefs, the ritualistic or practice, the experiential or feelings, the intellectual or knowledge and the consequential or effects (Watts and Williams, 1988: 10). These facets bound into one dimension of religiosity. On the other hand, Duke (1988) defines the general components of religiosity seen from social psychologist are knowing or cognition, feeling or affection, and doing or behavior. Knowing or cognition is abstract. Knowing about things that are related to religiosity and religions are inside every man's mind. This is an ideology. The people believe what he believes that the things are true and good for him. Because ideology is only idea in this context in idea of religious things, the only thing that can be seen from this is the realization of this belief in the real world. For example a person believes that a religion is true. People cannot see his belief but can only see how the person shows his belief true religious doings like doing rituals. The feeling or affective is the feeling dimension of religiosity towards the social situations. The social situations contain things that God has created. Human being, animals, plants, goods, or institution are the creation of God. People who have religiosity are feeling grateful of the existence of His creations. Doing or behavior is the action of showing religiosity. This action aims to get positive effect. Religious doings are the realizations of religion as ideology and the feeling towards the God and His creation in the world. The behaviors are like attending religious rituals like servings God as a duty, studying about religion as the feeling to enlarge his knowledge and religiosity to his God, doing charity as the praise for his sufficiency and love feeling towards fellow, and helping the others to tighten the fellowship. In the matter of religious behavior, cognitive scientists more or less ignored the roles of explicit religious ideas and sentiments as the motivations of people doing the religious behavior (Whitehouse, 2004: 24). Boyer stated in Whitehouse (2004: 24) says that people are feeling the compulsion to participate in rituals because the natural environment often produces contaminants so the people use the rituals as the detection of and protection against them. These specializations are actually just normal cognitive systems. Of these components of religiosity, many researchers still hopes for more developed ways to measure religiosity of someone that the participation in institutional religion because there are differences in religious attitudes and experiences between dominations and between different people with the same denomination and there are fact of the equivalency of average attendance figures (Watts and Williams, 1988: 11). Some people may define themselves as religious in some sense although they play no part in organized religion. From a survey on religious scale items from Independent Television Authority Survey stated in (Watts and Williams, 1988: 11), individuals scored high on religiosity because they classified themselves as very religious or fairly religious, are certain that having some religious beliefs lead a good life, without belief in god life is meaningless, religion helps to maintain standard and morals of society, there is God, god watches each person, are very likely to think of god when they are worried or happy, religious belief affected their everyday lives. MODES OF RELIGIOUS INVOLVEMENT Individual participation on religion consists of two modes of religious involvements. Duke, in his journal, states that the modes are personal mode and institutional mode. The personal mode is built of religious beliefs, feelings, and behaviors. These are found in personal and individualized religion. The person accepts doctrinal orthodoxy from the cultural society around (Duke: 1998). In institutional mode, the religious beliefs, feelings, and behaviors are found in formalized and institutionalized religion. This mode accepts them in which related to religious rituals and worship services like in a particular church or other religions. While Duke divides an individual involvement is a religion as personal and institutional mode, the others like Davidson stated in Duke, separates it to private and public modes. RELIGIOUS ORIENTATION People's interest toward particular religion that makes them religious depends on their own decision. It is whether they are extrinsically or intrinsically oriented (Allport, 1967: 144). Allport's point of view of extrinsic religious is caused by outer reasons or influence. The reason why an individual is committing religious acts aims in seizing mundane goals like feeling comforted and protected and also is like to get a social status and approval. To measure an individual religiosity based on extrinsic orientation is by seeing the influence given by peers, family members, or professional workers. Durkheim demonstrates how process that influence by society motivates individual action. The only source of life at which we can morally reanimate ourselves is that formed by the society of our fellow beings; the only moral forces with we can sustain and increase our own are those which we get from others. (Durkheim, 1915: 425) It is different from intrinsic orientation which assumed without achieving a mundane goal even self denying quality as the reason of religious involvement. This orientation arises from the goal of the contents of the religious tradition itself. To measure this orientation is by seeing the personality. CHANGE IN RELIGIOUS COMMITMENT AND PARTICIPATION Life events relate to religiosity. Peter Berger stated in Cornwall (1998) states that plausibility structures i.e. family, church, or voluntary organizations and conversations with the others are important and can give influence to religiosity. Because there are many life events that will influence someone's religiosity, there is chance of the change of his or her commitment and participation in religion. The changes are change in belief and activity over the life cycle, religion disaffiliation and dropping out, religious conversion and reactivation, religious change as personal development. The changing of religious belief and activity can be related to life cycle. Teens or early twenties may have less religious belief and activity than they who are in late twenties or thirties. This changing is caused by several backgrounds like family backgrounds, early socialization, and to developmental issues of adolescence and young adulthood (Albrecht and Cornwall: 1998) In religious disaffiliation and dropping out, an individual decides to not join one organization because she or he chooses to join another or decides to stop his religious involvement in the organization. Even though this is action of switching, it does not mean they loose their religious faith. They only choose the best belief for them. Religious conversion has often been defined as a rather sudden process consisting of new religious insight or experience which leads to greater religiosity on the part of individual involved (Donahue taken from Albrecht and Cornwall: 1998). Supporting Donahue, Starbuck (1900: 21) added that sudden changes of character like from evil to goodness, sinfulness to righteousness, and indifference to spiritual insight or activity. In the adolescent period, the conversion is an awakening. The conversion can happen in many motifs: conversion from private investigation of alternative ideologies to highly social, emotionally arousing experience (Lofland and Skonovd stated in Albrecht and Cornwall: 1998). Starbuck (1900: 49) states that the motives and forces behind the religious awakening is based on the nature of conversion. To study the motives and fears, the people are grouped into their likeness and differences. They are fears, other self-regarding motives, altruistic motives, following out a moral ideal, remorse and conviction for sin, response to teaching, example and imitation, urging and other forms of social pressure (Starbuck, 1900: 49) Religious development changes as the individual goes matures. This maturation process is primarily seen through psychological study without focuses on the impact of normative events like marriage, first job, child bearing, and death (Albrecht and Cornwall: 1998) PSYCHOLOGY OF ADOLESCENCE Adolescence is the second stage of human life. In this stage, adolescents will experience a period of the birth of procreative function until the full maturity of their powers (Tracy, 1920: 10). This stage is begun in the second dozen period of human life. The first dozen period is childhood, the third is manhood and the fourth or the last period is the beginning of decay of the powers until death. In other word, the adolescent period started from the age of 12 years. Supporting Tracy, Goldenson (1984: 17-18) explains further about the beginning of adolescent of girls and boys. He stated that adolescent period of girls is begun when they are 12 until 24 years. Boys have a year later the beginning of adolescence than girls, which is from 13 until 22 years. The period of adolescence is subdivided into two periods but some writers divided it into three. In the three divisions of this period, there are early, middle, and later adolescence. In this division, the beginning of adolescence happens in the four or five first year while the rest divisions follow this. In two divisions, the period of adolescence is subdivided into early and later adolescence. Both are lined when the adolescents are in their sixteen or seventeen years of life. During the period of adolescence, adolescents will experience a period of puberty. Puberty is a period when sexual life is born and it is also the beginning of procreative quality of them. Although puberty will happen to every person, the birth is varied between an adolescent to the other adolescents. This means that an adolescent can have it when he is 12 and the other may have it in his 14. Besides puberty is the birth of sexual maturity, in some civilized people, puberty is a sign of social and religious obligations of individual. … Frequently by some new emphasis on the social and religious obligations of the individual, evidently with a half-conscious recognition of the close association between the racial and the religious life. (Tracy, 1920: 17). The same thing happens to adolescents in Christian Communions. In this community, adolescents are hoped to take new step of their religiousness and begin to take their religious responsibility. This will lead them to the closer and more open relationship with their church. As well as Tracy, Goldenson (1984: 17-18) stated that during this period, adolescence will experience major various changes that have different rates one to the other. The changes include changing of sexual characteristic, body image, sexual interest, social roles, intellectual development, and self concept. Tracy (1920: 18) stated that in the matter of thought and feeling, adolescence is the period of 'deepening'. The feeling of adolescents will experience a flaming where they will find deepest meaning of things. All experiences of them will make them to interpret them deeper and bound them into a higher thought. In this case Evans (1978: 93) supports Tracy. He explained that in period of operational thinking, adolescents will not face conflict in thought process from the concrete to the abstract form. The adolescents will be aware of logical of basic things and the formulation of hypotheses (Evans, 1978: 93). Thus, they will seek for the logical reasons behind some things, conditions, or situations around them then they began to understand them as something that they have known or purposely introduced when they were kid. The mind of the adolescent reaches out to that which is implicated or involved in the presentation. In a deeper sense than ever before, the mind now takes hold upon the ideal, builds castles, lays plans, and indulges in day dreams, with all kindred psychic adventures (Tracy, 1920: 18) The feeling of adolescents will be richer than when they are children. This will also become actual. The combination of feeling, thought will result of the birth of emotion. Adolescence has primary emotions. They are love, fear, anger, and curiosity. The adolescence does not learn the emotions. The emotions are inborn. Other emotions are built on those primary emotions. Love is a feeling of strong affection or attachment. This emotion makes adolescence concerns for someone or feels delight in an object, person, or situation. This primary emotion builds some secondary emotions like affection, joy, pleasure, and delight. Adolescence will feel alone and insecure without love. Fear is an emotion which ranges from worry. Hurlock stated in Kapunan (1971: 55) categorizes fear into three: fear of material objects, like animals, airplane, elevator; fear of social relationship, like being alone, meeting people for the first time, making a speech; general fear, like poverty, death, darkness, physical incapacity, marriage. Gates and Pressey stated in Kapunan (1971: 56) say that fear has positive values. Fear causes someone to be cautious and careful, thrifty, sober, and the fear prevents one from doing wrong. But, fear also can make one from going a head and can lead to failure. There are three ways to overcome fear. They are forewarning in which the adolescence should be cautioned of something they are afraid of, assurance in which they are told that nothing is to fear, and to live the experience. Some secondary emotions of fear are moods, anxiety, and worry. Anger is an emotion from resentment to rage. This emotion is caused by inability to do or get what is wanted. It may be being teased, treated unfairly, and being bossed. The expressions of anger are like disobedience, resistance, sneers, threats, satire, gossip, or oral attack. This anger also has positive effect. This can make one accomplish more, make one pause and re-examine his practices and limitations. Curiosity is the beginning of knowledge and learning when one starts asking question. This interest or curiosity makes children being aware of the changes around them. This makes their interest aroused. The birth of emotions of adolescence makes the adolescents becoming aware of the combination of those emotions. After that, the action rises. When children's action is imitative, habitual and automatic adolescents' action will be less imitative, habitual, and automatic. It will be controlled by the will although it is not fully controlling the action. It is because their intelligence control is spasmodic and intermittent. FAMILY AND ADOLESCENCE Family condition whether it is related to the parents' attitudes influences the attitude of adolescence. Since many of attitudes or values own by children are well structured in their eight or nine years that are difficult to change, this means the home environment is the primary factor involved in structuring them. Powell (1963: 266) added that although parents have strong role of structuring children's attitudes and values, the home environment also influences them. It is including children's observation of his parent's interaction with each other and with other adults. According to Warnath in Powell (1963: 267) home is the place for children of learning developmental social skill and the desire to participate in activities related to other individuals. THE RELIGIOUS LIFE OF ADOLESCENCE Everyman is basically a religious being. They are capable of religion not at this age or that age. They are always capable of this. Although everyman's naturally religious, they are not capable of it in the same sense. It is not also the ideas and feelings towards a religion are the same in every man. An immature man does not have the same things as a mature man has of the ideas and feelings. It can be said that child's capability of religious experience is not the same in form and content as youth's and adult's. Since religion is a matter of thinking, feeling, and acting, children who are not mature, they themselves have intellectual power over their feeling and behavior (Tracy, 1920: 186). As long as they are given early introduction to God, their life is genuinely religious (Tracy, 1920: 186) as they easily absorb things around them. Thus, the character of children's religious life is based on their mental life and this progress. As everyone knows, child absorbs things around him but without the knowledge of his sense. Although the child tries to look deeper about the knowledge he gets from his surroundings, there is not larger degree of understanding that he will get. Although child may comprehend and speak bout the un-sensed for example the unseen and untouched things, there is not understanding about it. They only know that they can see the unseen if they have keener vision and where to look them. During childhood, children are told that God sees them but they cannot see God and God is near to them but they still cannot see God. They may ask such questions but without understanding. Thus, they will be satisfied to any answers given to them. Religion of child and the religion of youth have much in common but there are still features that differ one from another. The religion of youth is more subjectively personal than the religion of children. Religion of children is natural religion but the youth's is spiritual religion. Youth tries to find spiritual meaning of objects, events, and relationship of human life. Religion influences moral values as well as social attitudes not only for adults but also children and adolescents. Children know about religion early from the one closed to them like from parents. Since the children's religion is natural, as long as they are given early introduction about this, they will likely be religious. This differs to adolescent. Early introduction to concept of religion that is relationship between God and man often creates conflict in adolescence. They begin to question the concepts they have absorbed (Powell, 1963: 284) because they start to find out the hidden meaning of something, like no children. For in childhood there is a simple, direct response to the impressions of the environment, on the sensori-motor reflex plane, without the possibility of the deeper and stronger emotions, and with a minimum of logical interpretation or critical analysis. In youth this naive outlook gives way by degrees to one in which the subjective elements play a more prominent part, with the simple feelings giving place to the profounder emotions, mere sense-perception being supplemented by the more ambitious processes of cognition, and the instinctive and habitual motor reactions by deliberate choice and higher volition. (Tracy, 1920: 189) Adolescence is an important period of dedication in participation of organized religions in the world even in primitive form (Ferm, 1959: 378). Ferm also states that When the religious nurture of childhood must issue in personal commitment if significant religious maturity is to follow (Ferm, 1959: 378) Tracy (1920: 191) distincts two distinctive features of adolescence's religion. The first are the experience of intellectual doubts and difficulties whether it is accompanied by emotional tension and upheaval or not. The second is the experience known as conversion. Doubts and difficulties are related to religious questions. As children is very dogmatic which means they greatly absorbs what others say and answer based on questions that they ask, the mind of adolescence begins to criticize that. Ideas which have heretofore dwelt side by side in consciousness without any sense of clash or conflict, may now reveal to the more alert mind of youth certain incongruities and contradictions. (Tracy, 1920: 193) If the adolescence cannot deal with the idea that they have with the reality that they face, there will be conflict which leads to doubts of what they have believed. In some researches stated by Powell (1963: 286) relating to loss of religious interest with adolescent, show that young people do not loose 100 percents the interest of religion but they do not seem feeling satisfied with traditional religious belief and ritual. In this period, he added that confusion seems to happen that may lead to guilt feeling. Family environment which is included attitudes of father and mother influences the development of young people's religious attitudes, Parents often give their children with strict adherence to specific religion. This habit can make confusion to the children when they come to a more liberal home (Powell, 1963: 286). However, children with less religious even irreligious parents will make them insecure and envy of seeing their classmates involved in religious experience denied them. A better point of view of religion will be in the attitudes of children whose parents are religious and liberal. These combinations seem to make result in developing more mature religious views (Powell, 1963: 288). According to Allport cited in Powell (1963: 290) religious sentiments occur from needs, interests, temperament, rationality, and cultural response. Young people seek for new experiences, awareness of the presence of God, to be useful and unselfish, to participate responsibly, and become members of a wholesome fellowship (Powell, 1963: 291) Kuhlen and Arnold cited in Powell (1963: 289) agrees that religious beliefs become increasingly abstract with the increase of age. The more age he has, the more likely he becomes religious. For many adolescents, leaving religious practice is temporary since they will enter their adulthood that makes them likely to become affiliated with religious practice. DEPICTION OF PI'S RELIGIOSITY Three general components of religiosity are depicted by Pi. The depictions are Pi's knowing about God's existence, knowing about religion, feeling grateful of animals' existence, grateful of goods' existence, Pi's doing like serving God through personal prayer, committing three religions, loving the fellow, and loving animals. As adolescence, Pi has knowledge about the great power of God. Pi thinks that it is only a very serious disease that will kill God. What is meant by serious disease is a real serious disease that infects a human being. Pi thinks that God, the Supreme Being who has super power over all things in the world will not die or never dies because of thing like suffering disease like a man can. God is the creator of human being and all other creatures in this world. He disagrees with his teacher's opinion that God died during partition in 1947. He might also die during the war or when he was in orphanage. Pi believes and knows it so he thinks that it is an impossible thing for God to die that way like a human being does. He also thinks that if God's existence in a man's heart is dead, this condition will lead to terrible things. In other words this is a very dangerous condition. Pi states this because he does not want God disappears from every human being's heart. He compares the terrible things that will happen because of that condition with terrible disease. He attempts to say that the effect of both things towards human beings and other creatures in the world is vey dangerous. Someone who suffers a not-dangerous disease still can infect the people around him then imagine if the disease is terrible. This will have greater effect towards them. Then, if someone does not recognize his God anymore, this will make destruction. For example, if human beings are the highest God's creature compared to animals and plants do not have God inside their minds then the God's blessing like mercy towards the other will be lessen and the worst is disappearance of that. If the people do not have mercy anymore, they will damage the environment. Relating this to Pi's life that is closed to animals, Pi knows and believes that by keeping God inside his heart will make the world and its contents peaceful. Pi has a positive point of view of religion. For him religion is light. The light will guide human beings to the right way along their life's way. When Pi met his teacher, Mr. Kumar at his father's zoo, Pi was so happy to see him there. Mr. Kumar said that he often went to the zoo and thought that other people might think that it was his temple although he was indicating to the Pit of goats' and rhinos' cage. He later talked about politic that lead to religious debate between him and inside Pi's heart. Mr. Kumar thinks that the world will be peaceful if the politicians are like the goats and rhinos. But the real condition is reversed. Pi does not know anything about politics although his parents often complained about Mrs. Gandhi. He bluntly said that religion would save them. After Pi mentioned that they will be saved by religion from the political condition that was terrible, Mr. Kumar's response was not very good. He admitted that he did not believe in religion. He thought that religion is darkness. He thought that there were no grounds for believing thing like that. He only thought that religion was a superstitious bosh. He did not believe in God's existence. Hearing this Pi was only thinking that Mr. Kumar was only testing him for his knowledge of religion. He thought that he was like purposely saying that mammals lay eggs. After that Mr. Kumar is an atheist was in his mind. He was then surprised when he was told that God may have died somewhere some when. Although he was surprised of this, Pi did not hate the fact that Mr. Kumar is an atheist but Mr. Kumar's agonistic made Pi upset. Mr. Kumar spoke that God never came when he needed Him. When he was Pi's age, he was racked with polio. The God never came and saved Him but the medicine did. Pi did not respond anything about it although it was a bit much for him. Pi chooses not to argue with Mr. Kumar not because of his anger but more afraid of loosing someone he loved. The depiction of Pi's gratefulness of animals' existence is found when he was in the zoo. Pi's father was the owner of a zoo in Pondichery. He was feeling very happy of growing up in a zoo. Almost every animal in the zoo left an impression to Pi. In some case, Pi did not have to depend on his activity to the mundane thing like alarm clock for example. Pi did not have to have the clock because he could use the voice of animals around him to wake him up, to remind him for breakfast. He used the roar of a pride of lion who usually roar off between five-thirty and six every morning. The loud voice of howler monkeys punctuated his breakfast time. The animals in the zoo also give Pi a happy feeling. Besides from his mother's gaze, he also got a benevolent from bright-eyed otters, burly American bison, and also orang-utans. Pi was living his life as prince who had the fondest memories of living in a zoo because of the animals. The animals brought him advantages. From morning until dark, Pi was always welcomed by them. Every animal in the zoo has different characteristics, habits, and action. There are animals which voices are very disturbing but there are animals which are not. The habits or the actions of the animals whether they are annoying or not, has brought him to think that they are the graceful gifts from God. Seeing their action made Pi feeling as a lucky boy. Pi has always been feeling grateful of what God has given to him. Once when he is in trouble when floating on the Pacific Ocean, he finds goods that will make him survive. Although he is in trouble, he still remembers about the relationship of the goods' colour with one of the religions he has committed. In Hinduism, saffron is the most sacred color for the Hindu. This color represents fire and symbolizes purity. Wearing this color symbolizes the quest for light. If this color is related to what Pi finds in the lifeboat, this means the goods are source of light for Pi. The light is his survival from the fear. The boat makes him safe from the Pacific Ocean beneath him and the tarpaulin separates him with his Bengal tiger. At first, Pi does not think that the goods he has found will become his lifesaver. But, he then thinks that with the lid, he is separated from Richard Parker. This means he is protected from carnivore that is in the same boat with him. He is feeling grateful of that. Then if the tiger is managed to attack Pi from below, he should push the lid and it will warn him and make him fell backwards to the water. And here it is the function of the lifebuoy. The existence of the goods has caused joyful feeling for Pi. He even cannot compare them with all giving occasions that he has experienced before even the occasions bring great pleasure. Although Pi is floating on the Pacific Ocean, he still does prayers. Pi does the religious rituals adapted to the circumstances. He does all three religions rituals he commits. Pi still does the prayers because he has felt that doing prayer will bring him comfort. But, in practice, doing prayer is very hard for him. He thinks that to have faith in God is difficult. He has to have an opening up, trust, and act of love towards God. It is because he is not in a save condition. There are dangerous problems that he faces on the ocean. He sometimes fills with anger, desolation, and weariness. He is angry at the God who puts him in this kind of situation. In that kind of situation, Pi ensures himself that everything around him is God's, even the hat he is wearing, the attire, the cat, the ark, the wide acres, the ear. Pi has a very strange religious practice. Although he is still adolescence, he has already practiced three different religions. They are Hinduism, Christianity, and Islam. At the age of fourteen years old, Pi meets Jesus Christ and becomes a Christian although he was born Hindu. He is admired by the God's Son's sacrifice. He willingly sacrifices Himself for the goodness of humanity. He pays the humanity sins. The reason is because of love. Although Pi is a Hindu, he also commits to Christianity. He does both Hindu and Christian prayers even right after becoming Christian. Pi commits to Islam a year later. Again he is introduced to Islam by a professional worker. He is a Sufi who is a Muslim mystic. His name is Satish Kumar, person with the same name as his biology teacher. Pi is attracted to Islam because of the brotherhood and devotion that are told in Islam. Pi also feels good when he brings his forehead to the ground. He feels a deep religious contact then. After all those introductions to new religions, Pi practices all of them. Pi's love toward the fellow is depicted through his relationship with his biology teacher. Although Pi is born Hindu and is a well-content Hindu, he still respects anyone who does not have the same faith with him including his biology teacher, Mr. Satish Kumar. One day Pi sees Mr. Kumar in the zoo. He is a regular visitor of the zoo. When he is visiting zoo, he always reads labels and descriptive notices of every animal. He feels scientifically refreshed after visiting the zoo. In the zoo Mr. Kumar and Pi have a talk about political things in India. Mr. Kumar imagines if they have politicians like two rhinoceros and a goat, that live together in harmony that they are watching, India would not have faced many problems. Then Pi says that religion will save them. Mr. Kumar's response is out of Pi's mind. He thinks religion is darkness and God does not exist. Pi is surprised about this. Pi only thinks that he is testing him. But it is not. Mr. Kumar is an atheist, someone who does not believe in God's existence. Although Mr. Kumar's point of view about religion and God is not the same as Pi's, he still accepts this. He only thinks that anyone has doubt like Christ who ever doubts God for forsaking Him. Pi still makes Mr. Kumar as the reason he choose zoology as one of his major in university. Because he is the first atheist person that Pi meets, he is able to think that atheists are his brothers and sisters. He considers Mr. Kumar as a person of blood-relationship with him no matter what faith he has. The faith is their faith. They are free for it like Pi himself. Pi's love towards animals has made him to become a vegetarian. When Pi is in trouble finding the source of food on the boat on Pacific Ocean, he is finding many flying fish, Dorado fish, have flown into the lifeboat. He is finding this event as happy event because Richard Parker has had some food supplies to fill its hungry stomach. Pi also takes one of the fish. He covers the fish with blanket in order to not make him hurt. After that, he tries several times to kill the fish but he could not complete the action. Pi cannot make it because he feels pity of the fish. He even feels a bit responsible of the rat's death because he threw it to Richard Parker. To kill the fish, he thinks that he is between the affection feeling towards animals and the need to have meal. In his lifetime, he is a vegetarian. When Pi has been succeeded in killing the fish, the tears come down his cheeks. He cannot feel the life fighting anymore. He feels sad knowing that there is blood on the fish. Although fish is a common animal that human even other animals eat and they rarely think that the fish is a creature that has soul, Pi's aware that there is soul inside the fish. He is very sorry toward the soul living things that he has killed. The fish cannot enjoy its life anymore. Pi thinks the fish and him are the living creation of God. They should not kill each other. Because he loves it, he is feeling guilty. Then, he promise to pray for the fish in his prayer. FACTORS INFLUENCING PI'S RELIGIOSITY The religiosity of a person can be begun since early life of that person. This can appear to the mind of people when they are children. Not all people will experience religiosity since in their early age. Usually the forms of religiosity are based on religion. The moral values and social attitudes of the people will be likely influenced by it. Early introduction of religious things to people are mostly from the people around them but this religiosity can also come from inside the individuals. The factors that influence religiosity of Pi are family's influence, professional workers' influence, needs, interest, and rationality. Pi's religiosity comes from the influence of his parents because they are the closest figure for the children. Although Pi is from Hindu family, he defines his father as person who does not have strong belief about religion. He later explains that all new animals in the zoo owned by his father are blessed by priest. In the zoo there are also two small shrines. They are to Lord Ganesha and to Hanuman. But, the reason behind this is only to please the zoo director. His father thinks the existence of the shrines is good for his business to build a better relationship with the public, not personal reason like personal salvation for him. It is true that Pi is religious because he has been falling in love with Hinduism. But, the children's mental life grows. Pi sees his father as a less or lesser religious than him. Then he might think that committing two new other religions is okay for him. Because of this reason, he begins to think it won't be any problem with my family if I commits to these new religions. Besides of the religious life of his father, Pi also feels that when he was kid, he has never prohibited reading comic and other papers that contain anything about gods of any religion. Pi thinks that his mother was pleased to see him reading any books so long it was not naughty, because she herself is a big reader. Professional workers have a great influence towards Pi's religiosity. Pi was originally a Hindu because he was born in Hindu family. During his childhood, he was familiar with everything about Hinduism. Later on when he enters his adolescence period that is in his fourteen years old, he begins to know about Christianity. Pi is on a holiday trip in Munnar. In Munnar there are three hills. The hill on the right has a Hindu temple, the hill in the middle has a mosque, and the left hill has a Christian church. Pi is a school boy who attends a Christian school but he never goes inside a church. Then, because of curiosity he decides to hide around a corner of the rectory of the church because he is afraid. Inside the church he sees a figure, a priest who is sitting quietly and patiently waiting for anyone who wants to talk to him. On the next day he manages to enter the church and is welcomed by the priest, Father Martin. Pi thinks he is very welcoming. In that church he was told some story about Christianity including God's son who was willing to pay the humanity sins. Pi cannot accept this. He always questions this thing to Father Martin. He always answers it is because of love. Pi does not feel satisfied of the answer. On his last day in Munnar, Pi decides to come to the church again. At first he thinks that the priest is not in but he is. He says to Father Martin that he wants to be a Christian. He says that Pi already is. Before Pi leaves, he finds Father Martin smiling to him. It is the smile of Christ for him. From these, Father Martin's patience and kindness to give explanation to Pi and answers his questions too have made Pi to feel that Christian is not as what he thinks as people with great violence. He has seen the sincerity of Father Martin. He is feeling comforted about what the man is telling. These makes him understands about the religion and finally commits in it. Another professional worker that influences Pi to Pi's religiosity is an imam of a mosque in Mullah Street. At that time, Pi is also in his adolescent period. He is sixteen years old when he knows Islam. Pi actually does not have good impression about Islam. Islam has a reputation worse than Christianity. Islam has fewer gods but greate

Collected data and research material presented in the monograph are a result of financing of the Polish science budget in the years 2011−14; the research project was financed by the National Science Centre according to decision no. DEC-2011/01/B/HS4/04744. The project that resulted in this monograph was financed from public funds for education for 2011 − 2014, the National Science Center under Contract No. DEC-2011/01/B/HS4/04744. ; Value-Based Working Capital Management analyzes the causes and effects of improper cash flow management between entrepreneurial organizations with varying levels of risk. This work looks at the motives and criteria for decision-making by entrepreneurs in their efforts to protect the financial security of their businesses and manage financial liquidity. Michalski argues that businesses exposed to greater risk need a different approach to managing liquidity levels. The scientific aim of this monograph is to present the essence of financial liquidity management under specific conditions faced by enterprises with risk and uncertainty. Enterprises differ from one another in risk sensitivity. This difference affects the area of taking decisions by the managers of those enterprises. The result of interactions between levels of liquidity and sensitivity to risk affects the managers of such enterprises (Altman 1984; Tobin 1958; Back 2001; Tobin 1969). In this monograph the research hypothesis is the claim that enterprises with a higher sensitivity to risk are very different from enterprises with a lower sensitivity to risk, resulting in a different approach to managing their working capital. Enterprise managing teams react to risk, and this reaction is adjusted by an enterprise's sensitivity to risk. Because of its subject area, the book will address the issues of corporate finance. The monograph discusses the behavior of enterprises and the relationships between them and other factors in the market occurring in the management process under the conditions of limited resources. As a result of these interactions with the market and the environment in which individuals who manage enterprises operate, there is an interaction between money and real processes that in the end are the cornerstone of wealth building. This chapter discusses the objectives and nature of enterprises in the context of their risk sensitivity, as well as the relationships between the objectives of enterprises and the characteristic features of their businesses. Enterprises operate in various business environments, but generally speaking, they all have one main aim: wealth creation for their owners. The realization of that aim depends on an idea of business in which the enterprise is an instrument to collect money from clients of the enterprise's services and products. Business environment is crucial not only for future enterprise cash inflows from the market but also for risk and uncertainty (Asch, and Kaye 1997; Copeland, and Weston 1988; Fazzari, and Petersen 1993). According to the author, it is necessary to include an understanding of that risk and uncertainty of future in the rate that reduces the net size of free cash flows for the enterprise owners, beneficiaries, or more generally stakeholders. Enterprise value creation is the main financial aim of the firm in relation to working capital components (Graber 1948; Jensen, and Meckling 1976; Lazaridis, and Trifonidis 2006). Working capital management is a part of a general enterprise strategy to its value maximization (Laffer 1970; Kieschnick, Laplante, and Moussawi 2009; Lyland, and Pyle 1977). This chapter presents a definition of financial liquidity and liquidity-level measurements. This chapter contains four subchapters that address the specific role of short-term financial decisions, a classification of definitions of financial liquidity, sources of information about liquidity level, and liquidity-level measurements (Lazaridis and Tryfonidis 2006; Long, Malitz, and Ravid 1993; Kieschnick, Laplante, and Moussawi 2009). Financial liquidity definition and liquidity-level measurements Here we have an opportunity to present the author's opinion on what assets should be financed with short-term funds and what the level of liquidity is in an enterprise (Michalski 2012a). The discussion also pertains to the issue of the dividing line between long-term and short-term decisions, with greater emphasis on the durability of their effects, rather than the decision-making speed. This section also attempts to answer the question: What are the short-term effects of operations under conditions of uncertainty and risk? The reason for the considerations in this section is the need to characterize the decisions that affect the level of enterprise liquidity. The research hypothesis of this monograph assumes that differences between more risk sensitive and less risk sensitive enterprises are seen in liquidity management. Simply because the enterprises, during financial liquidity management, take into account the differences in their risk sensitivity. This chapter discusses the relationship between firm value and business risk sensitivity. The chapter starts with a presentation of intrinsic liquidity value and firm reactions to market liquidity value. This is the basis for target liquidity level in the enterprise. Liquid assets are the main part of working capital assets, so the next part of the chapter focuses on working capital investment strategies and strategies of financing such investments in working capital in the context of firm value creation. The chapter concludes that, from a firm-value-creation point of view, more risk-sensitive entities should use flexible-conservative strategies, while less risk-sensitive entities have the freedom to use restrictive-aggressive strategies. In the context of a crisis, this is the clear answer and explanation for higher levels of working capital investments observed empirically during and after a crisis. The determinants of intrinsic value of liquidity are attributed to liquidity by enterprise management. Enterprises in which financial liquidity has a high internal value will have a tendency to maintain reasonable liquid resource assets at a higher level. The levels of stocks of funds maintained by enterprises are also the result of the relationship between the liquidity market value and the intrinsic value of liquidity. It demonstrates how to approach the estimation of liquidity and presents the market value of liquidity. Having connected this information with the knowledge of manifestations of the internal liquidity, we can offer an explanation as to why the target (and also probably the optimal) level of liquidity for enterprises with higher-than-average risk sensitivity is at a higher level than the corresponding target (optimal) level for enterprises with a lower level of risk sensitivity. Working capital value-based management models In this part of the monograph we discuss the items contained within the cost of maintaining inventory. Using this approach, a model of managing inventories is presented. Theoretically, the value-maximizing optimal level of inventory is determined to be the modified EOQ model, presented as VBEOQ model. We also present an outline of issues associated with the risk of inventory management and its impact on the value of the enterprise for its owner. We also discuss the principle of the optimal batch production model and how the size of the production batch affects the value of the enterprise for its owner. Here also is demonstrated a modification of the POQ model: VBPOQ. The proposed modification takes into account the rate of the cost of capital financing and the measures involved in inventory when determining the optimal batch production. When managing the commitment of the inventory, it is crucial to take into account the impact of such decisions on the long-term effectiveness of the enterprise. This chapter also discusses the relationships between the management of accounts receivables and the value of a business. A modified (considering the value of a business) model of incremental analysis of receivables is presented, as is a discussion of the importance of capacity utilization by an enterprise for making management decisions pertaining to accounts receivables. Issues related to the management of working capital and enterprise liquidity are and will be an area of research. The analysis in this study focused primarily on working capital and liquidity management; understanding its specifics will facilitate the management of liquidity in any type of organization. Working capital as a specific buffer against risk has its special role during a crisis and can serve as a good forecasting indicator about future economic problems in the economy if a whole business environment notices higher levels of working capital and its components, like cash, inventories, and accounts receivables. The scientific value of the issues discussed in the book is associated with the issue of working capital and liquidity management in enterprises. It is also a result of the exploration and definition of the main financial objective of businesses and the relationship between the objective and the management of working capital and enterprise liquidity. The choice of topic and the contents of research resulted also from empirical observation. Empirical data on enterprises that operate in countries touched by the last crisis document higher-than-average levels of working capital before, during, and after the crisis in these enterprises. These conditions provided the means for a "natural experiment" of sorts. From that point, working capital management theory faced a necessity of even wider development. ; Collected data and research material presented in the monograph are a result of financing of the Polish science budget in the years 2011−14; the research project was financed by the National Science Centre according to decision no. DEC-2011/01/B/HS4/04744. The project that resulted in this monograph was financed from public funds for education for 2011 − 2014, the National Science Center under Contract No. DEC-2011/01/B/HS4/04744. ; How to Cite this Book Harvard Grzegorz Michalski . (April 2014). Value-Based Working Capital Management . [Online] Available at: http://www.palgraveconnect.com/pc/doifinder/10.1057/9781137391834. (Accessed: 28 May 2014). APA Grzegorz Michalski . (April 2014). Value-Based Working Capital Management . Retrieved from http://www.palgraveconnect.com/pc/doifinder/10.1057/9781137391834 MLA Grzegorz Michalski . Value-Based Working Capital Management . (April 2014) Palgrave Macmillan. 28 May 2014. Vancouver Grzegorz Michalski . Value-Based Working Capital Management [internet]. New York: Palgrave Macmillan; April 2014. [cited 2014 May 28]. Available from: http://www.palgraveconnect.com/pc/doifinder/10.1057/9781137391834 OSCOLA Grzegorz Michalski , Value-Based Working Capital Management , Palgrave Macmillan April 2014 ; Author Biography Grzegorz Michalski is Assistant Professor of Corporate Finance at the Wroclaw University of Economics, Poland. His main areas of research are Business Finance and Financial Liquidity Management. He is currently studying the liquidity decisions made by organizations. He is the author or co-author of over 80 papers and 10 books, and sits on the editorial board of international conferences and journals. Reviews 'Due to the recent financial crisis, interest in the topic of working capital has grown significantly to both theory and practice. The research results presented by Grzegorz Michalski contribute to the development of a comprehensive theory of liquidity management and the creation of an integrated working capital and liquidity for different types of business model. The job is processed on a high quality level." -Marek Panfil, Ph.D, Director of Business Valuation Department Warsaw School of Economics 'The book of Grzegorz Michalski is a very good publication that has found the right balance between theory and practical aspects of financial liquidity management. It is extremely timely and valuable, and should be required reading for all corporate finance practitioners, academicians, and students of finance. Value-Based Working Capital Management is comprehensive, highly readable publication, and replete with useful practical examples. It has also enabled corporate leaders to make better-informed decisions in their efforts to protect the financial security of their businesses and manage financial liquidity.' -Petr Polak, Author of Centralization of Treasury Management, and Associate Professor of Finance, University of Brunei Darussalam ; REFERENCES Introduction Adner, R., and D. A. Levinthal (2004). "What Is Not a Real Option: Considering Boundaries for the Application of Real Options to Business Strategy." Academy of Management Review 29(1). Altman, E. (1984). "A Further Empirical Investigation of the Bankruptcy Cost Question." Journal of Finance 39. Back, P. (2001). "Testing Liquidity Measures as Bankruptcy Prediction Variables." Liiketaloudellinen Aikakauskirja—The Finnish Journal of Business Economics 2001(3). Baker, M., and J. Wurgler (2002). "Market Timing and Capital Structure." Journal of Finance 57. Ben-Horim, M., and H. Levy (1982). "Inflation and the Trade Credit Theory Period." Management Science 28(6), pp. 646–51. Blaug, M. (1985). Economic Theory in Retrospect. Cambridge University Press: Cambridge. Charnes, A., W. Cooper, and E. Rhodes (1978). "Measuring the Efficiency of Decision Making Units." European Journal of Operational Research 2. Cokins, G. (2004). Performance Management: Finding the Missing Pieces to Close the Intelligence Gap. John Wiley & Sons: Hoboken, NJ. Dluhosova, D. (2006). Financial management of firms (in Czech: Financni rizeni a rozhodovani podniku). Ekopress: Prague. Emery, G. W. (1987). "An Optimal Financial Approach to Variable Demand." Journal of Financial and Quantitative Analysis 22(2), pp. 209–25. Falope, O. I., and O. T. Ajilore (2009). "Working Capital Management and Corporate Profitability: Evidence from Panel Data Analysis of Selected Quoted Companies in Nigeria." Research Journal of Business Management 3, pp. 73–84. Hill, M. D., G. W. Kelly, and M. J. Highfield (2010). "Net Operating Working Capital Behavior: A First Look." Financial Management 39(2), pp. 783–805. Hirshleifer, J. (1958). "On the Theory of the Optimal Investment Decision." Journal of Political Economy 66. Huyghebaert, N. (2006). "On the Determinants and Dynamics of Trade Credit Use: Empirical Evidence from Business Start-Ups." Journal of Business Finance & Accounting 33(1). Ijiri, Y. (1978). "Cash-Flow Accounting and Its Structure." Journal of Accounting, Auditing and Finance 1(4). Kaura, M. (2002). Management Control and Reporting Systems: Harmonising Design and Implementation. SAGE Publications, Response Books: New Delhi. Khoury, N., K. Smith, and P. MacKay (1999). "Comparing Current Assets Practices in Canada, the United States and Australia." Revue Canadienne des Sciences de l'Administration 16(1), pp. 53–57. Lumby, S. (1993). Investment Appraisal and Financing Decisions. The Chapman & Hall Series in Accounting and Finance. Routledge Chapman & Hall: London. Mallik, A.K., and D. Sur (1998). "Working Capital and Profitability: A Case Study in Interrelation." The Management Accountant 33(11), pp. 805–9. Mallik, A.K., D. Sur, and D. Rakshit (2005). "Working Capital and Profitability: A Study on Their Relationship with Reference to Selected Companies in Indian Pharmaceutical Industry." GITAM Journal of Management 3, pp. 51–62. Markides, C. (1997). "Strategic Innovation." MIT Sloan Management Review 39(3). Masulis, R. (1980). "The Impact of Capital Structure Change on Firm Value: Some Estimates." Journal of Finance 38(1). Myers, S. (1984). "The Capital Structure Puzzle." Journal of Finance 39(3), Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/2078/SWP-1548-15376697.pdf (date of access: January 10, 2014). Myers, S., and N. Majluf (1984). "Corporate Financing and Investment Decisions When Firms Have Information Investors Do Not Have." Journal of Financial Economics 13(2) Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/2068/SWP-1523-15376412.pdf (date of access: January 10, 2014). Myers, S. C. (1984). "The Capital Structure Puzzle." Journal of Finance 3. Peel, M. J., N. Wilson, and C. Howorth (2000). "Late Payment and Credit Management in the Small Firm Sector: Some Empirical Evidence." International Journal of Small Business 18(2). Petersen, M. A., and R. G. Rajan (1997). "Trade Credit: Theories and Evidence." The Review of Financial Studies 10(3), pp. 661–91. Pike, R., and B. Neale (1999). Corporate Finance and Investment: Decisions and Strategies. Prentice Hall: London. Pratt, S., and A. Niculita (2008). Valuing a Business: The Analysis and Appraisal of Closely Held Companies. McGraw-Hill: New York. Preve, L. A., and V. Sarria-Allende (2010). Working Capital Management, Financial Management Association Survey and Synthesis Series. Oxford University Press: New York. Robichek, A. A. (1975). "Interpreting the Results of Risk Analysis." Journal of Finance 30(5), pp. 1384–86. Ruback, S. C. (2002). "Capital Cash Flows: A Simple Approach to Valuing Risky Cash Flows." Financial Management 31(2). Scherr, F. C. (1989). Modern Working Capital Management. Text and Cases. Prentice Hall: Englewood Cliffs, NJ. Smith, J. E., and K. F. McCardle (1998). "Valuing Oil Properties: Integrating Option Pricing and Decision Analysis Approaches." Operations Research 46(2). Soltes, V. (2012). "Paradigms of Changes in the 21st Century: Quest for Configurations in Mosaic." Ekonomicky Casopis 60(4). Soufani, K. (2002). "On the Determinants of Factoring as a Financing Choice: Evidence from the UK." Journal of Economics and Business 54. Stewart, G. (1991). The Quest for Value. HarperCollins: New York. Summers, B., and N. Wilson (2000). "Trade Credit Management and the Decision to Use Factoring: An Empirical Study." Journal of Business Finance & Accounting 27(1). Tobin, J. (1958). "Liquidity Preference as Behavior Towards Risk." Review of Economic Studies 67, pp. 65–86. Tobin, J. (1969). "A General Equilibrium Approach to Monetary Theory." Journal of Money Credit and Banking 1(1). Washam, J., and D. Davis (1998). "Evaluating Corporate Liquidity." TMA Journal 18(2). Williamson, O. (1988). "Corporate Finance and Corporate Governance." Journal of Finance 43(3). Wilner, B. (2000). "The Exploitation of Relationships in Financial Distress: The Case of Trade Credit." Journal of Finance 55, pp. 153–78. Wojciechowska, U. (2001). Liquidity of Polish companies in transition economy: Microeconomic and macroeconomic aspects (in Polish: Plynnosc finansowa polskich przedsiebiorstw w okresie transformacji gospodarki). SGH: Warsaw. Zardkoohi, A. (2004). "Do Real Options Lead to Escalation of Commitment?" Academy of Management Science 29(1). Zmeskal, Z., and D. Dluhosova (2009). "Company Financial Performance Prediction on Economic Value Added Measure by Simulation Methodology." Proceedings of the 27th International Conference on Mathematical Methods in Economics, Mathematical Methods in Economics; H. Brožová, R. Kvasnička eds., Czech University of Life Sciences, Chapter 1. Working Capital Management in the Business Context Adner, R., and D. A. Levinthal (2004). "What Is Not a Real Option: Considering Boundaries for the Application of Real Options to Business Strategy." Academy of Management Review 29(1). Amram, M., and N. Kulatilaka (1999). Real Options: Managing Strategic Investment in an Uncertain World. Harvard Business School Press: Boston. Asch, D., and G. R. Kaye (1997). Financial Planning: Profit Improvement through Modelling. Kogan Page: London. Bagchi, B. and B. Khamrui (2012). "Relationship between Working Capital Management and Profitability: A Study of Selected FMCG Companies in India." Business and Economics Journal 60. Banos-Caballero, S., P. J. García-Teruel, and P. Martinez-Solano (2010). "Working Capital Management in Enterprises." Accounting & Finance 50(3), pp. 511–27. Baxter, M., and A. Rennie (1996). Financial Calculus: An Introduction to Derivative Pricing. Cambridge University Press: Cambridge. Baz, J., and G. Chacko (2004). Financial Derivatives: Pricing, Applications and Mathematics. Cambridge University Press: Cambridge. Beck, P. E., and D. R. Stockman (2005). "Money as Real Options in a Cash-in-Advance Economy." Economics Letters 87. Ben-Horim, M., and H. Levy (1982). "Inflation and the Trade Credit Theory Period." Management Science 28(6), pp. 646–51. Berger, P. G., E. Ofek, and I. Swary (1996). "Investor Valuation of the Abandonment Option." Journal of Financial Economics 42(2). Black, F., and M. Scholes (1973). "The Pricing of Options and Corporate Liabilities." Journal of Political Economy 81. Brasch, J. J. (1972). "The Role of Trade Credit in Economic Development." Nebraska Journal of Economics and Business 11(1), pp. 63–67. Brealey, R. A., and S. C. Myers (1999). Basics of enterprises finance (Polish edition: Podstawy finansow przedsiebiorstw). WN PWN: Warszawa. Brennan, M. J., and E. S. Schwartz (1985). "Evaluating Natural Resource Investments." Journal of Business 58(2). Cassimon, D., and P. J. Engelen (2003). "The New Frontiers of Corporate Finance." Global Business Review 5(1). Cokins, G. (2004). Performance Management: Finding the Missing Pieces to Close the Intelligence Gap. John Wiley & Sons: Hoboken, NJ. Copeland, T. E., and V. Antikarov (2001). Real Options: A Practitioner's Guide. Business & Economics: Texere, London, New York. Copeland, T. E., and P. Keenan (1998). "How Much Is Flexibility Worth?" The McKinsey Quarterly 2. Copeland, T. E., and J. Weston (1988). Financial Theory and Corporate Policy. Addison-Wesley: Reading, MA. Copeland, T. E., and J. F. Weston (1982). "A Note on the Evaluation of Cancellable Operating Leases." Financial Management 11. Copeland, T. E., L. F. Weston, and K. Shastri (2004). Financial Theory and Corporate Policy. Addison-WesleyPublishing Company: Boston. Cote, J. M., and C. K. Latham (1999). "The Merchandising Ratio: A Comprehensive Measure of Current Assets Strategy." Issues in Accounting Education 14(2) May, pp. 255–67. Database Amadeus product of Bureau van Dijk (date of release: 2013 SEP 15). Dluhosova, D. (2006). Financial management of firms (in Czech: Financni rizeni a rozhodovani podniku). Ekopress: Prague. Dudycz, T. (2000). Financial analysis (in Polish: Analiza finansowa). AE: Wroclaw. Emery, G. W. (1987). "An Optimal Financial Approach to Variable Demand." Journal of Financial and Quantitative Analysis 22(2), pp. 209–25. Fabozzi, F. J. (1999). Investment Management. Prentice Hall: Upper Saddle River, NJ. Falope, O. I., and O. T. Ajilore (2009). "Working Capital Management and Corporate Profitability: Evidence from Panel Data Analysis of Selected Quoted Companies in Nigeria." Research Journal of Business Management 3, pp. 73–84. Fazzari, S.M., and B. C. Petersen (1993). "Working Capital and Fixed Investment: New Evidence on Financing Constraints." The RAND Journal of Economics 24, pp. 328–42. Fernandez, P. (2002). Valuation Methods and Shareholder Value Creation. Academic Press/Elsevier: San Diego. Fewings, D. R. (1996). "Unbiased Trade Credit Decisions under Imperfect Information." Advances in Working Capital Management 3. Gentry, J. A. (1988). "State of the Art of Short-Run Financial Management." Financial Management 17(2), pp. 41–57. Graber, P. J. (1948). "Assets." The Accounting Review 23(1), pp. 12–16. Graham, J. (1996). "Debt and the Marginal Tax Rate." Jounal of Financial Economics 41(1). Graham, J., and C. Harvey (2001). "The Theory and Practice of Corporate Finance: Evidence from the Field." Journal of Financial Economics 60(2−3). Harris, M., and A. Raviv (1988). "Corporate Control Contents and Capital Structure." Journal of Financial Economics 20. Harris, M., and A. Raviv (1991). "The Theory of Capital Structure." Journal of Finance 46(1). Henderson, J. W., and T. S. Maness (1989). The Financial Analyst's Deskbook: A Cash Flow Approach to Liquidity. Van Nostrand Reinhold: New York. Hsia, C. (1981). "Coherence of the Modern Theories of Finance." Financial Management 10(4). Jain, N. (2001). "Monitoring Costs and Trade Credit." The Quarterly of Economics and Finance 41, pp. 89–110. Jensen, M. (1986). "Agency Cost of Free-Cash-Flow, Corporate Finance, and Takeovers." American Economic Review 76(2). Jensen, M. C., and W. H. Meckling (1976). "Theory of the Firm: Managerial Behavior, Agency Costs and Ownership Structure." Journal of Financial Economics 3(4). Kieschnick, R. L., M. Laplante, and R. Moussawi (2009). "Working Capital Management, Access to Financing, and Firm Value" Working Paper. Available at SSRN: http://ssrn.com/abstract = 1431165 (date of access: December 10, 2010). » Link Laffer, A. B. (1970). "Trade Credit and the Money Market." Journal of Political Economy (March/April), pp. 239–67. Lazaridis, I., and D. Tryfonidis (2006). "Relationship between Working Capital Management and Profitability of Listed Companies in the Athens Stock Exchange." Journal of Financial Management and Analysis 19(1), January-June. Available at SSRN: http://ssrn.com/abstract = 931591 (date of access: January 10, 2014). Lee, C. F., and J. E. Finnerty (1990). Corporate Finance: Theory, Method and Applications. HBJ: Orlando, FL. Levy, H., and D. Gunthorpe (1999). Introduction to Investments. South-Western College Publishing: Cincinnati, OH. Lyland, H., and D. Pyle (1977). "Information Asymmetries, Financial Structure and Financial Intermediation." Journal of Finance 32(2). Marr, B. (2006). Strategic Performance Management: Leveraging and Measuring Your Intangible Value Drivers. Butterworth-Heinemann: London. Martin, J. D., J. W. Petty, A. J. Keown, and D. F. Scott (1991). Basic Financial Management. Prentice Hall: Englewood Cliffs, NJ. Meszek, W., and M. Polewski (2006). "Certain Aspects of Working Capital in a Construction Company." Technological and Economic Development of Economy 12(3),pp. 222–26. Mian, S. L., and C. W. Smith (1992). "Accounts Receivable Management Policy: Theory and Evidence." Journal of Finance 67(1). Michalski, G. (2008). "Value-Based Inventory Management." Journal of Economic Forecasting 9(1), pp. 82–90. Michalski, G. (2009). "Effectiveness of Investment in Operating Cash." Journal of Corporate Treasury Management 3(1). Michalski, G. (2010). Strategic management of liquidity in enterprises. (in Polish: Strategiczne zarzadzanie plynnoscia finansowa w przedsiebiorstwie). CeDeWu: Warsaw. Michalski, G. (2012a). "Crisis-Caused Changes in Intrinsic Liquidity Value in Non-Profit Institutions. Equilibrium." Quarterly Journal of Economics and Economic Policy 7(2). Michalski, G. (2012b). "Crisis Influence on General Economic Condition and Corporate Liquidity Management: Financial Liquidity Investment Efficiency Model (FLIEM) Use to Diagnose Polish Economics Standing." Proceedings of the 7th International Conference on Currency, Banking and International Finance: How Does Central and Eastern Europe Cope with the Global Financial Crisis? EKONOM: Bratislava, pp. 200–219. Michalski, G. (2012c). "Financial Liquidity Management in Relation to Risk Sensitivity: Polish Firms Case." Proceedings of the International Conference Quantitative Methods in Economics (Multiple Criteria Decision Making XVI). EKONOM: Bratislava, pp. 141–60. Michalski, G. (2012d). "Risk Sensitivity Indicator as Correction Factor for Cost of Capital Rate." Managing and Modelling of Financial Risks: 6th International Scientific Conference Proceedings. Vysoka Skola Banska VSB-TU, Faculty of Economics, Finance Department, Ostrava, pp. 418–28, Available at SSRN: http://ssrn.com/abstract = 2193398 (date of access: January 10, 2014). » Link Miles, J. A., and J. R. Ezzell (1980). "The Weighted Average Cost of Capital, Perfect Capital Markets, and Project Life." Journal of Financial and Quantitative Analysis 15(3). Miller, M. (1999). Merton Miller o instrumentach pochodnych. K. E. Liber: Warszawa. Miller, M., and F. Modigliani (1961). "Dividend Policy, Growth, and the Valuation of Shares." Journal of Business 34(4). Miller, M., and F. Modigliani (1966). "Some Estimates of the Cost of Capital to the Electric Utility Industry, 1954 − 57." American Economic Review 56(3). Modigliani, F. (1982). "Debt, Dividend Policy, Taxes, Inflation and Market Valuation." Journal of Finance 37(2). Modigliani, F., and M. Miller (1958). "The Cost of Capital, Corporation Finance and the Theory of Investment." American Economic Review 48(3). Modigliani, F., and M. Miller (1963). "Taxes and the Cost of Capital: A Correction." American Economic Review 53(3). Moyer, R. C., J. R. McGuigan, and W. J. Ketlow (1990). Contemporary Financial Management. West Publishing Company: Saint Paul. Mueller, F. (1953). "Corporate Current Assets and Liquidity." The Journal of Business of the University of Chicago 26(3), pp. 157–72. Myers, S. (1977). "The Determinants of Corporate Borrowing." Journal of Financial Economics 5(2) Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/1915/SWP-0875-02570768.pdf (date of access: January 10, 2014). Myers, S. (1984). "The Capital Structure Puzzle." Journal of Finance 39(3), Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/2078/SWP-1548-15376697.pdf (date of access: January 10, 2014). Myers, S. (1998). "The Search of Capital Structure Puzzle." In Financial Strategy: Adding Shareholder Value. Edited by J. Rutterford. John Wiley & Sons: Chichester. Myers, S., and N. Majluf (1984). "Corporate Financing and Investment Decisions When Firms Have Information Investors Do Not Have." Journal of Financial Economics 13(2) Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/2068/SWP-1523-15376412.pdf (date of access: January 10, 2014). Myers, S. C. (1974). "Interactions of Corporate Finance and Investment Decisions: Implications for Capital Budgeting." Journal of Finance 29(1) Available at JSTOR: http://www.jstor.org/discover/10.2307/2978211 (date of access: January 10, 2014). Myers, S. C. (1977). "Determinants of Corporate Borrowing." Journal of Financial Economics 5. Myers, S. C. (2001). "Finance Theory and Financial Strategy." In Real Options and Investment under Uncertainty. Edited by E. S. Schwartz and L. Trigeorgis. MIT Press: Cambridge, MA. Myers, S. C. (1984). "The Capital Structure Puzzle." Journal of Finance 3. Myers, S. C., and S. M. Turnbull (1977). "Capital Budgeting and the Capital Asset Pricing Model: Good News and Bad News." Journal of Finance 32(2), pp. 321–33. Nadiri, M. I. (1969). "The Determinants of Trade Credit in the US Total Manufacturing Sector." Econometrica 37(3). Narware, P. C. (2004). "Working Capital and Profitability: An Empirical Analysis."; The Management Accountant, ICWAI Knowledge Bank, Kolkatta, June, pp. 491−493. Nobanee, H. (2009). "Working Capital Management and Firm's Profitability: An Optimal Cash Conversion Cycle." Working Paper. Available at SSRN: http://ssrn.com/abstract=1471230 or http://dx.doi.org/10.2139/ssrn.1471230 (date of access: January 10, 2014). » Link Nobanee, H., W. K. Al Shattarat, and A. E. Haddad (2009). "Optimizing Working Capital Management." Working Paper. Available at SSRN: http://ssrn.com/abstract=1528894 or http://dx.doi.org/10.2139/ssrn.1528894 (date of access: January 10, 2014). » Link Nobanee, H., and M. Hajjar (2009b). "Working Capital Management, Operating Cash Flow and Corporate Performance." Working Paper. Available at SSRN: http://ssrn.com/abstract = 1471236 (date of access: January 10, 2014). » Link Nowak, M. (1995). Dynamic models of financial management in the enterprise (in Polish: Dynamiczne modele zarzadzania finansami w przedsiebiorstwie). Pret: Warszawa. Opler, T., L. Pinkowitz, R. Stulz, and R. Williamson (1999). "The Determinants and Implications of Corporate Cash Holdings." Journal of Financial Economics 52, pp. 3–46. Opler, T., M. Saron, and S. Titman. (1997). "Designing Capital Structure to Create Shareholder Value." Journal of Applied Corporate Finance 10(1). Opler, T., and S. Titman (1994). "Financial Distress and Corporate Performance." Journal of Finance 49(3). Osband, K. (2011). Pandora's Risk: Uncertainty at the Core of Finance. Columbia Business School Publishing Series. Columbia University Press: New York. Ozkan, A. (2001). "Determinants of Capital Structure and Adjustment to Long Run Target: Evidence from UK Company Panel Data." Journal of Business Finance & Accounting 28(1−2). Petersen, M. A., and R. G. Rajan (1997). "Trade Credit: Theories and Evidence." The Review of Financial Studies 10(3), pp. 661–91. Piotrowska, M. (1997). Finances of Companies: Short-Term Financial Decisions. AE: Wroclaw. Polak, P. (2012). "Addressing the Post-Crisis Challenges in Working Capital Management." International Journal of Research in Management 6(2). http://ssrn.com/abstract = 2195059 (date of access: January 10, 2014). Schwartz, R. A., and D. A. Whitcomb (1978). "Implicit Transfers in the Extension of Trade Credit." In Redistribution through the Financial System: The Grants Economics of Money and Credit. Edited by K. E. Boulding and T. F. Wilson. Preager Special Studies: New York, pp. 191–208. Shapiro, A. C. (1990). Modern Corporate Finance. Macmillan Publishing Company: New York. Shulman, J. M., and R. A. K. Cox (1985). "An Integrative Approach to Working Capital Management." Journal of Cash Management November−December. Smith, J. K. (1987). "Trade Credit and Informational Asymmetry." Journal of Finance 42(4), pp. 863–72. Solomon, E. (1963). The Theory of Financial Management. Columbia University Press: New York. Stark, A. (1987). "On the Observability of the Cash Recovery Rate." Journal of Business, Finance and Accounting 14(4). Thakor, A. V. (1993). "Corporate Investments and Finance." Financial Management Summer, pp. 135−44. Titman, S. (1984). "The Effect of Capital Structure on a Firm's Liquidation Decision." Journal of Financial Economics 13(1). Uyar, A. (2009). "The Relationship of Cash Conversion Cycle with Firm Size and Profitability: An Empirical Investigation in Turkey." International Research Journal of Finance and Economics 24. Vernimmen, P., P. Quiry, M. Dallocchio, Y. Le Fur, and A. Salvi (2009). Corporate Finance: Theory and Practice. John Wiley & Sons: Chichester, UK. Walker, D. A. (1985). "Trade Credit Supply for Small Business." American Journal of Small Business 9(3) Winter, pp. 30–40. Warner, J. (1977). "Bankruptcy Costs: Some Evidence." Journal of Finance 32(2). Warner, J. (1977). "Bankruptcy, Absolute Priority and the Pricing of Risky Debt Claims." Journal of Financial Economics May. Zietlow, J., and A. Seidner (2007). Cash and Investment Management for Nonprofit Organizations. Wiley: Hoboken. Zingales, L. (2000). In Search of New Foundations. Journal of Finance 55(4). Chapter 2. Understanding and Measuring Financial Liquidity Levels Back, P. (2001). "Testing Liquidity Measures as Bankruptcy Prediction Variables." Liiketaloudellinen Aikakauskirja—The Finnish Journal of Business Economics 2001(3). Bagchi, B. and B. Khamrui (2012). "Relationship between Working Capital Management and Profitability: A Study of Selected FMCG Companies in India." Business and Economics Journal 60. Brigham, E. F. (1975). "Hurdle Rates for Screening Capital Expenditure Proposals." Financial Management; 4(3), pp. 17–16 Copeland, T. E., and J. F. Weston (1982). "A Note on the Evaluation of Cancellable Operating Leases." Financial Management 11. Cote, J. M., and C. K. Latham (1999). "The Merchandising Ratio: A Comprehensive Measure of Current Assets Strategy." Issues in Accounting Education 14(2) May, pp. 255–67. Damodaran, A. (1999). Applied Corporate Finance: A User's Manual. John Wiley & Sons: New York. Database Amadeus product of Bureau van Dijk (date of release: 2013 SEP 15). Database Osiris product of Bureau van Dijk (date of release: 2013 SEP 15). Dluhosova, D. (2006). Financial management of firms (in Czech: Financni rizeni a rozhodovani podniku). Ekopress: Prague. Dudycz, T. (2000). Financial analysis (in Polish: Analiza finansowa). AE: Wroclaw. Emery, G., and R. Lyons R. (1991). "The Lambda Index: Beyond the Current Ratio." Business Credit November/December. Etiennot, H., L. A. Preve, and V. S. Allende (2012). "Working Capital Management." Journal of Applied Finance 1 (ISSN 1534-6668), pp. 162–75 [This work was reported also as Etiennot, H., L. Preve, and V. Allende (2011). "Working Capital Management: An Exploratory Study." Journal of Applied Finance 2/2011, pp. 2–23 (available at SSRN: http://ssrn.com/abstract = 2119217).] Fama, E., and H. French (2005). "Financing Decisions: Who Issues Stock." Journal of Financial Economics 76. Fama, E. F. (1980). "Agency Problems and the Theory of the Firm." Journal of Political Economy 88(2). Fernandez, P. (2001a). "Valuing Companies by Cash Flow Discounting: Ten Methods and Nine Theories." EFMA 2002 London Meetings, Working Papers IESE Business School, Madrid. Available at SSRN: http://ssrn.com/abstract = 256987 (date of access: 2014 January 10). » Link Geske, R. (1977). "The Valuation of Corporate Liabilities as Compound Options." Journal of Financial and Quantitative Analysis 12(4). Gill, A., N. Biger, and N. Mathur (2010). "The Relationship between Working Capital Management and Profitability: Evidence from the United States." Business and Economics Journal 10. Graham, J., and C. Harvey (2001). "The Theory and Practice of Corporate Finance: Evidence from the Field." Journal of Financial Economics 60(2−3). Gupta, A., and L. Rosenthal (1991). "Ownership Structure, Leverage, and Firm Value: The Case of Leveraged Recapitalizations." Financial Management 20(3). Heinkel, R. (1982). "A Theory of Capital Structure Relevance under Imperfect Information." Journal of Finance 37(5). Henderson, J. W., and T. S. Maness (1989). The Financial Analyst's Deskbook: A Cash Flow Approach to Liquidity. Van Nostrand Reinhold: New York. Higgins, R. C. (1977). "How Much Growth Can Firms Afford?" Financial Management 6(3). Higgins, R. C. (1981). "Sustainable Growth under Inflation." Financial Management 10(4). Hill, M. D., G. W. Kelly, and M. J. Highfield (2010). "Net Operating Working Capital Behavior: A First Look." Financial Management 39(2), pp. 783–805. Hill, N. C., and W. L. Sartoris (1995). Short-Term Financial Management: Text and Cases. Prentice Hall: Englewood Cliffs, p. 2 Jensen, M. C., and W. H. Meckling (1976). "Theory of the Firm: Managerial Behavior, Agency Costs and Ownership Structure." Journal of Financial Economics 3(4). Kaplan, S. N., and R. S. Ruback (1995). "The Valuation of Cash Flow Forecast: An Empirical Analysis." Journal of Finance 50(4). Kemna, A. G. Z. (1993). "Case Studies on Real Options." Financial Management 22. Khoury, N., K. Smith, and P. MacKay (1999). "Comparing Current Assets Practices in Canada, the United States and Australia." Revue Canadienne des Sciences de l'Administration 16(1), pp. 53–57. Kieschnick, R. L., M. Laplante, and R. Moussawi (2009). "Working Capital Management, Access to Financing, and Firm Value" Working Paper. Available at SSRN: http://ssrn.com/abstract = 1431165 (date of access: December 10, 2010). » Link Kim, C-S., D. Mauer, and A. Sherman (1998). "The Determinants of Corporate Liquidity: Theory and Evidence." Journal of Financial and Quantitative Analysis 33(3). Lazaridis, I., and D. Tryfonidis (2006). "Relationship between Working Capital Management and Profitability of Listed Companies in the Athens Stock Exchange." Journal of Financial Management and Analysis 19(1), January-June. Available at SSRN: http://ssrn.com/abstract = 931591 (date of access: January 10, 2014). Lee, C. F., and J. E. Finnerty (1990). Corporate Finance: Theory, Method and Applications. HBJ: Orlando, FL. Long, M., L. B. Malitz, and S. A. Ravid (1993). "Trade Credit, Quality Guarantees, and Product Marketability." Financial Management 22. Luehrman, T. A. (1998). "Investment Opportunities as Real Options: Getting Started on the Numbers." Harvard Business Review 4. Maness, T., and J. Zietlow (2005). Short-Term Financial Management. South-Western/Thomson Learning: Mason, OH. Maness, T. S., and J. T. Zietlow (1998). Short-Term Financial Management. Dryden Press: Fort Worth, TX. Martin, J. D., J. W. Petty, A. J. Keown, and D. F. Scott (1991). Basic Financial Management. Prentice Hall: Englewood Cliffs, NJ. Melnyk, Z. L., and A. Birati (1974). "Comprehensive Liquidity Index as Measure of Corporate Liquidity." Scientific and Behavioral Foundations of Decision Sciences. Southeastern Region of the American Institute for Decision Sciences, Atlanta. Michalski, G. (2008). "Value-Based Inventory Management." Journal of Economic Forecasting 9(1), pp. 82–90. Michalski, G. (2010). Strategic management of liquidity in enterprises. (in Polish: Strategiczne zarzadzanie plynnoscia finansowa w przedsiebiorstwie). CeDeWu: Warsaw. Michalski, G. (2012a). "Crisis-Caused Changes in Intrinsic Liquidity Value in Non-Profit Institutions. Equilibrium." Quarterly Journal of Economics and Economic Policy 7(2). Michalski, G. (2012c). "Financial Liquidity Management in Relation to Risk Sensitivity: Polish Firms Case." Proceedings of the International Conference Quantitative Methods in Economics (Multiple Criteria Decision Making XVI). EKONOM: Bratislava, pp. 141–60. Michalski, G. (2012d). "Risk Sensitivity Indicator as Correction Factor for Cost of Capital Rate." Managing and Modelling of Financial Risks: 6th International Scientific Conference Proceedings. Vysoka Skola Banska VSB-TU, Faculty of Economics, Finance Department, Ostrava, pp. 418–28, Available at SSRN: http://ssrn.com/abstract = 2193398 (date of access: January 10, 2014). » Link Modigliani, F., and M. Miller (1963). "Taxes and the Cost of Capital: A Correction." American Economic Review 53(3). Myers, S. (1977). "The Determinants of Corporate Borrowing." Journal of Financial Economics 5(2) Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/1915/SWP-0875-02570768.pdf (date of access: January 10, 2014). Myers, S. C. (1977). "Determinants of Corporate Borrowing." Journal of Financial Economics 5. Myers, S. C., and S. M. Turnbull (1977). "Capital Budgeting and the Capital Asset Pricing Model: Good News and Bad News." Journal of Finance 32(2), pp. 321–33. Neftci, S. N. (1996). An Introduction to the Mathematics of Financial Derivatives. Academic Press: San Diego, CA. Nita, B. (2011). "Synthetic indicator of liquidity in static approach in terms of demand for net working capital" (in Polish: "Syntetyczny wskaznik plynnosci finansowej w ujeciu statycznym w kontekscie zapotrzebowania na kapital obrotowy netto"). Research Papers of Wroclaw University of Economics 182, Wroclaw. Nowak, M. (1995). Dynamic models of financial management in the enterprise (in Polish: Dynamiczne modele zarzadzania finansami w przedsiebiorstwie). Pret: Warszawa. Paddock, J. L., D. R. Siegel, and J. L. Smith (1988). "Option Valuation of Claims on Real Assets: The Case of Offshore Petroleum Leases." Quarterly Journal of Economics 103(3). Parrino, R., and D. Kidwell (2008). Fundamentals of Corporate Finance. Wiley: New York. Peasnell, K. (1982). "Some Formal Connections between Economic Values and Yields and Accounting Numbers." Journal of Finance and Accounting 9(3). Peel, M. J., N. Wilson, and C. Howorth (2000). "Late Payment and Credit Management in the Small Firm Sector: Some Empirical Evidence." International Journal of Small Business 18(2). Petersen, M. A., and R. G. Rajan (1997). "Trade Credit: Theories and Evidence." The Review of Financial Studies 10(3), pp. 661–91. Pike, R., and B. Neale (1999). Corporate Finance and Investment: Decisions and Strategies. Prentice Hall: London. Piotrowska, M. (1997). Finances of Companies: Short-Term Financial Decisions. AE: Wroclaw. Piotrowska, M. (1998). "Macroeconomic conditions of the money market in Poland" (in Polish: "Makroekonomiczne uwarunkowania rynku pienieznego w Polsce"). Scientific Papers of the University of Economics in Wroclaw 783, Wroclaw. Polak, P. (2009). "The Centre Holds: From the Decentralised Treasury Towards Fully Centralised Cash and Treasury Management." Journal of Corporate Treasury Management 3(2), pp. 109–12. http://ssrn.com/abstract = 1653318 (date of access: January 10, 2014). Polak, P. (2010). "Centralization of Treasury Management in a Globalized World." International Research Journal of Finance and Economics 56. http://ssrn.com/abstract = 1702687 (date of access: January 10, 2014). » Link Pratt, S., and A. Niculita (2008). Valuing a Business: The Analysis and Appraisal of Closely Held Companies. McGraw-Hill: New York. Preve, L. A., and V. Sarria-Allende (2010). Working Capital Management, Financial Management Association Survey and Synthesis Series. Oxford University Press: New York. Rajan, R., and L. Zingales (1995). "What We Know About Capital Structure: Some Evidence from International Data." Journal of Finance 53(3). Rizzi, J. V. (2007). "How Much Debt Is Right for Your Deal?" Commercial Lending Review 22(4). Ross, S. A. (1977). "The Determination of Financial Structure: The Incentive Signaling Approach." Bell Journal of Economics 8(1). Ross, S. A. (1977). "The Determination of Financial Structure: The Incentive Signaling Approach." Bell Journal of Economics 4. Salamon, G. L. (1982). "Cash Recovery Rates and Measures of Firm Profitability." Accounting Review 57. Samuels, J. M., F. M. Wilkers, and R. E. Brayshaw (1993). Management of Company Finance. Chapman & Hall: London. Sarjusz-Wolski, Z. (2000). Inventory control in an enterprise (in Polish: Sterowanie zapasami w przedsiebiorstwie). PWE: Warszawa. Scherr, F. C. (1996). "Optimal Trade Credit Limits." Financial Management 25 (1) (Spring), pp. 71–85. Schilling, G. (1996). "Working Capital's Role in Maintaining Corporate Liquidity." TMA Journal 16(5). Schwartz, R. A. (1974). "An Economic Model of Trade Credit." Journal of Financial and Quantitative Analysis 9(4), pp. 643–57. Schwartz, R. A., and D. A. Whitcomb (1978). "Implicit Transfers in the Extension of Trade Credit." In Redistribution through the Financial System: The Grants Economics of Money and Credit. Edited by K. E. Boulding and T. F. Wilson. Preager Special Studies: New York, pp. 191–208. Shapiro, A. C., and S. D. Balbier (2000). Modern Corporate Finance. Prentice Hall: Upper Saddle River, NJ. Shulman, J. M., and R. A. K. Cox (1985). "An Integrative Approach to Working Capital Management." Journal of Cash Management November−December. Siegel, J. G., J. K. Shim, and W. G. Hartman (1999). Guide to finance (in Polish: Przewodnik po finansach). WN PWN: Warsaw. Sierpinska, M., and D. Wedzki (2002). Financial liquidity management in an enterprise (in Polish: Zarzadzanie plynnoscia finansowa w przedsiebiorstwie). WN PWN: Warsaw. Singh, P. (2008). "Inventory and Working Capital Management: An Empirical Analysis." The ICFAI Journal of Accounting Research 7(2), pp. 53–73. Smith J. K., and C. Schnucker (1994). "An Empirical Examination of Organizational Structure: The Economics of Factoring Decision." Journal of Corporate Finance 1. Soltes, V. (2012). "Paradigms of Changes in the 21st Century: Quest for Configurations in Mosaic." Ekonomicky Casopis 60(4). Spremann, K. (2010). "Old and New Financial Paradigms." In Current Challenges for Corporate Finance: A Strategic Perspective. Edited by G. Eilenberger. Springer-Verlag: Berlin Heidelberg. Summers, B., and N. Wilson (2002). "The Empirical Investigation of Trade Credit Demand." International Journal of the Economics of Business 9(2), pp. 257–70. Titman, S., and R. Wessels (1988). "The Determinants of Capital Structure Choice." Journal of Finance 43(1),pp. 1–19. Varian, H. R. (1987). "The Arbitrage Principle in Financial Economics." Economic Perspectives 1(2). Waiss, L. (1990). "Bankruptcy Resolution: Direct Cost and Violation of Priority Claims." Journal of Financial Economics 27(2). Walker, D. A. (1985). "Trade Credit Supply for Small Business." American Journal of Small Business 9(3) Winter, pp. 30–40. Walter, J. (1957). "Determination of Technical Solvency." Journal of Business January. Washam, J., and D. Davis (1998). "Evaluating Corporate Liquidity." TMA Journal 18(2). Weston, F. (1963). "A Test of Cost of Capital Propositions." The Southern Economic Journal 30(2). Wojciechowska, U. (2001). Liquidity of Polish companies in transition economy: Microeconomic and macroeconomic aspects (in Polish: Plynnosc finansowa polskich przedsiebiorstw w okresie transformacji gospodarki). SGH: Warsaw. Zietlow, J., and A. Seidner (2007). Cash and Investment Management for Nonprofit Organizations. Wiley: Hoboken. Chapter 3. Intrinsic and External Values of Liquidity and Optimization Altman, E. (1984). "A Further Empirical Investigation of the Bankruptcy Cost Question." Journal of Finance 39. Asch, D., and G. R. Kaye (1997). Financial Planning: Profit Improvement through Modelling. Kogan Page: London. Baker, M., and J. Wurgler (2002). "Market Timing and Capital Structure." Journal of Finance 57. Banos-Caballero, S., P. J. García-Teruel, and P. Martinez-Solano (2010). "Working Capital Management in Enterprises." Accounting & Finance 50(3), pp. 511–27. Beck, P. E., and D. R. Stockman (2005). "Money as Real Options in a Cash-in-Advance Economy." Economics Letters 87. Blaug, M. (1985). Economic Theory in Retrospect. Cambridge University Press: Cambridge. Brealey, R. A., and S. C. Myers (1999). Basics of enterprises finance (Polish edition: Podstawy finansow przedsiebiorstw). WN PWN: Warszawa. Brennan, M. J., and E. S. Schwartz (1985). "Evaluating Natural Resource Investments." Journal of Business 58(2). Brigham, E. F. (1975). "Hurdle Rates for Screening Capital Expenditure Proposals." Financial Management; 4(3), pp. 17–16 Chriss, N. A. (1997). Black-Scholes and Beyond: Options Pricing Models. McGraw-Hill: New York. Copeland, T. E., and J. F. Weston (1982). "A Note on the Evaluation of Cancellable Operating Leases." Financial Management 11. Cox, J., S. Ross, and M. Rubinstein (1979). "Option Pricing: A Simplified Approach." Journal of FinancialEconomics 7. Database Amadeus product of Bureau van Dijk (date of release: 2013 SEP 15). DeAngelo, H., and R. Masulis (1980). "Optimal Capital Structure under Corporate and Personal Taxation." Journal of Financial Economics 8(1). Deloof, M. (2003). "Does Working Capital Management Affect Profitability of Belgian Firms?" Journal of Business Finance & Accounting 30(3 − 4), pp. 573–88. Dixit, A. K., and R. S. Pindyck (1994). Investment under Uncertainty. Princeton University Press: Princeton, NJ. Dixit, A. K., and R. S. Pindyck (1995). "The Options Approach to Capital Investment." Harvard Business Review 73(3), May−June, pp. 105−115. Dluhosova, D. (2006). Financial management of firms (in Czech: Financni rizeni a rozhodovani podniku). Ekopress: Prague. Eckbo, B. E. (2007). Handbook of Corporate Finance: Empirical Corporate Finance. Elsevier/North Holland: Amsterdam. Fernandez, P. (2001b). "Valuing Real Options: Frequently Made Errors." Working Papers IESE Business School, Madrid. Available at SSRN: http://ssrn.com/abstract = 274855 or http://dx.doi.org/10.2139/ssrn.274855 (date of access: January 10, 2014). » Link Fewings, D. R. (1996). "Unbiased Trade Credit Decisions under Imperfect Information." Advances in Working Capital Management 3. Fisher, E., R. Heinkel, and J. Zechner (1989). Dynamic Capital Structure Choice: Theory and Tests. Journal of Finance 44. Frank, M., and V. Goyal (2003). Testing the Pecking Order Theory of Capital Structure. Journal of Financial Economics 67. Frank, M., and V. Goyal (2009). "Capital Structure Decisions: Which Factors Are Reliably Important?" Financial Management 38. Hamada, R. (1969). "Portfolio Analysis, Market Equilibrium, and Corporation Finance." Journal of Finance 24(2). Harris, R. S., and J. J. Pringle (1985). "Risk-Adjusted Discount Rates: Extensions from the Average-Risk Case." Journal of Financial Research 8(3). Haugen, R., and L. Senbet (1978). "The Insignificance of Bankruptcy Costs to the Theory of Optimal Capital Structure." Journal of Finance 33(2). Herath, H. S. B., and C. S. Park (1999). "Economic Analysis of R&D Projects: An Options Approach." Engineering Economist 44(1). Herath, H. S. B., and C. S. Park (2002). "Multi-Stage Capital Investment Opportunities as Compound Real Options." Engineering Economics 47(1). Hill, M. D., G. W. Kelly, and M. J. Highfield (2010). "Net Operating Working Capital Behavior: A First Look." Financial Management 39(2), pp. 783–805. Hill, N. C., and W. L. Sartoris (1995). Short-Term Financial Management: Text and Cases. Prentice Hall: Englewood Cliffs, p. 2 Hirshleifer, J. (1965). "Investment Decisions under Uncertainty: Choice Theoretic Approaches." Quarterly Journal of Economics 74(4). Hubalek, F., and W. Schachermayer (2001). "The Limitations of No-Arbitrage Arguments for Real Options." International Journal of Theoretical and Applied Finance 4(2). Jajuga, K. (2005). "Problems in Operational Risk Measurement." In Finansowanie dzialalnosci przedsiebiorstw. Wydawnictwo WSB: Poznan, pp. 137–44. Kester, W. C. (1984). "Today's Options for Tomorrow's Growth." Harvard Business Review 2. Kogut, B., and N. Kulatilaka (2004). "Real Options Pricing and Organizations: The Contingent Risks of Extended Theoretical Domains." Academy of Management Science 29(1). Kulatilaka, N. (1993). "The Value of Flexibility: The Case of Dual-Fuel Industrial Steam Boiler." Financial Management 3. Kulatilaka, N., and L. Trigeorgis (2001). "The General Flexibility to Switch." In Real Options and Investment under Uncertainty. Edited by E. S. Schwartz and L. Trigeorgis. MIT Press: Cambridge, MA. Lee, C. F., and J. E. Finnerty (1990). Corporate Finance: Theory, Method and Applications. HBJ: Orlando, FL. Lee, Y. W., and J. D. Stowe (1993). "Product Risk, Asymmetric Information, and Trade Credit." Journal of Financial and Quantitative Analysis 28, pp. 285–300. Leland, H. (1994). "Corporate Debt Value, Bond Covenants, and Optimal Capital Structure." Journal of Finance 49(4). Leland, H. E., and D. H. Pyle (1977). "Informational Asymmetries, Financial Structure and Financial Intermediation." Journal of Finance 32(2). Lessard, D. R. (1996). "Incorporating Country Risk in the Valuation of Offshore Projects." Journal of Applied Corporate Finance 9(3). Lofthouse, S. (2005). Investment Management. Wiley: Chichester, UK. Long, M., L. B. Malitz, and S. A. Ravid (1993). "Trade Credit, Quality Guarantees, and Product Marketability." Financial Management 22. Luehrman, T. A. (1998). "Investment Opportunities as Real Options: Getting Started on the Numbers." Harvard Business Review 4. Lumby, S. (1993). Investment Appraisal and Financing Decisions. The Chapman & Hall Series in Accounting and Finance. Routledge Chapman & Hall: London. Madden, B. (1999). CFROI Valuation: A Total System Approach to Valuating the Firm. Butterworth-Heinemann: Oxford. Majd, S., and R. S. Pindyck (1987). "Time-to-Build Option Value and Investment Decisions." Journal of Financial Economics 18. Makridiakis, S., and S. Wheelwright (1989). Forecasting Methods for Management. Wiley & Sons: New York. Marris, R. (1963). "A Model of the 'Managerial' Enterprise." The Quarterly Journal of Economics 77(2). Masulis, R. (1980). "The Impact of Capital Structure Change on Firm Value: Some Estimates." Journal of Finance 38(1). McDonald, R., and D. Siegel (1986). "The Value of Waiting to Invest." Quarterly Journal of Economics 101(4). McGrath, R. G., W. J. Ferner, and A. L. Mendelow (2004). "Real Options as Engines of Choice and Heterogeneity." Academy of Management Review 29(1). Merton, R., and A. Perold (1999). "Theory of Risk Capital in Financial Firms." In The New Corporate Finance: Where Theory Meets Practice. Edited by D. H. Chew. McGraw-Hill: Boston. Merton, R. C. (1973). "Theory of Rational Option Pricing." Bell Journal of Economics and Management Science 4(1). Michalski, G. (2008). "Value-Based Inventory Management." Journal of Economic Forecasting 9(1), pp. 82–90. Michalski, G. (2010). Strategic management of liquidity in enterprises. (in Polish: Strategiczne zarzadzanie plynnoscia finansowa w przedsiebiorstwie). CeDeWu: Warsaw. Michalski, G. (2012a). "Crisis-Caused Changes in Intrinsic Liquidity Value in Non-Profit Institutions. Equilibrium." Quarterly Journal of Economics and Economic Policy 7(2). Michalski, G. (2012b). "Crisis Influence on General Economic Condition and Corporate Liquidity Management: Financial Liquidity Investment Efficiency Model (FLIEM) Use to Diagnose Polish Economics Standing." Proceedings of the 7th International Conference on Currency, Banking and International Finance: How Does Central and Eastern Europe Cope with the Global Financial Crisis? EKONOM: Bratislava, pp. 200–219. Michalski, G. (2012c). "Financial Liquidity Management in Relation to Risk Sensitivity: Polish Firms Case." Proceedings of the International Conference Quantitative Methods in Economics (Multiple Criteria Decision Making XVI). EKONOM: Bratislava, pp. 141–60. Michalski, G. (2012d). "Risk Sensitivity Indicator as Correction Factor for Cost of Capital Rate." Managing and Modelling of Financial Risks: 6th International Scientific Conference Proceedings. Vysoka Skola Banska VSB-TU, Faculty of Economics, Finance Department, Ostrava, pp. 418–28, Available at SSRN: http://ssrn.com/abstract = 2193398 (date of access: January 10, 2014). » Link Miller, M. (1988). "The Modigliani-Miller Propositions after 30 Years." Journal of Economic Perspectives 2(4). Modigliani, F., and M. Miller (1958). "The Cost of Capital, Corporation Finance and the Theory of Investment." American Economic Review 48(3). Moles, P., and N. Terry (1999). The Handbook of International Financial Terms. Oxford University Press: Oxford. Moyer, R. C., J. R. McGuigan, and W. J. Ketlow (1990). Contemporary Financial Management. West Publishing Company: Saint Paul. Mun, J. (2002). Real Option Analysis. Tools and Techniques for Valuing Strategic Investments and Decisions. John Wiley & Sons: Hoboken, NJ. Myers, S. (1977). "The Determinants of Corporate Borrowing." Journal of Financial Economics 5(2) Available at MIT: http://dspace.mit.edu/bitstream/handle/1721.1/1915/SWP-0875-02570768.pdf (date of access: January 10, 2014). Myers, S. (1998). "The Search of Capital Structure Puzzle." In Financial Strategy: Adding Shareholder Value. Edited by J. Rutterford. John Wiley & Sons: Chichester. Myers, S. C. (1977). "Determinants of Corporate Borrowing." Journal of Financial Economics 5. Myers, S. C. (2001). "Finance Theory and Financial Strategy." In Real Options and Investment under Uncertainty. Edited by E. S. Schwartz and L. Trigeorgis. MIT Press: Cambridge, MA. Myers, S. C., and S. M. Turnbull (1977). "Capital Budgeting and the Capital Asset Pricing Model: Good News and Bad News." Journal of Finance 32(2), pp. 321–33. Nobanee, H. (2009). "Working Capital Management and Firm's Profitability: An Optimal Cash Conversion Cycle." Working Paper. Available at SSRN: http://ssrn.com/abstract=1471230 or http://dx.doi.org/10.2139/ssrn.1471230 (date of access: January 10, 2014). » Link Nobanee, H., W. K. Al Shattarat, and A. E. Haddad (2009). "Optimizing Working Capital Management." Working Paper. Available at SSRN: http://ssrn.com/abstract=1528894 or http://dx.doi.org/10.2139/ssrn.1528894 (date of access: January 10, 2014). » Link Nobanee, H., and M. Hajjar (2009a). "A Note on Working Capital Management and Corporate Profitability of Japanese Firms." Working Paper. Available at SSRN: http://ssrn.com/abstract = 1433243 or http://dx.doi.org/10.2139/ssrn.1433243 (date of access: January 10, 2014). » Link Opler, T., L. Pinkowitz, R. Stulz, and R. Williamson (1999). "The Determinants and Implications of Corporate Cash Holdings." Journal of Financial Economics 52, pp. 3–46. Opler, T., M. Saron, and S. Titman. (1997). "Designing Capital Structure to Create Shareholder Value." Journal of Applied Corporate Finance 10(1). Osband, K. (2011). Pandora's Risk: Uncertainty at the Core of Finance. Columbia Business School Publishing Series. Columbia University Press: New York. Ozkan, A. (2001). "Determinants of Capital Structure and Adjustment to Long Run Target: Evidence from UK Company Panel Data." Journal of Business Finance & Accounting 28(1−2). Piotrowska, M. (1998). "Macroeconomic conditions of the money market in Poland" (in Polish: "Makroekonomiczne uwarunkowania rynku pienieznego w Polsce"). Scientific Papers of the University of Economics in Wroclaw 783, Wroclaw. Polak, P. (2012). "Addressing the Post-Crisis Challenges in Working Capital Management." International Journal of Research in Management 6(2). http://ssrn.com/abstract = 2195059 (date of access: January 10, 2014). Poteshman, A., R. Parrino, and M. Weisbach (2005). "Measuring Investment Distortions When Risk-Averse Managers Decide Whether to Undertake Risky Project." Financial Management 34, pp. 21–60. Rappaport, A. (1988). Creating Shareholder Value: A Guide for Managers and Investors. Free Press: New York. Razgaitis, R. (2003). Dealmaking Using Real Options and Monte Carlo Analysis. John Wiley and Sons: New York. Reilly, F. (1992). Investments. The Dryden Press: Fort Worth, TX. Remer, D. S., S. B. Stokdyk, and M. L. Van Driel (1993). "Survey of Project Evaluation Techniques Currently Used in Industry." International Journal of Production 32(3). Ross, S. A. (1973). "The Economic Theory of Agency: The Principal's Problem." American Economic Review 63(2). Ross, S. A. (1977). "The Determination of Financial Structure: The Incentive Signaling Approach." Bell Journal of Economics 8(1). Ross, S. A. (1977). "The Determination of Financial Structure: The Incentive Signaling Approach." Bell Journal of Economics 4. Ross, S. A. (1995). "Uses, Abuses and Alternatives to Net-Present-Value Rule." Financial Management 24(3). Rubinstein, M. (1973). "A Mean-Variance Synthesis of Corporate Financial Theory." Journal of Finance 28(1). Salamon, G. L. (1985). "Accounting Rates of Return." American Economic Review 75. Salamon, G. L. (1988). "On the Validity of Accounting Rates of Return in Cross-Sectional Analysis: Theory, Evidence, and Implications." Journal of Accounting and Public Policy 7. Scherr, F. C. (1989). Modern Working Capital Management. Text and Cases. Prentice Hall: Englewood Cliffs, NJ. Schilling, G. (1996). "Working Capital's Role in Maintaining Corporate Liquidity." TMA Journal 16(5). Sharpe, W. F. (1964). "Capital Assets Prices: A Theory of Market Equilibrium under Conditions of Risk." Journal of Finance 19 (3), pp. 425–42. Shiller, F. J., and F. Modigliani (1979). "Coupon and Tax Effects on New and Seasoned Bond Yields and the Measurement of Cost of Debt Capital." Journal of Financial Economics 7(3). Shleifer, A., and R. Vishny (1992). "Liquidation Values and Debt Capacity: A Market Equilibrium Approach." Journal of Finance 47(4). Smith, J. E., and K. F. McCardle (1998). "Valuing Oil Properties: Integrating Option Pricing and Decision Analysis Approaches." Operations Research 46(2). Smith, J. E., and R. F. Nau (1995). "Valuing Risky Projects: Option Pricing Theory and Decision Analysis." Management Science 41(5). Stiglitz, J. (1969). "A Re-Examination of the Modigliani-Miller Theorem." American Economic Review 59(5). Stiglitz, J. E., and A. Weiss (1981). "Credit Rationing in Markets with Imperfect Information." American Economic Review 71(3). Taggart, R. A. (1991). "Consistent Valuation and Cost of Capital: Expressions with Corporate and Personal Taxes." Financial Management 20(3). Trigeorgis, L. (1996). Real Options: Managerial Flexibility and Strategy in Resource Allocation. MIT Press: Cambridge, MA. Turnbull, S. M. (1979). "Debt Capacity." Journal of Finance 34(4). Washam, J., and D. Davis (1998). "Evaluating Corporate Liquidity." TMA Journal 18(2). Zmeskal, Z., and D. Dluhosova (2009). "Company Financial Performance Prediction on Economic Value Added Measure by Simulation Methodology." Proceedings of the 27th International Conference on Mathematical Methods in Economics, Mathematical Methods in Economics; H. Brožová, R. Kvasnička eds., Czech University of Life Sciences, Chapter 4. Net Working Capital Management Strategies Database Amadeus product of Bureau van Dijk (date of release: 2013 SEP 15). Michalski, G. (2008). "Value-Based Inventory Management." Journal of Economic Forecasting 9(1), pp. 82–90. Michalski, G. (2009). "Effectiveness of Investment in Operating Cash." Journal of Corporate Treasury Management 3(1). Piotrowska, M. (1997). Finances of Companies: Short-Term Financial Decisions. AE: Wroclaw. Sarjusz-Wolski, Z. (2000). Inventory control in an enterprise (in Polish: Sterowanie zapasami w przedsiebiorstwie). PWE: Warszawa. Sierpinska, M., and D. Wedzki (2002). Financial liquidity management in an enterprise (in Polish: Zarzadzanie plynnoscia finansowa w przedsiebiorstwie). WN PWN: Warsaw. Conclusion Etiennot, H., L. A. Preve, and V. S. Allende (2012). "Working Capital Management." Journal of Applied Finance 1 (ISSN 1534-6668), pp. 162–75 [This work was reported also as Etiennot, H., L. Preve, and V. Allende (2011). "Working Capital Management: An Exploratory Study." Journal of Applied Finance 2/2011, pp. 2–23 (available at SSRN: http://ssrn.com/abstract = 2119217).] Further References from Value-Based Working Capital Management Ehrhardt, M., and P. Daves (2002). "Corporate Valuation: The Combined Impact of Growth and the Tax Shield of Debt on the Cost of Capital and Systematic Risk." Journal of Applied Finance 12(2), pp. 31–38. Elvin, M. (2004). Financial Risk Taking: An Introduction to the Psychology of Trading and Behavioural Finance. John Wiley & Sons: Chichester, West Sussex, Hoboken, NJ. García Teruel, P. J., and P. Martínez Solano (2007). "Effects of Working Capital Management on Enterprise Profitability." International Journal of Managerial Finance 3, pp. 164–77. Grinblatt, M., and S. Titman (2001). Financial Markets and Corporate Strategy. McGraw-Hill/Irwin: Boston. Kerkhof, J., B. Melenberg, and H. Schumacher (2010). "Model Risk and Capital Reserves." Journal of Banking & Finance 34, pp. 267–79. Leary, M., and M. Roberts (2005). "Do Firms Rebalance Their Capital Structure?" Journal of Finance 60(6). Margrabe, R. (1978). "The Value of an Option to Exchange One Asset for Another." Journal of Finance 33(1). Markowitz, H. M. (1952). "Portfolio Selection." Journal of Finance 7 (1), pp. 77–91. Triantis, A., and A. Borison (2001). "Real Options: State of Practice." Journal of Applied Corporate Finance 14(2). Van der Wijst, D. (1989). Financial Structure in Small Business: Theory, Tests and Applications. Lecture Notes in Economics and Mathematical Systems, vol. 320. Springer-Verlag: Berlin Heidelberg. Vijayakumar, A. (2011). "Cash Conversion Cycle and Corporate Profitability: An Empirical Enquiry in Indian Automobile Firms." International Journal of Research in Commerce, IT & Management 1(2). ; National Science Centre no. DEC-2011/01/B/HS4/04744 ; Grzegorz Michalski

Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.

Judith P. Mitchell, ca. 1984; Judith P. Mitchell, May 17, 2013 ; The Weber State University Oral History Project began conducting interviews with key Weber State University faculty, administrators, staff and students, in Fall 2007. The program focuses primarily on obtaining a historical record of the school along with important developments since the school gained university status in 1990. The interviews explore the process of achieving university status, as well as major issues including accreditation, diversity, faculty governance, changes in leadership, curricular developments, etc. ; This is an oral history interview with Judith P. Mitchell conducted on May 17, 2013 by Ruby Licona. Judith discusses her career at Weber State from 1983 to 2011 in the Teacher Education program. ; 35p.; 29cm.; 2 bound transcripts; 4 file folders. 1 video disc: digital; 4 3/4 in. ; Oral History Program Judith P. Mitchell Interviewed by Ruby Licona 17 May 2013 i Oral History Program Weber State University Stewart Library Ogden, Utah Judith P. Mitchell Interviewed by Ruby Licona 17 May 2013 Copyright © 2014 by Weber State University, Stewart Library ii Mission Statement The Oral History Program of the Stewart Library was created to preserve the institutional history of Weber State University and the Davis, Ogden and Weber County communities. By conducting carefully researched, recorded, and transcribed interviews, the Oral History Program creates archival oral histories intended for the widest possible use. Interviews are conducted with the goal of eliciting from each participant a full and accurate account of events. The interviews are transcribed, edited for accuracy and clarity, and reviewed by the interviewees, who are encouraged to augment or correct their spoken words. The reviewed and corrected transcripts are indexed, printed, and bound with photographs and illustrative materials as available. Archival copies are placed in University Archives, which also houses the original recording so researchers can gain a sense of the interviewee's voice and intonations. Project Description The Weber State University Oral History Project began conducting interviews with key Weber State University faculty, administrators, staff and students, in Fall 2007. The program focuses primarily on obtaining a historical record of the school along with important developments since the school gained university status in 1990. The interviews explore the process of achieving university status, as well as major issues including accreditation, diversity, faculty governance, changes in leadership, curricular developments, etc. ____________________________________ Oral history is a method of collecting historical information through recorded interviews between a narrator with firsthand knowledge of historically significant events and a well-informed interviewer, with the goal of preserving substantive additions to the historical record. Because it is primary material, oral history is not intended to present the final, verified, or complete narrative of events. It is a spoken account. It reflects personal opinion offered by the interviewee in response to questioning, and as such it is partisan, deeply involved, and irreplaceable. ____________________________________ Rights Management All literary rights in the manuscript, including the right to publish, are reserved to the Stewart Library of Weber State University. No part of the manuscript may be published without the written permission of the University Librarian. Requests for permission to publish should be addressed to the Administration Office, Stewart Library, Weber State University, Ogden, Utah, 84408. The request should include identification of the specific item and identification of the user. It is recommended that this oral history be cited as follows: Mitchell, Judith P., an oral history by Ruby Licona, 17 May 2013, WSU Stewart Library Oral History Program, University Archives, Stewart Library, Weber State University, Ogden, UT. iii Judith P. Mitchell ca. 1984 Judith P. Mitchell May 17, 2013 Abstract: This is an oral history interview with Judith P. Mitchell conducted on May 17, 2013 by Ruby Licona. Judith discusses her career at Weber State from 1983 to 2011 in the Teacher Education program. RL: I'm Ruby Licona and I am on the faculty here in the Stewart Library. Today is May 17, 2013 and we are speaking with Judith P. Mitchell, who retired from the Teacher Education program in 2011. She originally came to Weber State in 1983. We are looking forward to speaking with her and getting a good perspective on her years here at Weber. Our meeting this morning is in the Waterstradt Seminar in the Special Collections Library. Good morning, Judy, how are you? JM: Good morning. I am fine, thank you. RL: I am so glad you agreed to do this. We are trying to capture as many perspectives on Weber State and its history as possible and your name came up as someone that we should spend some time talking to. Why don't we begin with you telling us a little bit about your background, where you grew up and what might have drawn you to teaching? JM: I grew up at least part of the time in Ogden. My parents were from Ogden. When I was a child, my father went to medical school. We lived in Portland, Oregon for about seven years and in Philadelphia for a year while he completed his education. He was an ophthalmologist here in Ogden. We came back to Ogden when I was nine years old. I started the fifth grade at Polk School, went through the Ogden School District system and graduated from Ogden High School. Page 1 of 35 Afterward, I went to Stanford University and spent four years there. My major was music. It was a wonderful background and I've never regretted it for a minute because it probably did more to enhance my life and my children's lives than any other education I could have had at the time. I had lots of literature, music, art history and history classes. It was a nice foundation for whatever I decided to do next. After college, I came back to Ogden and went to work for Amalgamated Sugar. Those were the days when old Mr. Benning was still in charge of Amalgamated Sugar. He was an interesting man who still had the secretarial girls ironing the carbon paper so that it could be reused. He also had these little things that went on the end of the pencil so that they could use the pencil down to the last stub. I think he bought Amalgamated Sugar at a penny a share, so he came through all of those really hard years and he knew how to squeeze a nickel. After that, I was recruited by Bill Eccles to work for First Security Corporation as his executive secretary. First Security then moved to Salt Lake, so I moved to Salt Lake as well. At that time, I became reacquainted with the man I later married. He was a year or two older than I and I had known his sister. I have three children. Of course, they are all adults now and I have five grandchildren. When I was having my first baby, I quit working and I stayed home. When my two oldest children got into school, I was so interested in the process of how children learn to read that I thought, "Here I am with a Stanford Baccalaureate Degree and I could just whip down to Polk School and teach reading." I discovered that I had to have a state Page 2 of 35 license, so I came to Weber State. They accepted all my liberal education credits and I had to take the teacher education courses. I think I had to take ten hours of science which I had carefully avoided in college previously. They awarded me a Baccalaureate Degree in Science and then I went on to teach in the public schools in Weber School District. I taught at Marlon Hills Elementary and Valley View Elementary and ended up out in Hooper. I loved Weber School District. They gave me opportunities to learn and do different things. I'm not sure that the educational standards of the parents were necessarily the most important thing, but they were good parents and they were very supportive of the school and of teachers. The children were lovely children and were wonderful to teach. I had never spent any time in a farm community before and at that time Hooper was a farm community. Many raised sugar beets as a cash crop. In the fall, there would be mountains of sugar beets waiting to be picked up. I earned a Master's Degree from Utah State University in education and my thesis was on reading. Then, I decided to do a doctorate and did that at the University of Utah. I knew I liked the public schools. I liked teaching and I liked the kids, but I am restless by nature and I thought what I really wanted to do was teach in higher education because I thought I could make a difference. RL: Was it a Ph.D. or an Ed.D. that you earned at the University of Utah? JM: It was a Ph.D. I like going to school. I think most of us that are in the education field like going to school. We like to teach, but we also like to be taught. So, when Page 3 of 35 the opportunity came up for me to come to Weber on a trade for a year, I was delighted. My district had recommended that since I had the doctorate. RL: So you came here on a trade? How did that work? JM: Karen Neilson was a professor in the Teacher Education program and her field was secondary education and literacy. Of course, I was an elementary person, but that made little mind. It was my first experience with taking somebody else's course and somebody else's notes and trying to figure out what it was that I was supposed to teach. She would have things in her notes like, "Come tomorrow and it will be a big surprise about this or that." I would think, "What is the big surprise that I'm going to come up with?" She extended her contract with the DODS schools, so I had an opportunity to come to Weber. This was at the time of the WILKITS. The WILKITS were packets of materials and students moved through them at their own pace. Many of us from traditional education settings had difficulty with this notion because there were no set classes and we met with students individually. For some students it worked wonderfully and for others it didn't work well at all. RL: Was that something that was just here at Weber, or was that a trend? JM: It was a new trend across the country in some ways and people came from all over to see the programs at Weber. RL: Was it solely in education? JM: Yes, it was only in education. A group of professors in Teacher Education had come to Weber at about the same time and they decided they could develop this program. They received a big federal grant so that they could be freed up for an Page 4 of 35 entire year to develop all the program materials. The thing they didn't really have time to do was to develop the assessment materials that went with it. I went through this program when I came to Weber to get a license to teach. For me, it was good. I'm quite self-motivated and I balance my time well, but for many students it was a nightmare. There were no deadlines so you just moved through it at your own pace. RL: That has a similarity to some of our online courses now, doesn't it? JM: Absolutely. RL: You have students that are very motivated and jump right in. I've had students try to turn in all of the assignments in the first week of an eight week block. I tell them, "No, we need to go through some things first." JM: Yes, it is the same idea. As I said, there were no set classes, so you'd just make an appointment with your professor when you were ready to be checked out of that particular module. I think they transported those modules all over the world. There was a big program in the Middle East and Blaine Parkinson and Harley Adamson made many trips. The college received a big national award for the program. It was cutting edge at the time. RL: We did have people from Weber who were involved with opening up a university in the Middle East. JM: That's right. I think Blaine was one of them and he was dean of the College of Education at one time. As some of us came to campus, we looked at teaching and learning differently and felt the need to have more set classes where we saw more than one student at a time. It was very time consuming for the faculty to Page 5 of 35 meet one-on-one with students. By the end of the fifth or sixth year after I came, I didn't see any more modules. RL: Were they just kind of eased out? JM: They were. People had different feelings about them. Like anything else, if you've had a hand in developing something you're a real advocate. RL: You have more ownership of it. JM: Absolutely. RL: Who were some of your colleagues when you came here? JM: Some of them have been here a long time. Luan Ferrin, Jimmie Merrill, Keith Burnett, and Burdett Johnson all came to Weber at about the same time. RL: You mention a lot of men. Were there not as many women in education at that time or just not in higher education? JM: When I went to work for Weber district, there wasn't a single woman administrator in Weber School District. That's a big school district. I think there were a few more women in Ogden School District. As a child, I had a woman principal and it wasn't uncommon at all. Later, it seemed like you didn't see many women in administration. We saw a lot of women teachers and still do, but not too many administrators. RL: There were some women in upper level positions during World War II as a result of the men being gone, but then I think it reversed. JM: Yes. I'm sure it did. It was pretty much a group of men. There were two or three women and they had been here a long time. They had been here at the time for this development. Page 6 of 35 RL: Did the men help to mentor you or was it more adversarial? JM: It wasn't adversarial. I'll have to say that Don Sharpes was the one who really sat me down and said, "Now, this is how you do your vitae and how you keep your records and your file. Oh by the way, the ladies room is down there." RL: That's essential orientation. JM: I didn't find that any one colleague did as much mentoring as they might have. Cordell Perkes hired me. He was a chair at the time. He was a very good colleague and was helpful. Dick Jones was the dean, at the time, in the College of Education. He was also very helpful as far as I was concerned. When Dick was named Dean of the College of Education, there were two other faculty members that aspired to be dean, but they were not selected. I think Bob Smith was the Vice President of Academic Affairs, the position now call Provost. He made the choice and I think Dean Jones had a hard time because there were a lot of good 'ol boys who felt they were cheated and that they should have the position. They didn't like the way Dick ran the finances. I'm not sure it would have mattered what he did or how he did it, they wouldn't have liked it. For me, as a new faculty member, he was a good dean. He gave me a lot of opportunities to do different kinds of things and I appreciated that. Cordell Perkes had come in not too long before I and he was very supportive of changes and was looking for new ways to do things and understood that there's a freedom in being an academic. I think that one of the difficulties with the WILKIT system was the fact that there wasn't any academic Page 7 of 35 freedom in terms of how we did things in a classroom. That kind of flew in the face of what most of us believed. RL: You came in 1983. When I arrived in 1990, we had three Master's programs. That would have been just seven years after you got here. I understand that you were one of the ones that established the master's program in education. JM: Well, not really. When I came, the Master's in Education was a combined program with Utah State University. There were three people from USU and three from Weber that sat on a steering committee. Within a year or so, I did do that, which was wonderful and it taught me a lot about the program. Weber faculty members were doing most of the teaching and that gave us some grounds for saying that it should be Weber's program since we were doing the work with the students and teaching the classes. Don Sharpes was hired to head up that combination of faculty from the two universities and to run the program. I did have that nice opportunity to get in from the beginning on the whole thing. When the program was finally declared independent, I did direct the master's program for about 13 or 14 years. RL: Maybe that's where I got the impression that you had helped to establish it. You were in on the ground floor though. JM: Yes. At the beginning, I had that opportunity along with the chair and somebody else. I was Chair of Elementary Education during some of that time when we were still a part of Utah State's program. Page 8 of 35 RL: What other kinds of things were happening on the campus that you might have been involved with early on? There were some changes happening in the 1970's and 1980's with the establishment of the Faculty Senate. JM: That must have been earlier because when I came, there were stories about Joe Bishop wiring the Faculty Senate room where we held meetings. The reason it all came out was because somebody went to a little party after the Faculty Senate meeting and there was a lot of information that was out. When I came they were still reeling from President Bishop and the kinds of things that went on while he was president. I think he was a man who was very suspicious about what faculty might do. RL: From what I understand, he was trying to pull in the reins at a time when the Faculty Senate was starting to gain more academic freedom and more faculty involvement and control. JM: No question. When I got involved in Faculty Senate, it was one of the best things that happened to me academically. For one thing, I worked with awfully interesting people. Secondly, the Faculty Senate had gained a great deal of power working with Rod Brady. RL: I believe he left in about 1987 or 1988. JM: Then Stephen Nadauld came. We became a university at that point. RL: That's right. That happened toward the end of 1990. JM: There were a lot of changes at the university. We were suddenly looking at ourselves differently. I think there had been an attitude that it was just an extension of Harrison High. Part of that grew out of how faculty looked at Page 9 of 35 themselves and how they looked at the school, not so much the townspeople perhaps. RL: Recently, I've heard a couple of things on television that have grated on my nerves. There was a young man on one of the news programs that grew up in Ogden. He was presenting an award of some kind and asked the young woman where she was going to be going to college and she said, "Weber State." He said, "Oh, Harrison High School." If I had been there I think I would've throttled him. Not too long after that I heard someone on KUER, University of Utah's radio station, referring to us as Weber State College. I thought, "We've been Weber State University for 22 years now. Attitudes have to change sometime and people like you need to be taken to the wood shed." JM: In many ways faculty were their own worst enemies because they were the ones who perpetuated it. It was a shame. Suddenly, university status did a great deal for Weber in terms of attitudes. At the time, Weber State College was the biggest four year college in the United States granting baccalaureate degrees. RL: They had a large enrollment. JM: Exactly. RL: There were a lot of things that were attractive then that still are now. The trend to try and keep classes smaller and community involvement and different things that have been developed here on campus are still attractive. When we were going through the process to become a university there was a lot of squawking from University of Utah and Utah State University about something being written in that would prevent Weber State from becoming a doctoral granting university Page 10 of 35 and that there were not to be massive numbers of graduate degrees. We haven't grown greatly, but we do have nine graduate degrees now. Certainly, the accent has been on programs that add to the workforce and meet the need of not just the immediate community, but of the state with the emphasis on providing an educated workforce. I guess that's kind of an extension of starting out your program as a Utah State program. JM: I think that's true. The other thing that's interesting is that if you look at the graduation statistics at Weber, half of them are still two year degrees. They are not baccalaureate degrees at all. RL: Some students do go on to get their baccalaureate. JM: A state the size of Utah could hardly afford two research universities. One of the things I think the Board of Regents has done especially well is that they have taken a look at programs and tried to avoid duplication. There is one medical school in Utah and no dental school. There's one law school. I think those kinds of things make sense because a state the size of Utah really can't afford to run two medical schools or two law schools. RL: Brigham Young University does have a law school. It's privately funded, but even so, it is a situation where we've got a couple million people in Utah. JM: It's growing, heaven knows. It's a tiered system. California has the same kind of tiered system. You have your research universities and you have your state universities and it seems that's where the growth is happening, perhaps more than we need it right now. Utah Valley University is just huge and Southern Utah is a master's granting university again. Page 11 of 35 RL: Of course, Dixie has gone from a two-year program to a master's granting university. JM: Price is a satellite for Utah State which is different, but the fact that Dixie is getting university status in many ways is rather surprising. A lot of the people in St. George are snowbirds, but apparently they seem to think they have a population to support a university. RL: It is the same administrator down there that helped Weber State become a university. JM: Yes, Stephen Nadauld is there. It's interesting, I think, that Utah has done a pretty good job in figuring most of this out. I have great respect for the University of Utah and Utah State University and they have significant programs that are highly rated and they should be. I am proud of Weber. When I look at what's happened in the last couple years, I think about what happened with the music department. RL: There's a new advertisement showing our resident piano prodigy that says, "Chose Weber State Over Julliard." When you see that it picks you up. JM: It makes you proud. Fan Ya's success has resulted in more students coming for the music program because of how well this young woman has done. RL: She's got the support of the administration. JM: No question about it. It has been helpful. On top of that, I've never seen a girl or a boy work harder than she does. She's earned every inch of it. RL: We also have a top-notch nursing program. Getting back to the College of Education, are there students that you had in those early years that you have Page 12 of 35 learned about their accomplishments and whom you feel got the basis for them here? JM: Absolutely. That first year I taught at Weber, I taught secondary students. Depending on their major, many were a challenge in a literacy course. In a lot of other courses they were as well and the students would say, "Well, in our majors we never write." It was a challenge for me. One of my very finest students was Jeff Stephens, who is now superintendent of Weber School District. He got his master's here and he went off and got his doctorate. There are many that I see who are school principals, wonderfully successful classroom teachers, and reading coaches. I've been teaching the level two reading coaching class for about five or six years now and most of them have Master's degrees when they come back to get this extra certification. They are the cream of the crop. They're bright, hard-working and they make a huge difference in school. RL: They come back to Weber State, and I don't think that's necessarily just for the location. JM: I don't either, although that plays a role. RL: I think they are looking for a quality program. JM: I think so. Weber has made a huge effort to maintain the class sizes. I think the faculty reaches out to students in good ways. There are not classes that are taught by students who do not speak English which is a huge advantage. One of my boys did a doctorate at the University of Utah and in the last year he said, "It's a do-it-yourself thing. This fellow doesn't speak any English at all and it really is a do-it-yourself educational program." That doesn't happen at Weber. Faculty Page 13 of 35 teach the classes, which I think matters. I think our graduates that are out in the field tend to think, "I did well as an undergraduate at Weber. I'll go back and do some graduate work there." One of the things I am most proud of was that in our Master of Education program, we maintained high standards. Students did a thesis or a project which was very scholarly. Everybody at that stage knows how to take classes and how to pass classes. The thing that really separates the men from the boys is doing some research and writing about it. I'm proud of that. I think that our master's program in education can stand up to anybody's. RL: The emphasis at Weber has changed somewhat in the last 20 years and there's more of an emphasis for the faculty to have more scholarship and research involvement. That still hasn't changed their role with the students. JM: You're absolutely right. RL: Certainly, Weber has won some kudos for bringing the National Undergraduate Research program here to Weber. Also, the Undergraduate Literature Conference we have every year is still used as a cookie cutter model for other places. In Teacher Education, you had the ISTE international group of people here from Australia, New Zealand, Europe, and Africa. That has to be a feather in you cap. JM: I think so. Along that whole line is that the College of Education has managed their endowment well and it has given faculty opportunities to attend conferences in a variety of places both in this country and abroad. They've had opportunities to make contacts with scholars and teachers and that's been valuable. Page 14 of 35 RL: Has Teacher Education done anything in terms of cooperative programs? Are there sister universities or programs that you've maintained? JM: I think the one thing I can think about is when I first came to Weber, one of the faculty members originally came from Arizona and she had done a lot of work with Native Americans on the reservations. She was a really brilliant lady and her field was reading. When she came to Weber, she wrote some grants and we ended up taking our teacher education program to Blanding. I was the new kid on the block, so I taught quite a bit in Blanding and Bluff, which was an eye-opener for me. Most of them were Navajo students seeking education degrees in order to teach. At that time in Blanding, there was an elementary school and I would say maybe 80 percent of the youngsters were Native American children. There wasn't a single aid, teacher, or administrator that was Native American. In Bluff, I think 98 percent of the children were Native American kids and there not a single teacher or aid that was Native American. We took that program down for a number of years and we trained a number of teachers, which I think changed the whole educational environment down there. Some of them didn't end up in teaching, but ended up in federal agencies where their educational background was valued. RL: They advanced beyond what had been available previously. JM: It was interesting because the way the Pell Grants worked then was that they got the money no matter if they completed a class or not. Quarter after quarter, you'd have some of the same people in the class because they never finished a class, but they got their Pell Grant so that they could go to school. It also supported Page 15 of 35 them for food, rent, and all of their living expenses. The Navajo culture is very matriarchal and many of the men didn't work or there wasn't work for them. There were high rates of alcoholism. The women would come to class and the men would stand along the back wall like, "Don't you teach my wife anything, it'll change the world." Many of the women were very ambitious and looked at their children and thought, "It's going to be up to me or these kids are going to end up like their not very good dad." We had quite a bit of success with that. Many times, these teachers would come up in the summer to take classes on the campus. They'd bring their kids and live in the dorms. It was a big sacrifice for them. It was wonderful for us. Certainly, it was an opportunity for me, who came from a background where I knew very little about Native American populations. When I went to college, it was very un-diverse. We were mostly white, middle-class kind of people. RL: We've been lucky at Weber that several of our presidents have put an emphasis on diversity and unity. I know when I got here, I started looking around at our student body and someone had mentioned that Weber and Ogden School Districts were something like 25 percent Hispanic, Latino, etc. When I looked around on campus, there were fewer than one percent of our students that fit into that category. Certainly, it's not up to 20 or 25 percent, but we are more between 5 and 10 percent now. JM: Exactly. Families that perhaps never anticipated college for their kids are looking at education differently. Page 16 of 35 RL: We are certainly seeing a lot more brown faces, Asian students, Pacific Islanders, etc. I think that changes the flavor of the University in the right direction. In regard to that, you started here when we had President Brady and when he left Stephen Naduald came and then Paul Thompson and F. Ann Milner. That was a big feather in Weber's cap too, having a female president. JM: She was a very successful female president. It was at a time when Eastern Utah had hired a woman who ran through the money like water through the creek. When she left, that little college was in horrible condition because the money had been spent. I never went to a conference anywhere in the United States that she wasn't there. I would think, "This isn't your field. Why would you be interested in this?" Ann came with an excellent background and she'd been well-trained by Paul. She was a very successful woman not only on our campus, but across the state and with the legislature. RL: She was well-respected. JM: Absolutely. It is a feather in Weber's cap. No question. RL: As far as the different administrators and the type of ship they sailed in terms of their styles, did that affect your career in any way? JM: I think it did. When I was active in the Faculty Senate and I was faculty chair for three years and co-chair for three years. RL: You were the second woman to do that? JM: Yes. I think Rosemary Conover was the first one. I had a good six year run, which was nice. Paul Thompson was the president and he very much believed in shared governance. He gave us lots of opportunities to be heard and he was Page 17 of 35 good to work with in that he felt that there were a number of things about which the faculty needed to have an equal voice, to have a say and to be able to ask the hard questions. For most of us at that time working in faculty governance, we had great opportunities. RL: I think he was more willing to accept some of the suggestions coming out of the Senate. I remember at one point I was chairing the Academic Standards Committee and I was given a list of 13 or 14 things that needed to be accomplished. That was about the time of the Gulf War and we were having to come up with policies regarding students who were pulled out of class and sent to the Middle East and what were we going to do with them when they came back as far as tuition or letting them finish classes. There were a lot of major things that were being determined then that our committee was involved with. We ended up coming up with the tiered admission thing so that we could still meet the mission of the University, but take on the new issues that we were facing. I think that was a time when people did have a voice. As far as your involvement in heading up the Faculty Senate, were there major things occurring that you needed to deal with? What were they and what were some of the outcomes? JM: When I started in affairs of Faculty Senate, Tom Burton was the chair. He appointed me to the Curriculum Committee and that was both curriculum and general education at the time. RL: So you came in as a new faculty member first? JM: Yes. Then I became chair of the Curriculum Committee. At the time, curriculum and general education were combined into one committee. Of course, we didn't Page 18 of 35 have the technology, so everything would be delivered to my office and there would be a stack of papers to read through. Those were very different times. I look back at the number of trees we must have killed. Tom was a good mentor and a good trainer. Curriculum and General Education was a great place to start and became something that I continued to work in while I was at Weber, until the last few years. One of the things that happened during the time I was in Faculty Senate was the big conversion to semesters from quarters. I still maintain that most of my students, even some of my graduate students, have a ten week attention span, not a 15 or 16 week attention span. The state said it would cheaper and of course it wasn't cheaper, it cost tons of money to make the conversion. It was far more complex than any of us thought. We made a lot of presentations about the change and why not. At the time, I was on the State Committee for General Education and that was a wonderful time because it was the first faculty committee that was under the Board of Regents. Each of the colleges and universities was represented. I was on that for about 15 years and we did a lot of things. The legislature decided the institution needed to have some common numbers, particularly for general education courses. We did a lot of that without wrecking people's individual programs. Most students in Utah at some time or another attend another university somewhere in the state. With some common numbers in those undergraduate courses in general education, the transfer was easy. For me, personally, working with the faculty leaders from across the state was a wonderful experience. They were the brightest of the bright. It gave me access to Page 19 of 35 friendships and acquaintances that I never would have had and it allowed me to know who to talk to at each university when something came up. Another group I really liked working with was the group of Faculty Senate presidents. In fact, that's where I met our present president. He was the President of the Faculty Senate of the University of Utah when I was active at Weber. He was a good chemistry professor and very bright, so now for him to be our president is an interesting kind of thing. Anyway, they were wonderful, interesting, smart people that had lots of ideas. We had a lot of respect. We were appointed by the Board of Regents and then appointed within our universities. Bob Smith put me on, so that was a long time ago. I learned a lot about higher education and I also learned a lot about the curriculum and systems within our state and how well most of them work. The change from quarters to semesters was also a big deal. RL: That was in the mid-1990's, wasn't it? JM: Yes. I think it was about 1995. That was a really big switch. In some ways, it made us come into a commonality with other universities within our state. I have to laugh because all the arguments about why semesters are so much better than quarters are a crock. There are wonderful universities across the United States that are still on quarters like the University of Oregon, Stanford, Columbia, etc. RL: Judy, you've talked a little bit about your involvement with the Faculty Senate as chair and the General Education/Curriculum Committee after you stepped down as chair. At about that time, we had a big push with the diversity requirements in Page 20 of 35 the classes and the Curriculum and General Education became separate committees and they are very involved. JM: Yes, and I went back on General Education just a few years ago. RL: You mentioned that, so what I wanted to ask you how that worked out for you and did you stay involved with that until you left? JM: Yes, until about last year, I continued to serve on senate committees. I served on a number of senate committees, which was wonderful. I think they seemed to value my background and what I'd already done and it worked well for me because I really enjoyed working with my colleagues. During the time I was senate chair, I was also head of Teaching and Learning because our person left. I was wearing two hats and I had three offices instead of two. It was a busy time. My department was good about the release time and at that time the Faculty Senate had some money, so we did get release time, which was a huge help, I couldn't have done most of what I did if I hadn't had some release time. RL: This was during the time of Paul Thompson's presidency? JM: Yes it was. RL: Then he left and Ann Milner stepped up to the plate and hit a few home runs. JM: Right. While Paul was president and Eisler was the provost, I worked a lot with Eisler and when it came time to name a new president, it was between him and Ann, do you remember that? RL: Yes. I had been off campus then for a little while. Page 21 of 35 JM: He was the provost and was an academic and Ann was someone who came through Continuing Education and Paul had mentored her wonderfully. Of course, she is a bright woman and she did a good job. RL: She had been involved with Development. JM: She had all of those kinds of things on that side of the university. RL: Those are important too. JM: Well, raising money is always important in universities. For Ann, I was surprised when she stepped down when she did simply because the capital campaign was her baby. I was just really surprised that she didn't see it to the end. RL: She did mention when she first started that she would take it and put in ten good years and that's what she did. Were you involved with any of the things that she helped to develop? JM: I've been on the University Capital Campaign Committee, so if raising money is part of it, yes. I am head of the committee for the College of Education even though I've retired. RL: Speaking of the College of Education, you would have been through a few deans there. JM: That's one way to put it, yes. When I came Dick Jones was the dean. As I said, he came in without a level playing field in many ways because there were two faculty members that thought they should have been the dean. That made it really hard. He did some things really well and some things less well, but it's true of all of us. There was finally a vote of no confidence and I think that Bob Smith decided it was probably time for him to go before there was a formal vote of no Page 22 of 35 confidence. It wasn't over anything dishonest or anything like that. There were just enough differences so he left. Then they hired Green, and he was the first African American dean on campus. Again, like any dean, he had his interests and did some things really well and some things not so. Jack Rasmussen was the next. He had been here as a faculty member so most of us had worked with him. He was a good teacher and he seemed to be a good administrator, so when he applied for the position we were interested. He was the dean in North Dakota at a university. We were happy to have him back. The known is always kind of nice and we knew what to expect. I think he's been an effective dean. I think he's had the respect of the faculty, he's good to work with, and he's a dependable person. RL: How long has he been here now? JM: I'm not sure. I think he's been here for maybe seven years. He's the senior dean on campus. RL: You were talking about his being supportive. Was there a difference in the level of support you got from each of those deans? JM: I had wonderful support from all of them, I can't complain at all. There was always money for me to present at conferences. Ray Reutzel, who was a professor at Utah State and I applied for the editorship of, The Reading Teacher, which is the premier journal of the International Reading Association and received the appointment. That was a five year thing and they came out and visited with the President, Provost and Dean to make sure that I would have the support I would need to do the job. They did the same at Utah State for Ray. I Page 23 of 35 had release time for it and I had financial support from International Reading. My dean could have said no. It was when Green was the dean. I guess Eisler must have been the provost and Paul was the president and they met with all of them to say, "Can she do this? Will you give her support and release time?" There was no question. It was a prestigious journal to begin with and it was nice that westerners were nominated and chosen to do this. I learned a great deal from that experience. Reading has been the thing that I've been most interested in, so that was a wonderful thing. RL: It's a basis for many things in education, isn't it? JM: I think it's the basis for learning when it comes down to it. I think for the youngsters who struggle it isn't just learning how to read, it's how to use literacy. In your position you know all about that. The other thing I've had a lot of support on for 28 years is running a reading and writing conference every summer. The State has given me some money and Weber has given me some money and support. This is the first summer that we haven't done it. We've brought to campus outstanding people in the field of reading and writing to do the conference. That has been a wonderful thing for our students and for our teachers in the field. Things like that I will miss terribly. I do miss them. RL: Were there other national programs that you were involved with that you got particularly good support for? JM: Yes there surely were. Of course, going to conferences is part of it and presenting at conferences takes support. I was on quite a few national Page 24 of 35 committees for reading and literacy and children's books. Those people tend to be a community that knows one another. For me, it was a broadening kind of thing. It gave me people I could call on to hire for my reading conference. Probably the thing that gave both Ray and me the most exposure was that editorship. Ray went on and served on the Board of Directors of International Reading. He has an endowed chair at Utah State. He's a good scholar and good teacher and all those kinds of things. RL: You've mentioned that you're retired, but you're still here on campus. JM: Yes, but I am coming to the end. I had a substantial grant from the State to run the level two reading endorsement classes. There are three of them. There's a research class, an internship and a professional development class. The audience for those classes consists of people that have a level one endorsement in reading and are aspiring to be reading coaches in the schools. The level one classes can be taught within the school districts. For a long time we taught some of them and I have to laugh because I still see my syllabi floating around being used in the schools by somebody else. Level two has to be taught through the universities. Weber held on to those, but the problem is that the size of the audience for the classes is not very predictable and often not very big. Weber State University serves Box Elder, Davis, Weber and a few from Ogden school districts. RL: Of course, we now have an information literacy requirement for graduation here and to have the local school district do away with all of the media specialists… Page 25 of 35 JM: It doesn't make a bit of sense. Particularly in a district where there are more needy children than any district along the Front. They need those people. They are wonderfully well-trained. They are superb teachers. RL: The Regents said, "We need this computer and information literacy." One of the things that we were finding was that they were coming to us from the high schools unprepared. One of my colleagues wrote in a letter to the newspaper about seeing students come in and they've already written the paper and then they do the research because they need three references to put with the paper. Something is not right. JM: Something is not right. RL: Interesting times in the Ogden School Districts. JM: They have been interesting times for a long time. I know they are dealing with a lot of things that are difficult. I had a friend who was an administrator and we were talking about second language. He said, "It isn't the second language that's the problem, it's the poverty that's the problem." There are a lot of needy children and they need excellent teachers. Those media people are excellent teachers. They're cutting out all the part-time reading coaches as well. There are 240 and if they have them for 30 hours they don't have to pay any benefits. The whole thing is disgusting as far as I'm concerned. RL: In terms of your time at Weber, it sounds like you've accomplished a lot in the 30 years that you've been here on campus. Are there things that you were involved with that didn't succeed? Page 26 of 35 JM: Well, who's going to say yes to that? I'm kidding. There are certainly things that were successful at different levels. Some of the things I look back and I wonder why I ever opened my mouth. RL: It's perfectly alright for you to talk about that because it was something that you were concerned about. Were there things that you wish you had done and weren't able to for financial reasons or maybe Weber couldn't get involved because it wasn't the right time and place? As far as the big picture, were there other things that you would have liked to have seen? JM: When I came to Weber, I still had three youngsters at home. I was pretty place bound. After that, I went through a divorce and my two boys were then grown and out of the house and my daughter was in college. I started late with my academic career. I stayed home until my youngest was seven and didn't go back to work. Then, I had to get a license to teach school. I was place bound for a number of years. I think had I done things earlier, I might have left Weber and had some other kinds of experiences. At the time, with my personal life, when it was time to do those sorts of things, it was late to do them. I loved Weber and quite frankly, I think, "Where would I have had the opportunities that Weber has given me?" I had never thought I planned my life particularly well if you want to know the truth. I've kind of fallen into things without as much planning as I might have done. When I finally decided to go back to school and to teach, the hook that really was there for me was that I was fascinated with how children learn to read. What is it that happens in our brains? In watching children who struggle, what is Page 27 of 35 the difference in how they look at the world or how they process everything from children who don't seem to struggle? Luckily, my children did not struggle, and I did not struggle. Having worked with youngsters in school who do struggle, I thought it would be tough if I worked with these kids in school and then had to go home and work with my own, but my children did wonderfully academically. I really liked Weber and with a university this size, you can make some differences. When I was in college and got this music degree I could have taught piano maybe, but I didn't know how to do anything. I didn't know how to type when I graduated from college. I went to Wright-MacMahon Secretarial School in Beverly Hills for a year and learned how to do all kinds of secretarial things. RL: Was this after you finished you bachelor's at Stanford? JM: Yes. That's how I happened to come home and work for Amalgamated Sugar and then for Security Corporation. I had wonderful jobs. RL: When you mentioned being an executive secretary, I was wondering if that position had required a Bachelor's degree. JM: Well, let me tell you some of the things I did for First Security. I worked for Willard Eccles and I wrote all the Board and Executive Board minutes for the corporation, although, I never went to a meeting. He did all the public relations and advertising for the corporation and I learned a lot. I probably would have gone on working for First Security, but I married and when my first baby was born, I didn't work again for another ten or fifteen years. When I came back to school, perhaps if I had been more thoughtful about what I really wanted to do, I might have done something other than education. I Page 28 of 35 don't know. My father was a physician. The summer between high school and college, I worked in the newborn nursery at the old Dee Hospital and just loved it. I wanted to go to nursing school. My father wouldn't hear of it. Those were the days. He said, "No, you're not going to go to nursing school. You have the wrong thumbs for the bed pans." So, I didn't do that. In college, I had developed a lot of other interests as well. I look back and think probably what I would have done in a different era would be to have gone to medical school. I was bright enough to and I think I would have really liked it. RL: The mentality then was that women in medicine were nurses. JM: They were odd ducks if they went to medical school. My father just couldn't see that for sour apples. He was a physician and he couldn't see this thing at all. Later on, we had a lot of talks about this whole thing and his outlook changed. I had one female friend in law school and a couple in business school. Most of them were in more traditional majors for women. I have a niece who graduated in law and my daughter is in architecture, both nontraditional women's fields. My generation was different. RL: Well, we have touched on a lot of different things. What about your time at Weber? Are there things that you might have done differently other than having gone somewhere else? I've seen a lot of people here on campus who leave and come back because this is a great place to be. JM: And I am not sure that I would have left. I liked the administrative experiences I had. I was department chair, and I directed the graduate program for 13 or 14 years. I had a lot of freedom on that because we developed a thesis system. Page 29 of 35 When I got here they were doing some little paper that was paper bound and we said, "No, this does not look like professional scholarly work." We did a lot with curriculum and all that was very satisfactory to me. The other thing I guess I could mention are civic kinds of things that have mattered to me. I was president of the Junior League before I ever came to Weber. I've been on the symphony board for a long time. I'm a Commissioner for Landmarks for Ogden City and I'm on the Heritage Board. Those things are interesting to me. I've been involved with the music department simply so I could return to my roots. I've had fun knowing the people in the music department and the students. I'm really quite busy. I think the thing that scared me most about retiring was, "What if I don't have anything to do?" Of course, I've been teaching classes, but I won't at the end of this semester because there's no money to do it, which makes me sad because I just loved my students. The reading coaches were the brightest of the bright. They were just wonderful. My connection with the school districts, particularly with the Weber and the Davis districts has been very satisfying and keeps your hand in to see what's happening out there. I will miss that. I still serve on the Board of the State Reading Association and I get to see all of these great people I've either had in school or known. They have moved ahead and have done wonderful things in their lives and I am proud of that. RL: That's wonderful. Sometimes you can go to a banquet and pick up lots of things and you walk away and you're still hungering for something and then there are other times when things fall into place and you can say that you were satisfied. Page 30 of 35 JM: I think that is absolutely true and I still see a number of my colleagues from Weber. One thing that was terrific about the Faculty Senate work was that I had the opportunity to meet people in all departments. When I arrived, I was shocked that there was so little communication between the College of Education, particularly Teacher Education, and across campus. It just didn't happen. Accreditation meant that it had to happen and working in the Senate allowed me opportunities to meet people across the campus that I never would have known. RL: I think with things like the Community Involvement Program and the Teaching and Learning Forum and all of the programs now for helping people develop online classes and so forth, people are interacting a lot more than previously. JM: Yes. I think they are too. Ruby, were you here when we did Writing Across the Curriculum? RL: I was. JM: That was a wonderful time for exactly what you're talking about. RL: It brought people together from different parts of the campus and took you someplace and you sat down and you could exchange ideas for how to teach or how to develop particular processes and so forth. It was a good program. I think Teaching and Learning came from that because Lee McKenzie was the one who developed that. JM: She was a lovely lady. That was a tragic kind of thing. RL: It was. When you said that you did Teaching and Learning Forum for a year, I wondered whether that might have been about the time that Lee had to leave. Page 31 of 35 JM: I can't remember what the circumstances were, but suddenly we didn't have a director and Teaching and Learning fell on the Faculty Senate. We were doing whatever we were doing to find someone to head it up as I remember. It was an eye opener to me. I'd served on it at one time or another before that, so it wasn't completely new or anything. RL: It was a great program, and I think Lee did a great job establishing it. JM: She did. I remember that one of the faculty members who was perhaps the most changed and it was most surprising was a fellow that was in accountancy. He used it widely in his accountancy classes. You would think it would have been history or English, but I'll never forget that. He was such a proponent of the whole thing. I thought that was a really good program. I liked all of the things that mixed us up with other disciplines. I thought it really mattered. RL: I think there's more of that kind of thing happening now and it can only strengthen the college. JM: Absolutely. I think that this community outreach is a tremendous thing. I am really curious to see how this is going to go downtown because I guess those spaces are about completed on Washington. Is it going to be Continuing Education classes or Adult Education? I have no idea what's going to go in there, do you? RL: I don't. JM: It's wonderful space. I thought, "Good." Remember when we were in the basement of the mall? Page 32 of 35 RL: Yes. I don't know if you were involved or remember in the very early nineties, before we had the whole Community Involvement Program, we had some of our athletes working at the Lewis School helping children with teaching. JM: I do remember that. There was faculty sending their students out to look at things. In Education, we'd send them out because they've got to be in the schools. Other disciplines were doing a lot of things as well. RL: I like it here. JM: I don't blame you. I like it here too. I think it's a good setting for students. There are more and more kinds of things to engage the students. I liked the programs where they put classes together in a cohort for new freshman. Those kinds of things have been successful. They've helped kids not to get lost and provided a way for them to become connected with other students, particularly if they're students that just commute. I'm happy to see the new dorms because I think it's more attractive to live on campus than ever before. I think that's good. We have a lot of administrators and faculty that have done good things to promote what's happening on our campus. It's a beautiful campus and when I was walking over here today I thought, "What a pretty time of year with the stream and the pond and the beautiful trees and bushes." It's a beautiful campus. RL: My brother was trying to explain to someone that I lived in an area where every place you look is a postcard. JM: What a compliment. RL: Then he said, "No, come to think of it, she lives in a postcard." Page 33 of 35 It sounds as though your years here have been good and I'm glad to hear it. Certainly, if you think of things later that you would have liked to have told us about, please get in touch. I want to thank you for taking the time to do this. JM: You're welcome. It's been my pleasure. RL: It's been a good program for us and it's good when we get someone like you who's been involved across the board and can help to build that picture of what Weber State has been over the years. JM: Don't you feel it has come a great, far distance in terms of sophistication? RL: Absolutely. JM: I think that it's become more scholarly. RL: It's certainly not Harrison High any longer, is it? JM: It surely is not. One of the things that I think has made a difference is that the standards for tenure have changed. That was another thing we did in those years in making Weber a more scholarly university—higher demands. RL: We've been able to maintain some of the earlier things, regardless. JM: For teaching there is no question about it. The standards for hiring people have become more comparative with other universities. When University of Utah or Utah State complains about Weber I have to laugh because I think of the numbers of faculty that were trained in those two institutions and if there's something wrong with this then it's their fault, not ours. RL: We keep showing up on more and more national lists and I think partly it's because of people like you. Page 34 of 35 JM: Well, thank you, that is a compliment. As I say, like you, I have not regretted my years at Weber. I've been proud of them. RL: Thank you for being with us today. JM: You're welcome. Page 35 of 35

Abstrak Karya sastra merupakan miniatur dari dunia nyata, dimana sebuah karya sastra biasanya mengungkap beberapa masalah yang berkaitan dengan makhluk hidup termasuk isu-isu tentang hubungan manusia dengan alam. Manusia lebih cenderung melakukan kerusakan pada lingkungan daripada menjaganya, hal ini menyebabkan kehancuran bumi beserta isinya. Hal ini tergambar pada novel The Road karya McCarthy dimana lingkungan yang menjadi setting utamanya hancur berantakan. Lansekapnya tertutup oleh abu yang berterbangan. Dan ketika salju turun, ia berwarna abu-abu. Langitnya juga terlihat gelap. Oleh sebab itu, ada beberapa masalah yang berhubungan dengan kehancuran bumi yang tergambar pada novel yang kemudian memunculkan dua dasar pertanyaan (1) bagaimana kehancuran bumi digambarkan dalam novel The Road karya McCarthy? Dan (2) bagaimana kehancuran bumi memberikan dampak terhadap karakter utama dalam novel The Road karya McCarthy?. Untuk melihat masalah ini perlu teori yang pas yang biasa disebut ecocriticism. Ecocriticism melihat kehancuran bumi sebagai hasil dari tingkah laku manusia terhadap lingkungan misalnya: eksploitasi dan colonialisasi. Seperti yang dikatakan Lawrence Buell bahwa kondisi lingkungan itu ditentukan oleh manusia. Ecocriticism adalah suatu istilah yang berada dibawah payung postcolonialism dimana seorang postcolonialist meyakini bahwa kolonialisasi mempunyai campur tangan dalam penghancuran bumi. Para penjajah merasa percaya diri untuk mengeksploitasi bumi karena dianugrahi kekuatan oleh modernism. Untuk mendapatkan analisis yang jelas, skripsi ini menggunakan metode descriptive quality dimana kualitas data menjadi poin utama daripada jumlah data. Jadi, terlihat jelas bahwa kehancuran bumi terjadi diseluruh lapisan lingkungan; yaitu atmosfer, permukaan tanah, dan laut. Seluruh atmosfer dipenuhi oleh abu, debu dan karbon, tanahnya terkikis, tandus dan gundul, dan lautnya berubah menjadi abu-abu. Kehancuran bumi ini juga memberikan kesuraman tersendiri kepada tokoh si bapak dan si anak. Mereka harus melalui hidup yang keras, susah untuk bernafas, susah untuk menemukan sesuatu yang bisa dimakan dan secara mental mereka selalu takut akan ancaman-ancaman dari kehancuran bumi. Kata Kunci: kehancuran bumi, ecocriticism, postcolonialism, modernism. Abstract Literary work is a miniature of larger world or reality, whereas a literary work reveals some problems related to humans being including issues of human relationships with the environment. Humans tend to do damage to the environment rather than maintaining it, thus it causes devastation of earth. It is reflected in McCarthy's the road where the environment is devastated. The landscape save the ash on the wind, and when the snow falls, it is gray. The sky is also dark. Therefore, there are some problems of knowledge about how the devastation of earth portrays in the novel, which are delivered to two main questions of (1) How is devastation of earth depicted in Cormac McCarthy's The Road? and (2) How does devastation of earth give impacts to the main characters in Cormac McCarthy's The Road?. In case to observe these problems, it needs a suitable theory which called ecocriticism. Ecocriticism sees the devastation of earth as the result of humans' behaviour such as exploitation and colonialism of the environment, as Lawrence Buell says that the condition of the environment is determined by humans. Ecocriticism is under umbrella term of postcolonialism in which postcolonilist believes that colonization has intervention in devastating the earth. Colonizer is encouraged to exploit the nature because of power that is given by modernism. To get a clear analysis, this thesis uses descriptive quality method; it means the quality of the data becomes the reference to work rather than the quantity of the data. Thus, it is seen clearly that devastation of earth happened in the whole layers of environment; atmosphere, land and sea. The atmosphere is occupied by ash, dust and carbon, the land has eroded and barren and the sea have changed into gray. This devastation also gives a misery to the father and the son as the main characters. They have to undergo hard life; hard to breathe, hard to find food and mentally they are haunted by the devastated earth's threatens. Keywords: devastation of earth, ecocriticism, postcolonialism, modernism. INTRODUCTION Humans often feel indifferent toward nature. For them, nature is something considerably as a 'mystic' thing, when it goes right, humans forget it, when it goes wrong, they worry it. People tend to prefer natural environments more than built environments, and built environments with water, trees, and other vegetation more than built environments without such features (Kaplan & Kaplan, 1989). On the other word, humans tend to permit the nature walks down by itself. They seem to just let it flow without thinking how to keep and maintenance the nature. The study of humans' relation with nature which is known as ecology was begun since years ago when humans lived in harmony with the nature. However, in line with development the nature also changes. Unfortunately, this natural changes brings devastation on earth, as Donald Hughes says that looking back to our historical ecology, Humans have related in multiple ways to the Earth's systems; some of these ways promise a sustainable balance with them, while others are destructive (Hughes, 2001: 269). Historically, through devastation of earth Humans have made major changes in their environments. This is happened almost in the whole surface, as Hughes says that devastation of earth has happened in every historical period and in every part of the inhabited Earth (2001: 1). In order to observe those processes of change that affect the relationship, ecologist studies the mutual effects that other species, natural forces, and cycles have on humans, and the actions of humans that affect the web of connections with non-human organisms and entities (id. at 4.). This ecologist's study shows that devastation of earth is the result of humans' behaviour toward environment. This bad behaviour has changed the environment that will bring devastation to the humans themselves. Humans seemingly don't care of the environment. Severity, humans tend to be more destructive. It forces some Ecocritics who concern in literary study and environment in late nineteenth criticized humans' behaviour toward nature. This criticises show how important avoiding that kind of behaviour toward nature which brings devastation of earth merely, it signed that the study of literature which related to the environment has to be discussed. There were in fact some isolated calls for an ecologically oriented criticism during the 1970s (Rigby, vol 2: 2). However, it was not until the end of the twentieth century that the study of literature and the environment was finally recognized as 'a subject on the rise'. In studying of literature, humans ordinarily focus on the relation between humans and others (society) or between humans and themselves (psychology), whereas, the relation between humans and environment actually is tightly connected. Unfortunately, the study of literature which related to the earth was often forgotten, whereas, the study of literature which related to the environment is greatly important. The study of environment is not merely observing of the nature or nonhumans aspect but it tends to study the relation among nature, earth and the humans themselves. Human actually is a part of environmental system, and therefore the environment has the crucial role in humans life in which it is become the main point of literary study. In some respects, it is perhaps not surprising that the study of literary texts should be coupled with such forgetfulness of the earth. Thus it is needed a study of humans' relation and environment. The study of literature and environment got a full attention when modern era begun to destruct the environment. Since last decade ago, especially years ago, humans consciously realized the impacts of their behaviour toward nature, moreover when they become crazier of invention, exploration and exploitation of the nature. Surely, this impact is indirectly causing ecological changes. However, actually what people do about their ecology depend on what they think about themselves in relation to things around them. Human ecology is deeply conditioned by beliefs about our nature and destiny (White 1996, 6). It can be imagined when humans were only thinking about themselves and forgetting the nature or they were just considering their needs without considering the nature needs, it can be ascertained that the nature will vanish and be extinct. This idea or thought about indifference toward nature is criticized by the Ecocritics. Ecocriticism maintains that literature may be approached in a way that examines humans as part of an ecosystem; they are neither master nor slave to it, but simply one part of an intricate system. Literature and environment truly can't be separated each other. Moreover, Lawrence Buell argues in his book The Truth of Ecology as quoted by Dana Philip that literature would be environmental. It would evoke the natural world through verbal surrogates, and would thereby attempt to bond the reader to the world as well as to discourse (Philip, 2003: 7). It can be assumed that through the literary work, the reader will be brought to the environmental world and devastation of earth. Indirectly, literature causes the reader's interpretation of the environment. Thus, it is important to understand the relation between humans and environment through literary work. It needs to notice that ecology is not a slush fund of fact, value, and metaphor, but a less than fully coherent field with a very checkered past and a fairly uncertain future (Philip, 2003: 45). By understanding the relation between humans and environment, it is beneficial to determine the act effectively on the impact of natural destruction and to integrate knowledge and actions. The study of literature and environment works in tandem in determining humans' perception and interpretation toward nature. As Lawrence Buell says that literature and environment studies must make their case for the indispensableness of physical environment as a shaping force in human art and experience, and how such an aesthetic works (2001: 9). It can be assumed that environmental interpretation is a humanistic inquiry. In other word, what people think about nature, and how they have expressed those ideas is what people interpret of the nature. Generally what people expressed the idea of the nature is a Realistic depiction of the world. Thus, it needs a tool to see this depiction. Surely Ecocriticism is a proper tool to see the depiction of the world. Ecocriticism is the most suitable binoculars to telescoped ecological issue and ecological changes in such literary work, as Sheryl Glotfelty (1996: xviii) says that Ecocriticism is the study of the relationship between literature and the physical environment, Ecocriticism takes an earth-centered approach to literary studies. Only Ecocriticicism observes the relation between humans and nonhumans aspects. What Ecocritics do, in short, is attempting to discover nature as absence, silence in texts, and construe environmental representation as a relevant category of literary (Buell, 2005: 30). Ecocriticism encourages the changing of canonisation through entering literary works which carry up natural issue. Ecocriticism ecologically oriented critique of the way in which Nature is constructed in certain canonical texts. Environmental literature constitutes the third way in which Ecocriticism recasts the canon. According to Lawrence Buell (1995, 7-8), an environmentally oriented work should display some characteristics; first, the nonhuman environment is present not merely as a framing device but as a presence that begins to suggest that human history is implicated in natural history. Second, the human interest is not understood to be the only legitimate interest. Third, Human accountability to the environment is part of the text's ethical framework. The last, some sense of the environment as a process rather than as a constant or a given is at least implicit in the text. In such literary work; Cormac McCarthy's The Road the nature as the setting represents ecological changes. Surely, this change causes devastation of earth. Nothing is more miserable on earth but devastation. The world which is the closest place we live at is not convenient again when it was devastated. Thus, literary and environment has interrelation that cannot be separated. Then, it is important to analyze such literary work through Ecocriticism. Ecological issue commonly represented by the presence of natural thing such as; tree, land and also circumstance in the novel which it become the setting. In other word, ecological issue become a centre point of setting. One of great writers in narrating the setting is Cormac McCarthy. Not only known as a king of the setting, McCarthy also has known as famous environmental setting as Addy Haddock (a writer of McCarthy's bibliography) says that his ability to provide eloquent descriptions with smoothly rolling darker undertones and poetically dismal nuances makes him become a writer with powerful setting. Thus, McCarthy is a right author referenced as a study of Ecocriticism. Indirectly, McCarthy's proficient is caused by his settled at a barn near Louisville, Tennessee. All the stones he gathered, all the wood he cut and kiln dried by himself to renovate his small house. Seemingly, McCarthy's life is not far away from the nature. Years later, after marrying fellow student Lee Holleman in 1961, he and she moved to a shack with no heat and running water in the foothills of the Smoky Mountains outside of Knoxville. These experiences of life sharpen his idea toward nature. McCarthy reveals that he is not a fan of authors who do not deal with issues of life and death; it can be assumed that his writing tends to be explored issues of life including devastation of earth. Recalling blithely the months he spent without electricity in a house in Tennessee. Without money, and he had run out of toothpaste and he was wondering what to do when he went to the mailbox and there was a free sample. It made him become more sensitive facing the nature and more respect it. In 2006, McCarthy writes The Road that grants him a change to be interviewed by Oprah Winfrey. Surely, this interview related to his writing especially devastation of earth and won Pulitzer Prize for fiction. McCarthy told Winfrey that related several stories illustrating the degree of outright poverty he endured at times during his career as a writer. He also states that his novel; The Road inspired when he was standing at the window of a hotel in the middle of the night, his son asleep nearby, he started to imagine what El Paso might look like 50 or 100 years in the future. He just had this image of these fires up on the hill. It shows the condition of the nature at the time which the hill was fired up. McCarthy can be categorized as a weird person. People usually gathered with other people who have same hobby or pleasure. However, it doesn't apply for McCarthy. As a writer, he doesn't like to gather with other writer. He would rather hang out with physicists or scientist than other writer. He does not know any writers and much prefers the company of scientists. No doubt if his knowledge of nature is rich. His knowledge of the natural world is vast and includes many of the Latin names of birds and animals. His pleasure gathering with physicists and scientist caused by his interest in science and environment, by absorbing the intelligence scientists, he realizes that in 100 years the human race won't even be recognizable. For him, what physicists did in the 20th century was one of the extraordinary flowerings ever in the human enterprise, which would much prefer to befriend a scientist than another writer. Most of McCarthy's novels are portraying about life or reality which many of them associated to ecological issue. In 1985, Blood Meridian was published. Blood Meridian portrays the desolate and indifferent 1850s Texas-Mexico borderlands. The extreme violence which takes place comments implicitly on both the environment and human nature. The novel's full title- Blood Meridian, or The Evening Redness In The West- is indicative of the novel's portrayal of the environment. A relationship between location, nature and violence is created in the symbolism of the sun as a "blood meridian". To call McCarthy's environments as constructed in Blood Meridian simply violent is an unsatisfactory conclusion. What is more appropriate and evident in the text is that man is inherently violent and the indifference of nature to this creates an amoral setting. In 1979, McCarthy published his fourth novel, Suttree. In short, Suttree tells the reader about a man named Cornelius Suttree, a fisherman, disillusioned scholar, alcoholic, nihilist, existentialist and transcendentalist. The attention to detail identified earlier in Suttree is telling in terms of his relationship with his environment. Generally, to an Ecocritical reading Suttree shows that, stripped of societal anthropocentrism, man is forced to reassess his relationship with nature. It could be said that McCarthy's prose style is often atavistic (anti-civilization, anti-materialism, anti-industrialism, anti-progress and pro-Nature) in that it both reflects natural processes and often appears primitive, stripped of culture. In 1973, Child of God was published. It was inspired by actual events in Sevier County. Child of God begins with Lester Ballard's dispossession from his parent's house. McCarthy's description of Ballard's lone nomadic wandering after he inadvertently burns down his squat uses the same free indirect discourse. Child of God can also be described as an existential text, particularly for the authenticity of its protagonist. Lester Ballard's atavistic tendencies bring him closer to an animalistic level. From those all of McCarthy's novels, The Road which was published in 2006 by Vintage book publisher is the most representative novel which is related to the study of Ecocriticism. The novel is generally thick of environments' issue. The issue for instance is the fire of woods that happened along the country which give the reader an image of burned land, ash and dust everywhere and so on. Because of this reason, the writer felt that The Road is interested to be analyzed through ecological critics. In short, the novel portrays a journey of father and son as the main character in a burned land in America. The issue of devastation of earth becomes the centre point of interest which grasps the whole setting of the novel. The Road brings the readers onto 'the future' in as much as it is set in a time after an ambiguous 'end' has occurred and society has collapsed. The reverse of the most recent reissue claims that it is the first great masterpiece of the globally warmed generation. It is also the first of McCarthy's novels to have provoked Ecocritical study. This wide appeal to the novel relies strongly on its environmental themes. The use of allusion to genre and form elsewhere in McCarthy's novels can be said to universalise his appeal but in The Road the key concern is the 21st century's most immediate global problem; the irrevocable damage global industrial capitalism is doing to our environment. It is difficult to read The Road without feeling the overwhelming cumulative force of the novel's desolation, and this desolation is most prominently present in the landscapes McCarthy portrays. The setting is almost entirely bereft of life; the little that is found is often malign humanity. The Road greatly represents a study of Ecocriticism. It portrays the colourless world because of devastation of earth. This devastation issue is common object of the Ecocriticism study. The Road continually reminds us of the bleakness of the landscape in the earth. As readers, we only experience bright colours through the characters' dreams or memories, if someone happens to bruise or bleed, or through fire or flare guns. The rest of the time we see a gray ash covering the landscape. As a reality, our landscape is actually green and natural. However, The Road shows the possibility of devastation of earth when humans did devastation to the nature and they can't live in harmony with the nature. Therefore, there is no doubt that The Road becomes the most influencing novel toward environment. It proves from the acclaim written in the novel by George Monbiot, an environmental campaigner that says "It could be the most important environmental book ever. It is a thought experiment that imagines a world without a biosphere, and shows that everything we value depends on the ecosystem." According to the brief story in background of the study that gives perception about the devastation of earth in the novel, it appears two questions as the problems: 1. How is devastation of earth depicted in Cormac McCarthy's The Road? 2. How does devastation of earth give impacts to the main characters in Cormac McCarthy's The Road? METHOD The used method is descriptive quality; it means the quality of the data becomes the reference to work rather than the quantity of the data. Besides, a technique is needed to understand the data. Technique of interpretation must be used to interpret and analyze the data. Through interpretation the analysis can be worked. Interpretation is a crucial step that has to do before analyzing the data. Then, extrinsic approach is used as an approach toward the analysis in which environment belongs to it. According to method above, the first thing that has to do is collecting data. In collecting data this research focuses on reading and documentation. Reading novel. In this step, novel becomes the object of the research. The novel is entitled The Road, written by Cormac McCarthy. To collect the correctly data, it needs reading more than once, because to get interpretation, it needs understanding all contents completely with all possibilities both intrinsically and extrinsically. Inventorying data. This step is collecting data through noting the quotations related to the statement of the problems and objectives of the study, it is including in words, sentences, and discourse that can represent devastation of earth in Cormac McCarthy's The Road. Thus, all data that will be analyzed are started and sourced through the novel's contents. Classification data. It is appropriate to the statements of the problems about devastation of earth in Cormac McCarthy's The Road. Tabling the data. It is to simplify reading the data and classify data that is used in the analysis for the readers. Continuously, the selected data or the collected data, which are related to the statements of the problems and the objectives, are analyzed through Ecocriticism in depicting the devastation of earth and its impacts to the main characters in Cormac McCarthy's The Road. MODERNISM The word "modern" closely means to up-to-date, abreast of the times, and going beyond the past in more than a temporally or chronologically literal sense (Greenberg, 1979; 2). Marshall Breman as quoted Jan Rada defines modernism as a trend of thought that affirms the power of human being to create, improve, and reshape their environment, with the aid of scientific knowledge technology and practical experimentation (2008; 6). Breman then argues that modernism is as any attempt by modern men and women to become subjects as well as objects of modernization, to be modern is to find ourselves in an environment that promises us adventure, power, joy, growth, transformation of ourselves and the world-and, at the same time, that threatens to destroy everything we have, everything we know, everything we are (Berman, 1982; 5; 14). The development of modernism emerged two poles that confront each other; science and technology and natural degradation. As Helena J. Keler explanation that the image of 'creative destruction' is very important to understanding modernity precisely because it derived from the particular dilemmas that faced the implementation of the modernist project. This destruction of a holistic universe in the modern era shatters the conception of human beings and societies as total entities, instead inaugurating an era characterized by a never-ending process of internal ruptures and fragmentations within itself (Keler, 2005: 4). According to Horkheimer and Adorno as quoted by Helena, modern capitalist society is engaged in a pattern of domination: the domination of nature by human beings, domination of nature within human beings, and this system of domination is driven by fear of the human and nonhuman unknown the Other (Keler, 2005: 3). Movement of modernism manifests itself in the self-destructive nature of symbolism: when pushed to its logical extreme, the symbolist aesthetic starts to forgo any notion of an organic, necessary relationship between signifier and signified, and simply imposes a particular motif as an arbitrary symbol of something else (Hutchinson, 2011; 58). Modernism often demonstrates the destructive rather than constructive nature. Modernists argue that the ecologically destructive projects are not viable because of climate change but modernism movement (Johnston, 2012: 207). Specifically, Barbara Rose Johnston states that Human conduct that contributes to the destruction of our ecological balance. Such interpretations of environmental change, however, can have undesirable effect of deflecting responsibility, since blame is placed on a cycle of time about which a person can do nothing (Johnston, 2012: 212). Global environmental change, which spans natural sciences, policy and development studies, is currently experiencing its first waves. Perhaps it is time to recognize that already some people are getting their feet wet. On what criteria should one decide to retreat to higher ground or stick it out unmoved until the tide turns. Modernism challenges the modern project of understanding global environmental change and doing something about it when it causes problems (Blaikie, 1996: 81). According to Piers M. Blaikie, modernism First, it challenges all embracing world views or 'meta narratives' which tend to be highly teleological and assume the validity of their underlying assumptions and their claims. Thus, the role of environmental scientists in policy making as 'talking truth to power' and as the only rational and legitimate brokers between the 'real' environment and the rest of us, is rejected. Second, it challenges the tendency that is more pronounced in areas of global environmental change where the local hands on experience of the environment (land degradation, desertification and biodiversity). Third, it challenged that reality is socially constructed. An epistemology which builds models of society and environment with causal connections is challenged by one which is constituted as a series of descriptive accounts according to different actors' perceptions (Blaikie, 1996: 81). Modernism encourages people and countries to over-exploit natural resources, and contribute to reductions in spending on social and environmental welfare (Huckle, 1999: 36). Moreover, environmental reductions being blamed on the impact of foreign cultural domination this has allegedly eroded and damaged the 'essential harmony' between humans and nature (Mawdsley, 2001: 96). Evernden contends that the second instrumental vision of control and domination over nature is the historical product of modernity, more specifically of Renaissance, when a new mode of knowledge, based on reason and experimentation replaced the medieval search for knowledge as contemplation and wisdom (1992). This argument is supported that Modernity is thus responsible for creating Nature by abstracting from nature, and with it a whole history of conquest and domination comes to be enacted. In the words of C. S. Lewis: "We reduce things to mere Nature in order that we may "conquer" them. We are always conquering Nature because "Nature" is the name for what we have, to some extent, conquered" (Lewis, 1978: 42). Latest, Environmental problems and other risks encompass less than the globally catastrophic. More and more disaster experts, development agencies, and citizens' groups are supporting that the globalisation is largely responsible for such human misery (Huckle, 1999: 36). Modernism signed by the development science and technology (Somerville, 2006: 17-18). Further, given the increasing production by technologically advanced capitalism of risks that threaten us all ironically that technology induced catastrophes and environmental disasters (Simon Cottle, 1998: 8). Since the Enlightenment, technology, especially science-based technology, has offered the promise of a better world through the elimination of disease and material improvements to standards of living. On the other hand, resource extraction, emissions of dangerous materials, and pollution of air, water, and soil have created conditions for unprecedented environmental catastrophe and have already caused irreversible damage to the biosphere (Vergragt, 2006: 7). Ironically, the persisting contradictions between a better life created and supported by technology for the wealthy few, also caused the increasing environmental degradation and persistent poverty for the vast majority calls for a deeper exploration and understanding of the nature. Philip J. Vergragt then, states that technology will support and enhance a "good life" for all of its citizens, in both rich and presently poor countries, without compromising the Earth's ecosystem or the prospects of later generations (Vergragt, 2006: 8). Thus, science and technology which shaped to the sophistication give man a power to colonize the earth. POSTCOLONIALISM Environmentalism in post-colonial discourse has its beginnings in Alfred Crosby's account of the impact of European incursions into the Americas and the Pacific (Ashcroft, 2000: 71). This incursion of course destructs not only the country; physical building and ideology but also the environment and nature. The conquest and colonization of so many extra-European environments produced irreversible changes in land use, in flora and fauna and frequently damaged beyond repair traditionally balanced relations between indigenous communities and their environments, a relationship unlike that of their conquerors crucial to their understanding of their 'being' as of the land rather than merely on it (Ashcroft, 2000: 71-72). He adds that imperial incursions and colonization have been regarded as environmentally destructive, yet as Richard Grove argues, the perception of what had already been lost in Europe, the sense of intrinsic connection between the 'more-than-human' and the human, and thus the urgency of environmental preservation became strikingly evident in Europe's colonies, particularly in the late nineteenth century. Much environmentalism in theory and practice has emanated from former imperial centres such as Europe and the United States. While belated recognition of the crucial importance of other forms of life on earth is both welcome and necessary, its export and sometimes imposition on postcolonized cultures invites the obvious charge of hypocrisy and generates resentment against former imperial states which having degraded their own and their colonies' environments in the 'interests' of progress and 'development' now encourage (or impose) the theory and practices of environmental preservation on other peoples (Ashcroft, 2000: 72). This also frequently creates division within post-colonized cultures themselves, where, for instance, peoples are moved off their traditional lands to make way for game parks, essentially for the benefit of wealthy tourists. Demands for the 'global' preservation of endangered species frequently clash with the policies of post-colonized governments eager to use their regained environmental sovereignty in the interests of a modern capitalism from which it is difficult for them to escape. Devastation of earth has highlighted how human–environmental vulnerabilities are amplified not only by anthropogenic climate change but also by the capitalist exploitation of natural resources (Carrigan, 2005: 1). Harmful environmental conduct exposes several broader dimensions such as the nation's ability to use its resources as determined by domestic political processes, such as; it changes the natural forest microclimates that have been transformed into new microclimates increasing sunlight and lowering humidity (Nazzal, 2005: 6). The ecological crisis is not merely an isolated event but has its roots in the modern materialistic civilization that makes man becomes the butcher of earth (Huggan and Tiffin, 2010: 1). They argue that one way out of this morass is to insist that the proper subject of postcolonialism is colonialism, and to look accordingly for colonial/imperial underpinnings of environmental practices in both colonising and colonised societies of the present and the past (Huggan and Tiffin, 2010: 3) Colonialism greatly changed the environmental condition of colonized country. Alfred W. Crosby (Crosby 1986) as quoted by Aschroft describes the ways in which the environments of colonized societies have been physically transformed by the experience of colonial occupation, imperialism/colonialism not only altered the cultural, political and social structures of colonized societies, but also devastated colonial ecologies and traditional subsistence patterns (Ashcroft, 2000: 69). Indirectly, colonization influences ecological changes in the past which cause ecological destruction in the present day. More importantly, based on Crosby statement in Aschroft explain that introduced crops and livestock not between colonizer and colonized country only supported conquering armies and colonizing populations, radically colonizer altered the entire ecology of the invaded lands in ways that necessarily disadvantaged indigenous peoples and annihilated or endangered native flora and fauna (2000: 69). Arguably this has led to one of the most profound ecological changes the world has seen. Colonization or colonialism can be defined as the conquest and control of other people's land and goods (Loomba, 2005: 8). Colonialism means a conquest which is done by the west or European and American country toward Asia and Africa by exploitation the land, surely it causes natural destruction. Elleke Boehmer has defined colonialism as the settlement of territory, the exploitation or development of resources, and attempts to govern the indigenous inhabitants of occupied lands (Boehmer as qtd. in McLeod 2000: 8). The term colonialism is important in defining the specific form of natural exploitation that developed with the expansion of Europe over the last 400 years (Ashcroft, 2000: 40). With the end of the cold war, global infatuation with neoliberal economics has intensified the peripheralization of the South along economic, political, social, cultural and natural lines (Geeta Chowdhry and Sheila Nair, 2002: 1). Postcolonial critique bears witness to those countries and communities - in the North and the South (Bhabha, 1994: 6). The assumption of postcolonial studies is that many of the wrongs, if not crimes, against nature are a product of the economic dominance of the north over the south (Young, 2001: 6). Thus, the Norh represents the West and the South represents the East. Postcolonialism sees the natural destruction on the South as the impacts of colonization The northern environmentalism considered as the rich (always potentially vainglorious and hypocritical) and the southern environmentalism considered as the poor (often genuinely heroic and authentic) (huggan and Tiffin, 2010: 2). However, northern needs of the natural need were supplied from the south in the name of colonization. Colonialism granted imperial powers the rights to arrogate and exploit the territory of a subject people as well as to appropriate unlimited property rights, post-colonial states acted quickly to regain control over their natural resources both through expropriation of foreign property interests and through the legal arena (Nazzal, 2005: 10). Colonialism, through both practice and discourse, has separated man from his natural surroundings and has given him a false idea about the meaning of nature: on the contrary, nature is not there to be plundered, but to be cared for, tended and made to yield its produce. Then, Man is ennobled by the relationship with the environment, by his power to make things grow and watch over their growth, but the reverse also holds true: devastation returns man to his primitive condition. It is not surprising when the the nature did reverse destruction to the humans. It is the result of what they do exploit to the nature. On the other world, man as the colonizer has colonized the earth which caused the devastation of earth. (Chrisman and Williams, 1994: 1–20). Thus, postcolonialism can be considered as umbrella term of ecocriticism in which it criticizes the relation between human and nature including criticizing humans' behaviour precisely humans' exploitation toward nature. ECOCRITICISM Humans truly can't be separated with environment. human beings are engaged in the eternal search for connection, for that which connects us to others and for that which connects us to ourselves, culture, language, history, belief systems, social practice, and other influences on human development are as much a part of place as the physical landscape one crosses (Dreese, 2002; 2-3). She emphasizes that environmental factors play a crucial role in the physical, emotional, and even spiritual configurations that determine our ideas of who we are. All human beings develop their own sense of place through life that determines why they love certain regions or feel utterly alien in others. The study of relations between humans and environment called ecology. Lawrence Buell defines ecology as the study of the interactions between organisms and the environment (Buell, 2005; 139). Meanwhile, Glen A Love defines ecology as not as merely a study of the relationship between organisms and their living and nonliving environment but also a combination of science and a sense of responsibility for life (2003; 37-38). Ecology as Lawrence Buell say above is drawn in the life circle; the life processes of many organisms put into their surroundings environment whose presence of other organism affects the life processes of these and other organisms sharing the same environment. When these processes are cut by such destruction, e.g. chemical by-products of the life processes of one species (or occupational group) are harmful to another species; the relationship between the two species is "antagonistic." Increased population density increases the probability of antagonistic interactions (Catton, 1994: 80). It is essential to be aware of the environmental damage which caused by ecological changes. The development of humans' ecology slowly damages the environment. The ecology of human development involves the scientific study of the progressive, mutual accommodation between an active, growing human being and the changing properties of the immediate settings (Bronfenbrenner, 1979: 21). Imbalance fine relations between humans and environment emerged a critic called ecocritic or ecocriticism (Buell, 2005; 2). John Elder as quoted by Dana Philip says that The science of ecology confirms the indivisibility of natural process: each feature of a landscape must be understood with reference to the whole, just as the habits of each creature reflect, and depend upon, the community of life around it (1999; 581). Ecology when it counts as science tends to be a lot more reductive, thus many of the core concepts of ecology once notable for their expansiveness have in recent years been cut down to size, made more particular, or abandoned altogether. It now appears that even the ecosystem concept may not be valid biologically, but valid concept or not, an ecosystem is primarily a theoretical entity, and therefore could never be the reality that somehow underwrites poetry, even if that poetry is of the good old-fashioned, supposedly "organic" sort (Philip, 1999; 582). By that kind of reason, Elder argues that culture too may be understood organically: it is the field of relationship between organisms and, as such, a complex organism in its own right (Philip, 1999; 582). Ecology is not merely bound to science and technology, but also moral and politic. Greg Garrard assumes that ecology itself is shifting and contested, the emphasis on the moral and political orientation of the ecocritic and the broad specification of the field of study are essential (2004; 4). Problems of ecology are features of our society, arising out of our dealings with nature, from which we should like to free ourselves, and which we do not regard as inevitable consequences of what is good in that society (Garrard, 2004; 5). Lynn white, Jr argues in his article on Cheryll Glotfelty's The Ecocriticism reader: landmark in literary ecology that environmental crisis is fundamentally a matter of the beliefs and values that direct science and technology and dominating attitude toward nature (1996; 4). Discoveries in ecology and cellular biology revolutionize our sense of self, teaching us that there is no such thing as an individual, only an individual-in-context (Neil Evernden, 1996; 93). Discoveries of course get much of invention. Unconsciously, humans' behaviour (ex: exploitation) toward environment was changed. Industrial Revolution affected humanity's conception of its relationship to nature, warning that technology has created the false illusion that we control nature, allowing us to forget that our "unconquerable minds" are vitally dependent upon natural support systems (Harold Fromm, 1996; 31) Ecocritic or Ecocriticism is an umbrella term, used to refer to the environmentally oriented study of literature and (less often) the arts more generally, and to the theories that underlie such critical practice (Buell, 2005; 138). Cheryll Glotfelty simply writes the definition, ecocriticism is the study of the relationship between literature and the physical environment, ecocriticism takes an earth-centered approach to literary studies (1996: xviii). Ecocriticism might succinctly be defined as study of the relation between literature and environment conducted in a spirit of commitment to environmental praxis (Lawrence Buell as quoted by Dana Philip, 1999; 583). Ecocriticism is, then, an avowedly political mode of analysis, ecocritics generally tie their cultural analyses explicitly to a 'green' moral and political agenda. In this respect, ecocriticism is closely related to environmentally oriented developments in philosophy and political theory (Greg Garrard, 2004; 3) Ecocentrism is more compelling as a call to fellow humans to recognize the intractable, like-it-or-not interdependence that subsists between the human and the nonhuman and to tread more lightly on the earth than it is as a practical program (Lawrence Buell, 2005, 102). Ecological criticism shares the fundamental premise that human culture is connected to the physical world, affecting it and affected by it. Ecocriticism takes as its subject the interconnections between nature and culture, specifically the cultural artefacts of language and literature (Cheryll Glotfelty, 1996; xix). The majority of ecocritics, whether or not they theorize their positions, look upon their texts of reference as refractions of physical environments and human interaction with those environments, notwithstanding the artifactual properties of textual representation and their mediation by ideological and other socio-historical factors (Lawrence Buell , 2005; 30). Literary theory, in general, examines the relations between writers, texts, and the world. In most literary theory "the world" is synonymous with society-the social sphere. Ecocriticism expands the notion of "the world" to include the entire ecosphere or nonhuman, which is physical environment. Several things that have to be seen are: • Transforming this concept becomes social movement that will bring the humans into conscious of the equality between human and their environment and doesn't consider the nature into binary opposition between dominate and dominated. • Ecocriticism encourages the changing of canonisation through entering literary works which carry up natural issue. • Ecocriticism is not only an approach but also a pendadogis tool. • Ecocriticism connects the literary study with the earth to see how is the relation between humans and earth where they stand (Cheryll Glotfelty, 1996, xxii) The majority of ecocritics, whether or not they theorize their positions, look upon their texts of reference as refractions of physical environments and human interaction with those environments, notwithstanding the artifactual properties of textual representation and their mediation by ideological and other sociohistorical factors (Buell, 2005; 30). It can be assumed that Ecocrtiticism sees the text as the refraction of physical environment. Another denigrates attempts to recuperate realism as restricting the field of environmental writing, as ludicrously foreshortened in focus ("its practitioners . . . reduced to an umpire's role, squinting to see if a given depiction of a horizon, a wildflower, or a live oak tree is itself well painted and lively"), and in any case bogus, since "mimesis presumes the sameness of the representation and the represented object" (Phillips 2003: 163–4, 175). Buell has added that this is a conviction that contact (or lack ofcontact) with actual environments is intimately linked, even if not on a one-to-one basis, with the work of environmental imagination, for both writer and critic (Buell, 2005; 31). Ecocriticism can explore what we can call a discursively manipulated nonhuman world in literature, and discuss how it gets marginalized or silenced by, or incorporated into the human language (Legler, I997: 227). Nonhuman environment must be represented as an active presence and player within the text made some astute readers inclined to be sympathetic of the environment (Buell, 2005: 51). The task of ecocriticism, then, is to formulate a conceptual foundation for the study of interconnections between literature and the environment. Literature can be perceived as an aesthetically and culturally constructed part of the environment, since it directly addresses the questions of human constructions, such as meaning, value, language, and imagination, which can, then, be linked to the problem of ecological consciousness that humans need to attain. Within this framework, ecocritics are mainly concerned with how literature transmits certain values contributing to ecological thinking (Glotfelty, 1996: xxi). Ecocriticism offers researcher a way how to analyze such literary work through three steps. First is seeing the representation of nonhuman aspect. This first step is looking how is the nature like rice field, village, wilderness, forest, sea, beach, hill, mountain, valley, river, animal (or treatment toward animal) and city environment pictured in the text. Second is seeing the accusation toward ecology issues. The second step destructs how the natural issue is portrayed with the different way. For instance, the nature is pictured as an inconvenient place again for humans because of the emergence the new value; technology, capitalism, extinction of local knowledge, and development of building which is not oriented to the environment. Last is taking part of text's ideology. In this case examines the relations between writers, texts, and the world. This third step is seeing and taking part of the ideology that contains in the text. How the author's view and commitment toward the nature (Cheryll Glotfelty, 1996, xix). DEVASTATION OF EARTH Those all theories mentioned above are related to the word "devastation" which happened on earth. Modernism granted colonizer a power to devastate the earth in which postcolonialism and ecocriticism tend to criticize that devastation. Certainly, what is actually the meaning of devastation of earth? The word "devastation" itself according to Merriam-Webster dictionary means the state or fact of being rendered nonexistent, physically unsound, or useless. In other word, devastation is deterioration, destruction, vanishing of the earth through depletion of resources such as air, water and soil. Devastation of earth can be defined as a destruction of ecosystems and the extinction of wildlife. Devastation of earth is a term used to describe a situation in which a part of the natural environment (the earth) is devastated or damaged. According to Shakhashiri, earth is areas of land as distinguished from sea and air (2011: 1). It means that the earth is composed by three parts; land, sea and air. Thus, it can be ascertained that if the devastation happened on earth, it will strike those all of earth's parts. The devastation which strikes the air will harm the condition of air in the atmosphere or known as devastated atmosphere, devastation which strikes the land will harm the condition of the soil and change it into erode and barren, and devastation which strike the water will contaminate the clean water into the dirty one. The earth as mentioned above that composed from three parts; certainly those each parts have a role. Land is the surface of the earth where the creatures are growing and developing; the plantations (trees) grow well, the animals breed and the humans dwell the life. Air is the mixture of gases which surrounds the Earth in which it contains a lot of vital substances such as oxygen and ozone. And water is a clear liquid, without colour or taste, which falls from the sky as rain and is necessary for animal and plant even human life. Water is also available in the river and sea. All of those parts of the earth greatly have advantage when it states in the normal/natural condition. However, when it was devastated, the earth turns into less natural and more miserable. That is the picture of the devastation of earth. DEPICTION OF DEVASTATION OF EARTH The devastation of earth as Hughes says has happened in every historical period and in every part of the inhabited Earth (2001: 1). It means that devastation of earth happened in the whole surface of the earth. Devastation has stroked the whole environment; atmosphere, land, and sea. Postcolonialism argues that colonialism has an intervention on devastating the earth. Colonialism has devastated the earth as Ashcroft says that the conquest and colonization of so many extra-European environments produced irreversible changes in land use, in flora and fauna and frequently damaged beyond repair traditionally balanced relations between indigenous communities and their environments (2000: 71-72). He adds that imperial incursions and colonization have been regarded as environmentally destructive. Devastation of earth happened over earth. It means that devastation happened on land, atmosphere and sea. The land has changed into gullied, eroded and barren. This changing surely as the impact of devastation of earth which is done by the colonizer in colonizing the land. Everything which stands on the land has changed, There was no reborn flora and fauna in McCarthy's The Road. However, the presence of the flora and fauna is the rest of the previous world. Indeed these flora and fauna have changed as the impact of colonialism. Flora in McCarthy's The Road is dominated by the trees. However, most of the trees have changed into gray, dark and black. It is so pathetic when the father and his son faced the standing black trees and they realized that it changes. Horribly, it seems like ghost of trees. The changing of the trees is not underlined on the changes of its colour but also its presence. It means that the trees are not only changing into dark and black with its standing but also there are many trees which die and fall to the ground. The changes of fauna can be seen when the father and his son was camp in the forest and listening for any sound, it draws that the bird has changed its behaviour by holding migratory to circle the earth. The birds can no longer life in harmony with the environment by occupying the forest. It is caused the changing of trees which turn into dead. Thus, it forces the birds to change themselves. Other fauna changing draws when the father who found an odor of cows. However, the cows are extinct since years ago. He asked to himself whether the cows are really real or not. He finally realized that it is extinct. It shows that the cows are changed from the presence to absence. The burning of a certain thing; such as the trees, surely produces a residue or combustion. It can be carbon and ash. It can be imagined how large the amount of ash will be produced if the whole land of forest were burned. Certainly, the ash will cover everything that has seen. A horrible fire of forest has produced a horrible ash too till everything is covered by ash. The ash has moved along the wind till it covered the city and everything in the city, The fire of forest makes the amount of ash become uncontrolled. The moving of ash filled the air and atmosphere in which it makes everything coloured covered by ash and dust. Hence, everything becomes colourless. The ash changes the landscape become gray. It can be assumed that the graying landscape is no other causing by the moving ash. The occupying of ash in the atmosphere makes the day become unseen and dark. The result of the residual combustion is not ashes merely, but also carbons that harm the environment. Ash and carbon both fill and occupy the atmosphere. As the greenhouse effect idea, that the ash and carbon also dust which in a large amount and uncontrolled in atmosphere will form a mantle which wrapped out the whole of earth. This causes our sight of the sky become dark and gray.The sky and cloud are devoured with ash. The cloud becomes ashen and gray. Severity, the ash and carbon have contaminated everything in the air including the sea water vapor. Then, the result is clouds of ash. Ash and dust have affected the form of the cloud to become gray. Probably its content has been also affected. When the clouds changes into gray, it can be predicted that the rainwater which come down from the clouds will also be gray. It is supported with the presence of the ash mantle that wrapped up the earth. Certainly, everything which come down from the sky; rainwater has to pass this mantle, consequently the rain water will be coloured as gray by the ash mantle. The ash mantle has coloured the rain water. The rainwater which drips down to the earth is seen as the gray sheets of rain. Rainwater that is usually used by humans to fulfil their needs such as to irrigate the fields has been contaminated by ash and carbon so that its contents no longer can be used for the benefit of man. Consequently, there will be no crops and there will be no natural food. Mantle of ash has blanketed the earth during the unknown time. As described above that everything which fell from the sky will pass this mantle so that everything will be contaminated by it. The result, everything which fell will be gray. After several days the father and his son watched the gray sheets of rain, the weather quickly changes into snowy. Everyone knows as it has seen that snow is falling from the sky. The snow actually is similar to the rain, including their formed and their fell. The sea water vapor which is formed into cloud in the sky will fall as the rainwater, however, because of the extreme/cold weather, the rain water freeze into ice and it changes into snow that is white and soft. This falling snow of course has to pass the mantle of ash and it changes into gray. The next devastation of earth is turned to everything which lay on the surface of the earth covered by darkness as the ash effect. Everything stands in the earth turned to be black such as the dead trees which burned by fire forest, and the rain water and snow which fell as gray turn into black in the land. The dead trees which burned by fire forest surely create a black view of trees. The trees which burned in incompletely will make an appearance of burnt and black trees. The rainwater and snow which are grey in their falling turned to be black in the land. The large number of those rainwater and snow gathered as one in the ground create a new colour, more intense and black. The gray flakes which fell down turned to the dark slush. Dark slush can be assumed as the slush which is thicker than a flake. Thus, the slush which is as the result of flakes changes into black. It is also applied in the rainwater; the water in the land is not the whole from the rainwater, some from the river and so on. However, the thick rainwater which fell down in gray proved that its water is dominated to black water. the slush which is melted flows through the ash and turned to the black water. THE IMPACTS OF DEVASTATION OF EARTH ON FATHER'S ATTITUDE Living and dwelling in such devastated earth surely give impacts to the humans who walk over it. The father and his son reveal those kinds of impacts. The father who lived before and after unknown disaster seems undergoing a lot of impacts. It is different with his son who born after that disaster. He tends to be innocent, only watch and observe what his father did. There was an idea to end the life when the father still lived with his woman. She always forces him to end their life because there was nothing else to do in the ruined world. However, the father keep his believe that humans have to struggle. The experience of dwelling the life before the unknown disaster made him stronger. The father realized that what the environment did to him is the result what the humans did to the environment, as Lawrence Buell says that human culture is connected to the physical world; nature and environment, affecting it and affected by it. In other word, humans have affected the environment and have been affected by environment. The woman forces him because they lived in unusual life, they lived like zombie. The devastation of earth causes their life as like as zombie or walking dead in a horror film which the father and his son have a role as the victims. They have to avoid even to face the zombie to keep alive. Dwelling the life in such devastated earth; the air was filled by the ash and dust forces them to wear a mask. The devastated earth; unfriendly air forces him to wear mask (canister mask) and even wear biohazard suit. As the affection of the devastated earth, the father and his son have to worry their life, Mostly he worried about their shoes. Worrying is something that the father in his son has to do. There is no certainty living in such ruined world. It is a common thing for them to worry anytime, worrying of food and shoes. Food is essential thing to keep alive. It is the reason why they worry of food. If they can't find some foods, it means they will die. The shoes are important stuff to hold a journey. As explain before that the weather extremely changes a while. Few days were raining, and another was snowing. Shoes keep the father in his son feet to keep away from coldness and freezing which can take their life. The weather is extremely cold. It is not surprising that the weather turns to colder and colder. The weather has changed anytime; sometime it rains and often snow. The coldness of weather doesn't only force them to eat the food that already fermented as above but also threaten their life. The coldness is very extremely danger for them. Moreover it is pictured that the cold can crack the stone and takes their life off. In such condition surely makes them hard to breathe because in the coldness the air contains thin oxygen. Dwelling the life in such devastated earth actually makes him aware of surrounding even the weather. The sounds like forest fire, fallen trees, and so on makes his ears disturbed and consequently he has to keep awake. Living in such devastated earth makes him to be more aware toward everything that threatens them. The father and his son have experienced many kinds of problems. Everything that happened to him does not break his spirit to keep alive even when they are in starving. He always believes that he would find something to eat. the father always optimistic dwelling life. the devastated earth makes him become more optimistic. Struggle is a must to do to find another thing to be eaten to keep the life. Keep trying is the key for the good guys who living in the ruined environment. By keeping trying, they can survive dwelling the life in such environment. Keep trying is not enough to live in such devastated earth. Always suspect the possibility that may happen has to be done, because no one knows what will happen, but the threat of nature always happen all the time. Thus, another thing that has to do is to remain vigilant about the environment. The devastated earth forces him to become "cautious, watchful" and always "on the lookout". He believes that no one expect a trouble. However, living in the devastated earth, the thing that has to do is to always expect it. Thus he was always wary of something bad that may happen. Nothing can be expected from the nature. The father always believed it. He no longer agrees if people prepare something for tomorrow. Although he always optimistic of what he did, he never believed it. For him, even though he's preparing for tomorrow, he doesn't believe that the nature will prepare for him. What the father believes that is now or tomorrow is the same. This belief keeps the father spirit to face his following days. As a father he would often feel the pain. Physically, he is ill of facing the devastated earth. And mentally, he is ill of the feeling of bearing the responsibility as a father who is responsible for the survival of his son and his own life. However nature should never take the life of his son. He would bet his life for the life of his son. Often he complains to himself about his illness. He pretends as tough man in front his son but actually he felt tremendous pain. It's just that he does not want his son to know. THE IMPACTS OF DEVASTATION OF EARTH ON SON'S ATTITUDE Being born in the devastated earth which the unknown disaster has swept it surely affects the son's behaviour toward environment. The greyscale image of environment has saved well in his mind that forces him to expect something else, something in colour. When they continue their journey, the son had found some crayons. These crayons change his mind that something left on earth in colour. Thus, environment is not filling of gray merely. The crayons seem like a hope for

GETTYSBURG "NEWS" PRINT. r . t —Mil HELP THOSE WHO HELP US. The Intercollegiate Bu^au or Academic Costume. Cotrell & Leonard, ALBANY, N. Y. Makers of Caps, Gowns and Hoods to the American Colleges and Universities from the Atlan-tic to the Pacific- Class contracts a specialty, I?.iclL G-o-wns for t3a.e E'-o.lpit and. Bench., WANTED. College students during their vacation can easily make $20 to $30 per week. Write for par-ticulars. THE UNIVERSAL MFG. CO., Pittsburg, Pa. Come and Have a Good Shave,,, or HAIR-CUT at Harry B. Sefton's New Tonsorial Parlors, 35 Baltimore St. BARBERS' SUPPLIES A SPECIALTY. Also, choice line of fine Cigars. Wanted. LADIES AND GENTLEMEN in this and adjoining territories to represent and advertise the Wholesale and Educa-tional department of an old established house of solid financial standing. Salary $3.5° per day with expenses advanced each Monday by check direct from headquar-ters. Horse and buggy furnished when necessary. Position Permanent. Ad-dress, BLEW BROTHERS & CO., Dept. 8, Monon Bldg., Chicago. 111. IF YOU CALL ON C. fl. Bloeher, Jeuuelei*, Centre Square, He can serve you in anything you may want in REPAIRING or JEWELRY. , • . . 1 WE RECOMMEND THESE FIRMS. "FOUR POINTS" Quality of material; thorough-ness of workmanship; perfection of style, and fairness of price are the four cardinal points of this tailor store. J. D. LIPPY, ^9 Chambersburg Street, GETTYSBURG, PA. CITY HOTEL, Main Street, - Gettysburg, Pa. Free 'Bus to and from all trains. Thirty seconds' walk 'from either depot. Dinner with drive over field with four or more, $1.35. Rates, $1.50 to $2.00 per Day. Livery connected. Rubber-tire buggies a specialty. John E. Hughes, Prop. For Artistic Photographs TIPTON, The Leader in Photo Fashions. Frames and Passapartouts Made to Order. C. E. Barbehenn THE EAGLE HOTEL Corner Main and Washington Sts. ©rattalatuma Literal, 50c. Interlinear, $1.50. 147vols. Sirtumaroa German, French, Italian, Spanish, Latin, Greek, $3.00, and $1.00. Completely Parsed Caesar, Book I. Haa on each page interlinear translation, literal translation, and every word completely parsed. Long rowels marked. $1.50. Completely Scanned-Parsed Aeneld, L $1.50. Completely Parsed Cicero, Oration I. $i.». HINDS. NOBLE & ELDREDOE 31-33-35 W. 15th St. New York City Schoolbooks of all publishers at one store PATRONIZE OUR ADVERTISERS. II Of Novelties for the Fall Season, including Latest Suiting, Coating, Trousering and Vesting. Our Prices are Right. SPECIAL CARE TAKEN TO MAKE WORK STYLISH AND EXACTLY TO YOUR ORDER. CUill CQ. Seligman, Taiio*. 7 Chambersbupg St., Gettysburg, Pa. R. A. WONDERS Corner Cigar Parlors. A full line of Cigars, Tobacco, Pipes, etc. Scott's Corner, opp. Eagle Hotel GETTYSBURG, PA. Pool Parlors in Connection. D. J. Swartz Country Produce in Groceries Cigars and ToDacco GETTYSBURG. Established 1887 by Allen Walton. Allen K. Walton, Pres. and Treas. Root. J. Walton, Superintendent. Hiimmelstown Brown Stone Company and Manufacturers of BUILDING STONE, SAWED FLAGGING, and TILE, WALTONVILLE DAUPHIN COUNTY, PENNA. Contractors for all kinds of cut stone work. Telegraph and Express Address, BROWNSTONE, PA. Parties visiting quarries will leave cars at Brownstone Station, on the P. & R. R. R. PATRONIZE OUR ADVERTISERS. A&**44**M4**M4«444 mtt m w«. ttj - - - , I 126 THE MERCURY. VOX HOMINIBUS. BY "ATLANTIS." AROUND the purple azure hill, The river spreads its waters broad, And with its beauty calm and still, Forever murmurs praise to God. And where old ocean dashes wild And hurls the broken wrecks on shore Her thunders say to nature's child, " I praise the Lord forevermore ! " Within the forest's leafy shade Where wooing winds do softly sigh The message by the leaves displayed Is, " Glory be to God on High ! " The lowing herd, the fiery steed, By limb and form and instinct true, Give to their great Creator meed, Honor, and praise most justly due. But man, Creation's royal child, His body formed for God's own fane, Himself this temple hath defiled And mocked his maker's glorious name ! But sweeter far than Siren's song, Fair Virtue cries in accents plain " Ye men ! seek health, forsake the wrong And God's own image thus regain." _ THE MERCURY. 127 THE HOLY GRAIL OF THE TWENTIETH CENTURY. J. EDWARD LOWE, '06. THE past teems with brilliant failures. Woolsey, Solomon, Socrates, Antony, Brutus and Caesar; love, glory, dominion, disgrace, disgust, ingratitude. " He must be fenced with stronger mail Who would seek and find the Holy Grail." The king saw that few of his knights had reached the lower plane of perfect manhood. Few of King Arthur's knights knew the real meaning of the vision. They followed the Grail from curiosity or because others had seen it, therefore the quest was not for them. Their rashness raised an insurmountable barrier between them and their hopes. But we, as Sir Galahad heard, may hear the " still small voice " calling for us to follow. According to a very old tradition the Holy Grail was a cup made of one great sapphire, out of which Jesus drank wine at the last Supper. The Grail-bearer was put under a vow to be chaste and pure of heart. This cup was brought into Britain by Joseph of Arimathea and preserved in his family for many years, an object of adora-tion by pilgrims. The heathen prince Arviragus gave Joseph an isle of marsh whereon to build. Joseph was thankful to the king for this marshy spot, a place very hard to build upon ; but better than to be refused admission. Here he erected a small church, with no other material than the wattles from the marsh. He dedicated that small church to the Great Jehovah, and placed the Holy Grail therein. When it shone before the knights of Camelot, it became necessary for them to leave all and follow it. It is necessary for the knights of the twentieth century to leave all and enter this quest. One of Joseph's descendants broke his vow of chastity, and the Holy Grail disappeared. It became an object of devout search throughout the world by the knights of the Round- Table, and at last the first appearance of the Holy Grail was thus related to Sir Percivale by his sister who was a nun. » - f i i .••»-'( r * IMIMIB llih 128 THE MERCURY. "Sweet brother, I have seen the Holy Grail ; For, waked at dead of night, I heard a sound As of a silver horn from o'er the hills blown, And I thought, It was not Arthur's use, To hunt by moonlight; and the slender sound As from distance beyond distance grew Coming upon me—O never a harp nor a horn Nor aught we blow with breath, or touch with hand, Was like that music as it came ; and then Streamed through my cell a cold and silver beam, And down the long beam stole the Holy Grail, Rose-red with beatings in it, as if alive, Till all the white walls of my cell were dyed With rosy colors leaping on the wall ; And then the music faded, the Grail Past, the beam decayed from the walls and The rosy quiverings died into the night." This was told to the knights by Percivale, and they fasted, watched and prayed. Among them was Sir Galahad, called the " Morning-star," the " Sinless," and who always wore white armor. When he heard of the vision his eyes became wonder-ful and beautiful. Merlin, the enchanter, made a chair and placed it in the vast circular hall. It was carved with strange figures; like a serpent ran a scroll of letters in a tongue that no man could read, " Perilous " for good and evil. If any man sat in that chair of destiny, he would be lost. By misadventure Merlin sat in it, and died. When Galahad heard of Merlin's doom, he cried, " If I lose myself, I save myself." On a summer night while the great banquet lay along the hall, the vision came ; Galahad sat in Merlin's chair, " All at once, os there he sat they heard A cracking and a riving of the roof, A rending, and a blast, and overhead Thunder, in the thunder there was a cry, And in the blast, there smote along the vast hall A beam of light, seven times clearer than day ; And down the long beam stole the angel with wide-spread wings in celes-tial white, bearing the Holy Grail. All over covered with a luminous cloud, And none might see who bare it, and it past." Under an enchantment, Arthur and his court are sustained by a shadowy life, while the procession of the Grail passes nightly before their eyes. They can not be released by death THE MERCURY. 129 until Galahad, the unstained hero, comes into the castle, and, by asking the meaning of the Holy Grail, breaks the spell. Galahad enters their midst; but fails to ask the question. The knights waited breathlessly until he heard a voice and swore a vow. . " Sir Percival vowed before them, that he had not seen the Grail, and would ride, Twelve month and a day in quest of it, Until he found and saw it, as the nun His sister saw it; and Galahad swore the vow And good Sir Bors, Sir Lancelot's cousin, swore, And Lancelot swore, and many among the knights, And Gawain swore, and louder than the rest." Lancelot and many of the knights heard it; sorrow filled their hearts. When Arthur on his return from exterminating a band of heathen heard what had befallen them, he foresaw failure, and failure in this meant failure in all. The knights of the twentieth century do not look upon the Grail as a phantom, it has long since been revealed to them. Neither do they regard the Grail-bearer a mysterious winged form ; but we are able to imagine that we see in the centre of a great glory the appearance of a man, clad in a robe intensely white; 'above its shoulders tower the tops of wings shining and folded ; a star over its forehead glows with steady lustre, bril-liant as Hesperus ; its hands are stretched toward us in bles-sing; its face is serene and divinely beautiful." The Idyls of the King is the latest and greatest picture of man's conflict with sin and fate. The basis of the poem is found in the mystical story of King Arthur and his Round- Table. We need not stop to inquire whether Arthur was a historical character, or a myth, whether the birth-place of the legend which Tennyson has so clearly depicted in his Idyls', was on the misty mountains of Wales, or among the castles of i-ritain. Whatever the origin of the story may be, this fact is certain, that in the middle ages the name of King Arthur had come to stand for an ideal of royal wisdom, chivalric virtue and knightly power. It stands as the central figure in the Idyls of the King. Arthur formed the fair order of the Round- Table a glorious company, the flower of men, that they might have as an object: ISO THE MERCURY. " To serve as a model for the mighty world, And be the fair beginning of a time, To reverence the king, as if he were Their conscience, and their conscience as their king, To break the heathen and uphold the Christ, To ride abroad redressing human wrongs, To speak no slander, no, nor listen to it, To lead sweet lives in purest chastity." Arthur and his glorious company of knights dwelt in their great hall at Camelot. Peace came like spring, for the king had driven out the heathen, and his kingdom blossomed like a rose in richness and beauty. Constant was the pastime of the tournament, where the eye of beauty beheld the brave deeds of dauntless knights. What was the supreme signification of the quest for the Holy Grail? Undoubtedly the poet means symbolizing the attainment of spiritual perfection; this work is a parable. The struggle depicted is our own in which we are engaged every hour. The dual nature of man is at strife. Soul against sense. There is a Round-Table today. We lack Arthur, but a greater Arthur is here. We are the descendants of the knights of the sixth century, and Christians of the twentieth cen-tury. Our conflict is as severe, our goal is the same, our op-portunities are greater. " 'Tis as easy now for the heart to be true • As for grass to be green or skies to be blue, 'Tis the natural way of living." There is a Holy Grail for modern knighthood to strive for. The Grail signifies for us the attainment of a lofty character, perfected manhood, purity of life, courage, truth and all that makes a man. All free men may unite in this quest. The basis of a purpose to form a perfected character, lies not in an evil character, but in a free will. The soul is not foredoomed to a hopeless struggle, but is free to choose between good and evil; and individual destiny is decided by the choice. The past teems with brilliant failures, whose examples should be as beacons to steer us safely from the shoals of present and eternal ruin. Amb'tion establishes its shrine and nations bow THE MERCURY. 131 down and worship. But the niornful cry of Woolsey sounds in our ears : " Cromwell, I charge thee fling away ambition; " men too eagerly follow after the phantom, pleasure. The splendor of Solomon filled his brimming cup, and he drained it to its dregs, and exclaimed in despair, " All is des-tiny." " Knowledge is power," cries the sage ; that is the highest good of life. A deep pathos invaded the gloom of Socrates' last hour. He died like a philosopher, yet without hope. Antony sought for success in love, Brutus in glory, Caesar in dominion. The first found disgrace, the second dis-gust, the third ingratitude, and all found destruction. Great-ness is by 110 means the key to happiness, for some of the greatest men have been the most miserable. Neither does folly prophesy misfortune, for the fool is ordinarily lucky. Let us enter the quest for a higher ideal, work out the problem of life, not bit by bit, but in all its glorious beauty and complete-ness. Be monarchs of ourselves; sway the sceptre in our humble sphere, that we may be crowned in the Fair Celestial city, where the splendor is indescribable, such beauty the human eye has never seen. The throne of Arthur was secure and his reign began prosperously. The poet says that his poem is a tale of human life shadow-ing sense at war with soul. The conflict is in our own exper-ience and lies in the inward struggle. The king, who wore the white flower of a blameless life, is a man in whom the spirit has triumphed. His kingdom rests on this foundation. His aim was to bring his realm into harmony with himself; to build up a spiritual and social order, on which his character would be impressed with the highest and noblest thoughts imaginable. His task was to elevate his people to a higher plane, socially and morally. His greatest foes were not the heathen, for he had subdued those ; but they were the pas-sions and the evil nature in the hearts of the people within his realm. Throughout the world in all ages this conflict is trace-able. The chaste knights of the sixth century rejoice in Sir Laun-fal, " who flashed forth in his unshared mail, to seek in all climes for the Holy Grail;" also in Sir Galahad the pure, U2 THE MERCURY. called " The Morning Star." The chaste knights from the six-teenth until the present century rejoice in Luther, " The Morn-ing Star of the Reformation." The moral knights of the sixth century rejoice in Sir Percivale; those of the twentieth century rejoice in Moody; they left all vain-glorious rivalries and fol-lowed the sweet vision of the Holy Grail. The victorious souls of the sixth-century rejoice in Lancelot and Arthur, noble kings of their country. The victorious souls since the eigh-teenth- century have idolized Washington "The Father of his country; " those of the twentieth century reverence their assasi-nated president, William McKinley. Yes, the Holy Grail of the sixth century was not a phantom. It is the most splendid and most mystical description of the Idyls. The achievement of the quest was the noblest and greatest deed the chivalry of Arthur's order could attempt. The king planned for a delay of the quest, until his knights had attained the necessary degree of social order, and moral perfection. They had been to the ends of the earth in search for the Grail, only to find it at their own door, when genuine charity and love for their fellowmen took possession of their hearts. The same is true of the modern age. We should make a measure of our lives, not by days and weeks, but by thoughts and deeds ; so that when our forms are no longer seen, and our voices no longer heard, may it be said of us, that we spent our lives for the Holy Grail. THE MERCURY. 1.33 COLLEGE OPPORTUNITIES. ESSAY, '07. THERE are very few men, if any, who realize fully, when they enter college just what lies before them. They are apt to look upon the institution and to judge it from their knowledge of preparatory schools. They fail to realize to what extent their sphere of action has been changed, and conse-quently lose valuable time and opportunities before becoming aware of this great change. This, at least, was the writer's experience, and in order that others may not make the same mistake this article is written. Of course the primary thing the student comes to college for is the curriculum work, and this is the very thing that he is most liable to neglect. But it should not be fixed in mind as so much grinding to be done or as so much work to be gotten over as easily as possible, for it is nothing of the kind. The curriculum is not merely so much Latin and Greek and Mathematics mixed up with a few 'ologies and 'isms. But it is the result of years of study by master teachers and of cen-turies of experimenting. It has been evolved from the in-numerable sciences and branches of study known to man. It has been found by theory and by practice that the regular college curriculum of the present time is the course of study that best prepares a man for an active place in the world, and best rounds out his personality. The professors by whom the studies are directed are men of great experience—men who are especially strong in their departments. This advantage of expert instruction the stu-dent has throughout his entire course. It is no small oppor-tunity for students to have such a course of study under such direction open before them. It should not be neglected in any particular, for if it is, the student will awake, as many be-fore him have done, after a year or two have passed by, to find that he is losing in the race—that he is not gaining in its en-tirety that for which he came to college. The curriculum, then, is the primary object. There are opportunities within it, however, of achieving success along M '34 THE MERCURY. special lines. The prizes are offered for this purpose. They are stimuli to greater proficiency. The opportunities for literary attainment are almost unlimited. The inexhaustable libraries will furnish the best books, both of referance and of literature, that the student may need. The essay prizes are incentives for the cultivation of his literary talents. The Literary Societies offer opportunities for practi-cal experience in writing, in public speaking, and in clear thinking while before an audience. They offer training in composition, in oratory, in debate and in various other literary exercises, all of which are of the greatest importance to the college man. The college publications offer additional oppor-tunities for literary experience, such as managing or editing a paper, or more generally, writing up for publication any event of importance, or putting in presentable form the ideas one may have about a certain subject. It is a valuable experience to be on the staff of one of the publications, or at least to be-come a contributor to their columns. There is much to be gained, or lost, by the associations in college. The student's success depends, more than he knows, upon the company he keeps. To be one among several hun-dred young men of high ideals and aspirations is a privilege granted to comparatively few. There are all kinds of men in this student body, men who will be among the leaders of the world's activity in the coming years, and men who will never be anything more than ordinary. If he chooses the former (men) as his companions, his work and habits of study will grow like theirs, easy and natural, and become a source of pleasure to him. But if, on the contrary, he should select the latter men—those who spend much of their time loafing about the pool-room, the cigar-store, or the hotel, letting their golden opportunities slip by unheeded—his inclination will grow along this same line and the object and aim of his college course will, in some degree, be lost. The Y. M. C. A. offers another broad field of action. The active Y. M. C. A. man becomes prominent among the students and weilds an influence for good. It is advantageous to the student to take an active part in this work. It brings him into I THE MERCURY. 135 closer touch with a larger number ol students and he profits by it. This in itself is a broad field and might be dwelt upon to some length, but space does not permit. College offers many other opportunities in addition to the ones before mentioned. For instance, the musical clubs, the orchestra, the dramatic clubs, all with their training and enjoy-able trips, athletics, with all that goes with them, all are in-viting the student to enter them and profit thereby. But all this requires work, in fact, every opportunity offered by college implies work on the part of the student. So we might say, in a word, that the great opportunity a college offers is Work. But it is the right kind of work, and the 'right degree of work to meet the needs of the student. The ideal college life, then, is the well planned, well regulated, strenuous life. So, since we came to college to work and the college offers us work in abundance, let us not be turned away from our purpose by any momentary pleasure-giving avocations, but let us rather do as much work as possible and thereby lay up for ourselves imperishable treasures of discipline, knowledge and power. A PLEA FOR POETRY. BY S. E. SMITH, '07. IN the childhood of the world, in the rosy-fingered dawn of Greek civilization, history and literature began. The ac-cumulated fancies of the ages united in the story of the wrath of Achilles and of the wanderings of Odysseus. The mighty warriors of that day were models of physical courage and de-lighted in slaughter and destruction. Yet, when their feuds were laid aside for a time, they were not ashamed to listen to the deeds of war, love and revenge, clothed in the sensuous imagery of that age. The Odyssey frequently tells us " and a divine bard sang gloriously." Indeed the poet was a welcome guest in the palace of every Achaean king. The land of Aeneas brought forth its bards and in the Augustian age they were 136 THE MERCURY. among the most honored of men. The populace loved poetry and the proud patricians were not slow in helping a poor poet. Thus, Horace, a clerk, becomes a gentleman of leisure under the patronage of Maecenas. In all the Imperial city there was a genuine love for the Muses' art. When the mistress of the world gave way before the barbarian hordes, the love of song still continued. The Germans, with all their vigor and brut-ality, were delighted with the rude rhymes of their day. Our Saxon ancestors loved the fierce lines of Beowulf, brimful of a coarse brutality and horrible murders. Such was the poetry which delighted our Saxon forefathers as they drank and ca-roused in their banquet halls. And then, when the scene of the world's progress shifted to the British Isles and Albion as-sumed the leadership in the world's affairs poetry was given a new impulse. The long line of poets from Spenser to Tennyson have fashioned for themselves monuments which will endure. In England the poets have received every consideration. Many of them have been pensioned by the government. The office of poet-laurate has been a glittering ideal for every English bard. The free air of America has inspired many of her rugged sons to song and during the past century a noble company of poets appeared. Thus, have the poets flourished since the earth first cradled the infant soul of man. They have been universally loved because they have spoken to the heart. They have furnished the inspiration tor useful deeds. They have supplied the balm of Gilead for many a heart wound. They have armed the mightiest of warriors, they have soothed the most timid of women. The kingly Gladstone found daily help in the study of Homer. His manly character gained strength for mighty political battles through contact with the poets. Such has been the influence of the poetic muse upon the world. But times have changed. In this land of ours a new influence has appeared. It has quickened the national pulse. Under its spell material progress has been so great that the sluggish blood of Europe has been amazed at the rush of our national life. Today America is setting the pace for the rest of the world. In the material things of life Columbia is supreme. But as a nation we have paid for this supremecy. THE MERCURY. 13; We have given up that which satisfies the soul for that which delights the body for a time. As a nation we are unacquainted with the poets. Of course everyone knows the names of the great poets and can tell works they have written. But how many are acquainted with the works themselves ? How many can repeat from memory a half dozen lines from the works of four different poets ? We Americans no longer see visions in the poets' lines. We are too commonplace. We have for-gotten that the poets have clothed the infinite in finite terms. Indeed, by foresaking the poetic Muse, we have lost the very breath of heaven. What is the cause of this national indiffer-ence to the masters of English verse ? Let me tell you a story. Two lads of nine go out for a walk in the woods and with child-like eagerness search for treasures. The one is attracted by the smooth stones, gleaming in the bed of the foaming brook. He takes off his shoes and stockings and wades in the rushing waters. He gathers a great heap of the shining pebbles. He fills his pockets and places the rest in his hat. The other boy cares not for the flinty baubles but finds delight in the flowers growing on the grassy bank of the stream. At length they start on their way homeward. The pebbles in the hat become so heavy that their owner is obliged to fling them away and those in his pockets become so heavy that they are a burden. At last they reach their home and the boys show their treas-ures. The first boy tired out by his heavy burden drops the stones on the floor and the white pebbles are not as beautiful as when they lay in the bed of the stream under the bright sun. The second boy puts his flowers in water and for a week their soft colors are a reminder of the glorious woods. Like the first boy we Americans are too much occupied with the pebbles, material things of life. We neglect the flowers, the poetry of life, which can open to us a glimpse of the eternal. It is no wonder that Americans grow old before their time, that when we contemplate the temporal comforts which we have secured, there comes a satiety which is almost a loathing. The Ameri-can method has made life a scramble for wealth and position, a ceaseless round of duties. No time is there for a fellowship with earth's choicest spirits. The business man will tell you he 138 THE MERCURY. has no time for poetry. We of the coming generation are catching his spirit. Oh, what a mistake! By shunning the companionship of the poets we are cutting ourselves off from the noblest thoughts of the world. Our plea is for a wider ac-quaintance with the poets. Our desire is that the gems of poetry may be fixed in the halls of memory. The poet has a message for every experience of life. Thus, when the tempter comes luring us into the paths of questionable pleasure, the message of the Scottish bard rings out: " Pleasures are like poppies spread, You seize the bloom, its beauties shed ; Or like the snowfall along the river, One moment white, and melts forever ; Or like the Borealis rays which flit Ere you can point their place ; Or like the rainbow's lovely form, Evanishing amid the storm." When the madness of man is upon us and in our folly we be-gin to judge our fellowmen, Joaquin Miller, the poet of the Sierras, reminds us: " In those whom men pronounce as ill I find so much of goodness still ; In those whom men pronounce divine I find so much sin and blot. I hesitate to draw the line When God has not." When we are dissatisfied with our surroundings and long for distant scenes, we should hear the mild rebuke of Emerson: " Why see Italy Who cannot circumnavigate the sea Of thoughts and things at home but still adjourn The nearest matters for a thousand days ? " The poet has a message for those who buy and sell. would be fewer bad bargains if Lowell's lines were memory: 1' Earth gets its price for what Earth gives us, The begger is taxed for a corner to die in, The priest hath his fee who comes and shrives us, We bargain for the graves we lie in ; At the Devil's booth are all things sold, Each ounce of dross costs its ounce of gold ; There held in THE MERCURY. 139 For a cap and bells our lives we pay, Bubbles we earn with a whole soul's tasking ; 'Tis heaven alone that is given away, 'Tis only God may be had for the asking." And then, when life is dark and disappointment and the end of lile are like clouds in the way, how comforting is Tennyson's expression of an eternal hope: " Sunset and evening star And one clear call for me, And may there be no moaning of the bar, When I put out to sea. " But such a tide as moving seems serene, Too full for sound and foam, As that from out the boundless deep Turns again home. " Twilight and evening bell, And after that the dark ; And may there be no sadness of farewell When I embark.- " And though from out the bounre of time and place The flood shall bear me far, I hope to see my Pilot face to face, When I have crossed the bar." These are a few poetic gems from the inexhaustible minds. They are not for weaklings. Poetry is not effeminate as some have affirmed. The ages acknowledged it the language of the soul. It unites the mortal with the immortal. It brings the largest vision of opportunity and service. The way is open- Nature abhors a vacuum. Our minds must think some thoughts. Shall we allow the cares and worries of our present existence to cloud minds which are immortal ? Let us keep our hearts in harmony with the Infinite by a companionship with the poets. Then will our souls rise from things of earth to their eternal home. V1/ - 140 THE MERCURY. TOM LAYMOND'S DECISION. STORY. DARE I keep on playing ? How can I give it up? Is it wholly impossible lor me to become both an athlete and a scholar ? These were the words that involuntarily fell from the lips of Tom Laymond as he sat alone in his cosy room in one of the dormitories of the Newton College in one of the New England States, trying as he had tried time and time again, since entering college, to decide whether he should give up his football and his prospects of a position on the " Varsity" eleven and devote all his time to study. Tom Laymond had been born and reared in the little village of Compton in the heart of the Green mountains, and there among the hills and valleys he had developed a strong, vigor-ous body as well as a keen and energetic mind and it was little wonder that during his three years in the acadjmy of a neighboring village he had developed into a star half-back idolized and envied by all the boys of the academy. Now he had entered college and during the two short weeks that he had been there, he had shown such promise that coach Weston had already given him a position as sub-halfback on the " varsity " eleven and had spoken so encouragingly that his hopes for a permanent position were high and not un-reasonably so. But as he had found the opportunities for ath-letic development much greater at the college than at the academy; he found also that his studies would be more diffi-cult and would require much more time. At the beginning of his college career Tom had promised his parents that he would never allow anything to tempt him to neglect his studies. And now he found the questions already mentioned confronting him. With his love for football and his desire to be a great athlete, battling against his determination to keep up his stand-ard of scholarship, no wonder the struggle was a hard one and had to be fought over and over again. Matters with Tom continued this way for several days. Sometimes he would almost determine to play football, regard-less of the cost, and again he would almost decide to give it up. But he kept hard at work under Coach Weston, who being THE MERCURY. 141 much pleased with his efforts placed him in a game with one of the rival colleges as " varsity " half-back and kept him in during the entire game. It was a hard contest but Tom was finally pushed over the goal line for a touchdown which won the game. And as he limped wearily from the field, Jack Leighton, one of his warmest admirers, called him aside and introduced his sister Hazel. Bruised, torn, and covered with the dust and dirt of the battle, it was little wonder that Tom felt slightly confused as he looked into the face of this fair maiden. For Hazel Leigh-ton was beautiful enough to set the heart of any man throb-bing, let alone that of this young athlete. Tom hurried away to dress but those few moments that he had gazed into the face of Hazel Leighton had wrought a great change in the heart of Tom Laymond and more than this as he hurried away to-ward the gymnasium he overheard some words of admiration which she spoke to her brother. That night the battle with Tom raged more fiercely than ever. A new and powerful argument had sprung up in favor of athletics, for he cherished in his heart the image of beautiful Hazel Leighton, and her words of admiration were constantly passing through his mind. In spite of all this he stood firmly in his resolve to maintain his scholarship and finally after toss-ing upon his bed until dawn was stealing over the eastern hill-tops, he arose determined that he would give up neither but become both an athlete and a scholar. So quietly and earnestly he went to work on his lessons for the coming day. Having made this decision Tom went about his work and play with an energy and determination that invariably conquers all difficulties, yet many were the trials with which he met dur-ing the remainder of his course, and at times he thought that he would have to fight the old battle over again. But gradu-ally the season drew to a close and with his mind and energies all centered on the final game with Goston University he for a time forgot his troubles. The day for the game finally arrived and early in the after-noon it was called. Before many minutes it was seen that the teams were well matched, so well indeed that during the first - ■ -w l^f^' ' 142 THE MERCURY. half each team scored a touchdown ; but during the second half the ball surged back and forth near the center of the field ; first in possession of one side and then of the other. Finally, with only three minutes to play, Tom broke through the line and by a brilliant dash carried the ball over. For a while it seemed that the Newtonians had gone wild. Cheer after cheer they gave and, rushing from the sidelines, they seized Tom and carried him from the field in triumph. Yet amid all his glory Tom could not fully enjoy himself until he met the smiling eyes of Hazel Leighton and heard her words of praise. Then he gave himself fully to the enjoyment of the occasion feel-ing that those few words from her lips far excelled the plaudits of all his fellow-students. Football season being over Tom soon found time beginning to drag and also to his amazement that he made little, if any, improvement in his class standing, because he was neglecting his physical training and he soon began to see that physical and mental training should go hand in hand; for the trained mind is worthless in a ruined body and a strong body is power-less without a mind to guide it. So each day he was more impressed with the wisdom of his decision to become both an athlete and a scholar. Thus Tom continued throughout his college course. He became not only a football star but also a " forward " on the basketball team and " crack " shortstop of the baseball nine. Yet his work did not suffer and at the close of his college course he ranked second in his class. But he won also what he prized far more than all his honors and that was the heart and hand of Hazel Leighton, and one beautiful evening in June as they strolled along the pathway from the college talking, of the days when they were almost strangers, Hazel turning to Tom said : " Now. I want to tell you how I first came to love you. I admired you first as an athlete, afterward as a student; and I soon found that one worthy of so much admiration was worthy also of my love." And Tom clasping her in his arms replied: " Then you also, above all things else, I owe to my decision." THE MERCURY. 143 CHARACTER AND ITS INFLUENCE. Bv ZENAS O. FISCUS, '07. Character is one of the greatest motive powers in the world. In its noblest embodiments it :xemplifies human nature in its highest forms, for it exhibits man at his best. Although genius may command admiration, character the more secures respect. The former is more the product of brain-power, the latter of heart-power, and in the long run it is the heart that rules in life. A man to possess a noble character need not be a great man as the world classes great men. That man has a true, noble character who uses his gifts rightlv and does his duty in what-ever station of life he may be situated. At the same time while duty, for the most part, applies to the conduct of affairs in common life by the average of common men, it is also a sustaining power to men of the very highest standard of character. They may not have money or property or learning or power; and yet they may be strong in heart and rich in spirit. And whoever strives to do his duty faith-fully is fulfilling the purpose for which he was created and is building up in himself the principles of a manly character. Intellectual culture has no necessary relation to purity or excellence of character. A man may be accomplished in art, literature and science and yet in honesty, virtue, and the spirit of duty might well pattern after some poor, illiterate peasant. But back of character lies a chain of actions, thoughts, and feelings each of which contributes to the education of the temper, the habits, and the understanding, and exercises an in-evitable influence upon al! the acts of our future life. There-fore with the light of great examples to guide us, every one is not only justified but in duty bound, to aim at reaching the highest standard of character. Men of high character carry its influence wherever they go When Washington consented to act as commander-in-chief of the patriot army during the Revolutionary war, it was felt as if the strength of the American forces had been doubled. Again, many years later, in 1789, when Washington, grown old, had withdrawn from public life and was living in retirement at Mt -.-.- . ■ -*- — . .--.'., «.-«. - 144 THE MERCURY. Vernon, and war with France seemed imminent, President Adams wrote to him saying, " We must have your name if you will permit us to use it; there will be more efficiency in it than in many an army." Such was the esteem in which the great President's noble character and eminent abilities were held by his countrymen. Thus Washington left behind him the ex-ample of a great and noble character as a model for his nation to form themselves by in all ages to come. Then again a nation must possess character if it would en-dure and this is secured only through the character of the in-dividual. Where national character ceases to be upheld a nation may be regarded as next to lost. When such a state is reached that honor and obedience are seemingly lost, the only remedy is the restoration of individual character and if this be irrecov-erably lost there will be nothing left worth saving. THE MERCURY. 145 THE CONSUMMATION. w F. MOSER, '07. HY should we turn to lesser art When free in nature 'round By far degree the rarest hue, The truest song is found ? Awakened by the day's decline, To life they quickly spring, While o'er the land in joyful tones All nature's heart doth sing. What hue is like the dying hue The darkening evening holds ? Its crimson and its amber sweep In rolling, swelling folds? Among the kingdoms of the clouds, The monarch's royal robe, It well portrays in flashing rays That monarch's crown is love. What note is like the swelling chord That from the wild birds come, When at the evening winging swift To distant forest home? Its melody floats earthward While the volume rolls along, As 'neath the sky swift passes by The songster and his song. It almost seems as if the sky Were painted in our sight While from its portals sweetly sounds The chorus of the night; And though the arching dome may seem To lose its last bright ray, The gloom but serves to usher in The glory of the day. ^MflNBfl 146 THE MERCURY. "THE SPECKLED HORSE." BY H. A. MCGILL, '06. The time—evening of Feb. 7th, in the year of our Lord 1902; the place—the great city of London ; and the man Jim Grath —criminal, ex-convict and kidnapper. " I'm tired, so tired, sir, you said we'd soon see the Beautiful Lady." The brave little voice quivered pitifully, and the great blue eyes of the tiny lad in kilts, looked up fearlessly, if full of tears, into the hardened face of the man. All day long they had tramped these two, " miles and miles " it seemed to little Rob, from the handsome home where he had lived with the " Beautiful Lady," to the strange and narrow streets through which this queer man now hurried him. The " Beautiful Lady " was a name the child had given to the step-mother, whose short stay in the home of his grave, silent father had brought days of unknown and undreamed of happiness to little Rob. Days, which had suddenly passed away, when one stormy night, she came with* flushed face, and tear-bright eyes, to say good-bye to him. "Why had she gone ? The question had been in the child's mind ever since that fatal night, but he dared not ask the father, whose love had, until her coming, been the one bright spot in his lonely little life. For, to this, the child of his first wife, the man, judged by acquaintances to be cold, haughty, and mercenary, had given the love of a heart long hidden from the world, and the child, in the wonderful wisdom of his childhood, had accepted it without question. In this same spirit of unquestioning faith, the boy had held out his tiny hands to the " Beautiful Lady," when she came through her marriage of convenience, to the home of the man whom the world called her fit companion for life's journey, the man who seemed as cold and proud as she herself. So it was, that despite her bitterness, and her cynicism, this little child had wrought a miracle, and through the love which sprang up in her heart for the son, grew the love, that suffered in secret for the father. Of course this state of affairs should have soon ended in a wonderful " finale" of enlightment for the man,and joy for the THE MERCURY. 147 woman, the chief goal of the romantacist should have been reached at once, and " all gone merrily as a marriage bell." Yet real life rarley runs along the lines of romance, and sad truth compells the statement that these unhappy people were at last forced, through their many quarrels, into a permanent separation. These things, however, Rob could not understand. Had not he said that he would take care of her, and buy her everything in the world, when he was a big man ! But she had only smiled at this generous offer, and hugged him tight, so tight, that it almost hurt, then put him down quickly, and gone away out into the dark night, never to come back to him again. Now, this morning while he played near the edge of the park, all alone with his thoughts, this strange, good-natured man had come. He had told him all about her, the " Beautiful Lady," and the man seemed to know her well, and had prom-ised to take him to her so that he could ask her again to stay with him. She had given him the Speckled Horse, maybe she was sorry now, and wanted him for herself. " You see the Speckled Horse is very nice" he had told the strange man as he showed his treasure, " and maybe she will come back if she can have him again." But now he was very, very tired, and the Speckled Horse was so heavy. He seemed to have sharp edges and points all over him, that stuck into Rob's arms and chest as he walked, and hurt, then, all of a sudden, he jumped out of his arms, and went rolling off into the gutter, and Jim, the strange man, who now did not smile, any more, but scowled, gave Rob a hard jerk when he tried to go after him, and said " come along in here young one." He did not even seem to remember that "the Speckled Horse was very nice'' and " had belonged to her." Into a strange, foulsmelling house they hurried, and left that wonderful steed to perchance an awful fate. Rob could not understand again, and he sobbed aloud. Lights hurried to and fro in the great suburban mansion, and over its surrounding parks. All afternoon the searchers had been working, and now returned only to report fruitless labors, and start once more upon their quest. To the man who sat there worn with anxious dread in the midst of his 148 THE MERCURY. riches, the minutes dragged as hours and were far out-stripped by his bitter thoughts. Suddenly upon the threshold of the great library door stood the woman; she, whom he had thought to use as a figure-head in his handsome mansion; she, whose beauty was to have impressed his acquaintance, just as his wealth and position had already done ; the woman, to whom much had been given, according to his worldly stand-point, but who had failed him, and repaid his bounty by the disgrace of his name. With one quick impulsive gesture she held out her arms toward him, then suddenly dropping them asked, in a voice so broken and changed, that he scarcely recognized it, " The boy, have you not yet found him ?" He rose quickly to his feet and, faced her in his bitterness. " What is that to you ?" he said, "You can not care, or else you would not so soon have left both him and me. Why do you come here now to taunt me that I have lost him ?" Turning her face from the scorn of his angry eyes, she answered brokenly," "Because I loved him too, and——" " And ? and what ?" he questioned," You," came the almost inaudible reply. In the great room silence reigned—a silence that could be felt; then, as a log burned itself out and fell upon the hearth the man lifted his bowed head and crossed over to his wife. As he raised her down-cast face between his hands, he looked deep into the eyes, where sorrow struggled with a light before unseen, and said in a voice made gentle through a great hu-mility. "Let us go, and search for him together." [TO BE CONTINUED.] %> THE MERCURY Entered at the Postoffice at Gettysburg as second-class Matter VOL. XIII GETTYSBURG, PA., OCTOBER, 1905 No. 5 Editor-in-chief HARRIET A. MCGILL, '06 Exchange.Editor MARY B. MCGILL, '06 Business Managers THOMAS FAUST, '07 E. VICTOR ROLAND,'07 Associate Editors - H. F. SMITH, '07 CLIFFORD HARTMAN, '07 W. B. RICK, '07 Advisory Board PROF. J. A. HIMES, LITT.D. PROF. G. D. STAHLEY, M.D. PROF. J. W. RICHARD, D.D. Published each month, from October to June inclusive, by the joint literary societies of Pennsylvania (Gettysburg) College. Subscription price, one dollar a year in advance; single copies 15 cents. Notice to discontinue sending the MERCURY to any address must be accompanied by all arrearages. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Busi-ness Manager. Articles for publication should be addressed to the Editor. Address THE MERCURY, GETTYSBURG, PA. EDITORIALS. To the Freshmen of Pennsylvania College : Dear Friends, Years come and go, and once more it is the duty as well as the great pleasure of a MERCURY staff to welcome the new class which has entered the portals of our Alma Mater. Wel-come— how significant is the word, what hope of future promise does it contain, and how great the expectations which its utter-ance arouses. We need you, newcomers, that is what it means. We need you in the Y. M. C. A., in the class-rooms, on the athletic field, in the halls of our rival literary societies, and greatly indeed does the MERCURY need your help and coopera-tion. Do not let the feeling that you are strangers withhold your interest in your College—she belongs \.o you, use her. If I50 THE MERCURV. you have ambition, do not fear the fate of brave Caesar; there is no " honorable man " among our higher classmen who will condemn you—start in and win. There is, for instance, a priz*, which the Pen and Sword society has offered for the best pro-duction of any kind, to be published in our college monthly. There are but three more numbers to be issued by the present staff, and until this number, no one has tried for that prize Do you wonder that you are needed ? Any person handing his prc-duction and a nom de plume to Dr. Himes has a fair trial (or the winning of this prize. One person may write as many articles as he desires, all will be noticed. Do not let our student-body be shamed before the Alumni of the Pen and Sword by the ingratitude of not even trying for the prize, which they so kindly offer. There are more ways than one to show that you are worth something to your Alma Mater. Try this one, Freshmen, and good luck to you. Sincerely, "THE STAFF." As we begin another year in our college course it will be profitable, perhaps, to old students as well as new, to say a few words on athletics. Not to expound many new facts and theories but to impress one and all with the necessity of ath-letic training and encouragement. We have come here to develop and strengthen our minds to encounter the many disappointments, failures, successes, etc., in life. We must keep in mind, however, that an exceedingly well developed mind can accomplish little without a sound, healthy body. Take advantage of our athletic field, gymnas-ium, tennis courts, etc., in your spare moments, and you will develop with your mind, a stronger, healthy body. One is necessarily a companion of the other and if you have ambition some day to amount to something above the ordinary it is nec-essary for you to be sound in body and mind. Then, in concentrating your efforts with those of others, you will be able, if not to make a varsity, to help develop one. This is where the true college spirit lies. No varsity can sue- THE MERCURY. 151 ; ceed without a second team and, when the true love of Alma Mater is present, each one strives unselfishly toward the better-ment of the varsity. Thus in bettering yourself you can at the same time by sincere cooperation promote the standing and welfare of your College. Further, if through some reason you are not able to lend your efforts to the physical making of the varsity, give them good honest support. All efforts will be in vain unless there is a loyal support by the entire student body. Learn the yells and don't be afraid to use them in encouraging the team. When asked for financial support give it promptly and as lib-erally as possible. Give all candidates encouragement and don't be too ready to find fault with the coaching, placing and management of the teams. In short, give your attention to the welfare of the college, which surely includes all that has here been said, and be a good, loyal College man. c. H. The Senior was weary: He had finished his last summer vacation at home, and well launched upon the duties of his last Collegiate year, had been thinking of the future. He had planed wonderful things for himself, this Senior. A career already marked with the word success, a position secured immediately after his graduation, " health, wealth, happiness," and in short many things. In the meantime, however, the Senior fell asleep. It was then that there came to him a strange dream, and a strange vision—the meaning of which he cannot understand so he fain would inquire from the seers of his Alma Mater, as to the interpretation thereof. Although the Senior had never been an athlete he saw himself in the garb of an acrobat, and heard, above the sound of a great concourse of people, the voice of a trainer, whom he had never seen before, yet whose personality seemed strangly familiar, speaking to him, and giv-ing him his final directions. It seems that his task was the climbing of a great promontory, along which there were cer-tain resting places to which the trainer could follow him with ad-vice and encouragement. From the top this eminence how-ever, could be seen a great mass of ice and snow which must i 152 THE MERCURY. be lept before the acrobat could reach another promontory, from whose height he must cast himself into the crowd below. And, in order that through this last feat he might come to no harm, the Senior had prepared for himself a matress to throw before him, and make for himself a landing place. Slowly, and with much hope in his heart he began the ascent, and upon the first resting place was the trainer, who with words of cheer bade him pass on. So was it with the second and third stages, but when he reached the top, without thought of the faithful trainer, he flung his matress before him, and leaped through ice and snow upon the other promontory. So far, all had been well, it was here that fear sized him, as he gazed upon the great depths be-low, and strained his eyes to find a vacant place in the multi-tude where he could throw his matress. It was then, that he burried his face in his hands, and cried in great despair to the trainer, seeking aid in his distress, yet scarce expecting it. Then suddenly as he faltered trembling upon the brink, his trainer as by a miracle stood beside him, and pointing to the matress at his feet, said in that gentle, patient voice, with which he had been want to coach him. " It is too broad— you must return, and make for yourself a narrow one, thus alone will you find room in the crowd below. It was then that the Senior awoke, and now in his bewilder-ment, would know the interpretation of his dream. In truth his wish shall be granted, for he has been blessed above his fellows through the spirit of warning. Thus say the seers. The first promontory is the College course—the second the symbol of his position after leaving his Alma Mater before he has taken his place in the world; the matress is his idea of what that place shall be, and the trainer, well the trainer is known to all men, his name is Experience. PATRONIZE OUR ADVERTISERS. } /*■ FURNITURE Mattresses, Bed Springs, Iron Beds, Picture Frames. Repair Work done promptly. Under-taking a specialty. * Telephone No. 97. L Bendei 37 Baltimore St., Gettysburg, Pa. The Windsor Hotel 1217-29 Filbert St., Philadelphia. Headquarters for Students. Thoroughly Renovated, Refurnished and Remodeled FRANK M. SCHEIBLEY, Manager. Graduate of Lafayette College 1898. A Complete Encyclopedia of Amateur Sport Spalding's Official Athletic Almanac FOR 1905. EDITED BY J. E. SULLIVAN (Chief of Department of Physical Culture. Louisiana Purchase Exposition). Should be read by every college student, as it contains the records of all college athletics and all amateur events in this country and abroad. It also contains a complete review of Olympic Games for the official report of Director Sullivan and a resume of the two days devoted to sports in which savages were the only contestants, in which it is proved conclusively that savages are not the natural born athletics we have heretofore supposed them to be. This is the first time in which the athletic performances of savages have ever been systematically recorded. This is the largest Athletic Almanac ever published, containing 320 pages. Numerous illustrations of prominent athletes and track teams. Price rp Cents. For sale by all newsdealers and A. G. SPALDING