Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.
Abstrak Karya sastra merupakan miniatur dari dunia nyata, dimana sebuah karya sastra biasanya mengungkap beberapa masalah yang berkaitan dengan makhluk hidup termasuk isu-isu tentang hubungan manusia dengan alam. Manusia lebih cenderung melakukan kerusakan pada lingkungan daripada menjaganya, hal ini menyebabkan kehancuran bumi beserta isinya. Hal ini tergambar pada novel The Road karya McCarthy dimana lingkungan yang menjadi setting utamanya hancur berantakan. Lansekapnya tertutup oleh abu yang berterbangan. Dan ketika salju turun, ia berwarna abu-abu. Langitnya juga terlihat gelap. Oleh sebab itu, ada beberapa masalah yang berhubungan dengan kehancuran bumi yang tergambar pada novel yang kemudian memunculkan dua dasar pertanyaan (1) bagaimana kehancuran bumi digambarkan dalam novel The Road karya McCarthy? Dan (2) bagaimana kehancuran bumi memberikan dampak terhadap karakter utama dalam novel The Road karya McCarthy?. Untuk melihat masalah ini perlu teori yang pas yang biasa disebut ecocriticism. Ecocriticism melihat kehancuran bumi sebagai hasil dari tingkah laku manusia terhadap lingkungan misalnya: eksploitasi dan colonialisasi. Seperti yang dikatakan Lawrence Buell bahwa kondisi lingkungan itu ditentukan oleh manusia. Ecocriticism adalah suatu istilah yang berada dibawah payung postcolonialism dimana seorang postcolonialist meyakini bahwa kolonialisasi mempunyai campur tangan dalam penghancuran bumi. Para penjajah merasa percaya diri untuk mengeksploitasi bumi karena dianugrahi kekuatan oleh modernism. Untuk mendapatkan analisis yang jelas, skripsi ini menggunakan metode descriptive quality dimana kualitas data menjadi poin utama daripada jumlah data. Jadi, terlihat jelas bahwa kehancuran bumi terjadi diseluruh lapisan lingkungan; yaitu atmosfer, permukaan tanah, dan laut. Seluruh atmosfer dipenuhi oleh abu, debu dan karbon, tanahnya terkikis, tandus dan gundul, dan lautnya berubah menjadi abu-abu. Kehancuran bumi ini juga memberikan kesuraman tersendiri kepada tokoh si bapak dan si anak. Mereka harus melalui hidup yang keras, susah untuk bernafas, susah untuk menemukan sesuatu yang bisa dimakan dan secara mental mereka selalu takut akan ancaman-ancaman dari kehancuran bumi. Kata Kunci: kehancuran bumi, ecocriticism, postcolonialism, modernism. Abstract Literary work is a miniature of larger world or reality, whereas a literary work reveals some problems related to humans being including issues of human relationships with the environment. Humans tend to do damage to the environment rather than maintaining it, thus it causes devastation of earth. It is reflected in McCarthy's the road where the environment is devastated. The landscape save the ash on the wind, and when the snow falls, it is gray. The sky is also dark. Therefore, there are some problems of knowledge about how the devastation of earth portrays in the novel, which are delivered to two main questions of (1) How is devastation of earth depicted in Cormac McCarthy's The Road? and (2) How does devastation of earth give impacts to the main characters in Cormac McCarthy's The Road?. In case to observe these problems, it needs a suitable theory which called ecocriticism. Ecocriticism sees the devastation of earth as the result of humans' behaviour such as exploitation and colonialism of the environment, as Lawrence Buell says that the condition of the environment is determined by humans. Ecocriticism is under umbrella term of postcolonialism in which postcolonilist believes that colonization has intervention in devastating the earth. Colonizer is encouraged to exploit the nature because of power that is given by modernism. To get a clear analysis, this thesis uses descriptive quality method; it means the quality of the data becomes the reference to work rather than the quantity of the data. Thus, it is seen clearly that devastation of earth happened in the whole layers of environment; atmosphere, land and sea. The atmosphere is occupied by ash, dust and carbon, the land has eroded and barren and the sea have changed into gray. This devastation also gives a misery to the father and the son as the main characters. They have to undergo hard life; hard to breathe, hard to find food and mentally they are haunted by the devastated earth's threatens. Keywords: devastation of earth, ecocriticism, postcolonialism, modernism. INTRODUCTION Humans often feel indifferent toward nature. For them, nature is something considerably as a 'mystic' thing, when it goes right, humans forget it, when it goes wrong, they worry it. People tend to prefer natural environments more than built environments, and built environments with water, trees, and other vegetation more than built environments without such features (Kaplan & Kaplan, 1989). On the other word, humans tend to permit the nature walks down by itself. They seem to just let it flow without thinking how to keep and maintenance the nature. The study of humans' relation with nature which is known as ecology was begun since years ago when humans lived in harmony with the nature. However, in line with development the nature also changes. Unfortunately, this natural changes brings devastation on earth, as Donald Hughes says that looking back to our historical ecology, Humans have related in multiple ways to the Earth's systems; some of these ways promise a sustainable balance with them, while others are destructive (Hughes, 2001: 269). Historically, through devastation of earth Humans have made major changes in their environments. This is happened almost in the whole surface, as Hughes says that devastation of earth has happened in every historical period and in every part of the inhabited Earth (2001: 1). In order to observe those processes of change that affect the relationship, ecologist studies the mutual effects that other species, natural forces, and cycles have on humans, and the actions of humans that affect the web of connections with non-human organisms and entities (id. at 4.). This ecologist's study shows that devastation of earth is the result of humans' behaviour toward environment. This bad behaviour has changed the environment that will bring devastation to the humans themselves. Humans seemingly don't care of the environment. Severity, humans tend to be more destructive. It forces some Ecocritics who concern in literary study and environment in late nineteenth criticized humans' behaviour toward nature. This criticises show how important avoiding that kind of behaviour toward nature which brings devastation of earth merely, it signed that the study of literature which related to the environment has to be discussed. There were in fact some isolated calls for an ecologically oriented criticism during the 1970s (Rigby, vol 2: 2). However, it was not until the end of the twentieth century that the study of literature and the environment was finally recognized as 'a subject on the rise'. In studying of literature, humans ordinarily focus on the relation between humans and others (society) or between humans and themselves (psychology), whereas, the relation between humans and environment actually is tightly connected. Unfortunately, the study of literature which related to the earth was often forgotten, whereas, the study of literature which related to the environment is greatly important. The study of environment is not merely observing of the nature or nonhumans aspect but it tends to study the relation among nature, earth and the humans themselves. Human actually is a part of environmental system, and therefore the environment has the crucial role in humans life in which it is become the main point of literary study. In some respects, it is perhaps not surprising that the study of literary texts should be coupled with such forgetfulness of the earth. Thus it is needed a study of humans' relation and environment. The study of literature and environment got a full attention when modern era begun to destruct the environment. Since last decade ago, especially years ago, humans consciously realized the impacts of their behaviour toward nature, moreover when they become crazier of invention, exploration and exploitation of the nature. Surely, this impact is indirectly causing ecological changes. However, actually what people do about their ecology depend on what they think about themselves in relation to things around them. Human ecology is deeply conditioned by beliefs about our nature and destiny (White 1996, 6). It can be imagined when humans were only thinking about themselves and forgetting the nature or they were just considering their needs without considering the nature needs, it can be ascertained that the nature will vanish and be extinct. This idea or thought about indifference toward nature is criticized by the Ecocritics. Ecocriticism maintains that literature may be approached in a way that examines humans as part of an ecosystem; they are neither master nor slave to it, but simply one part of an intricate system. Literature and environment truly can't be separated each other. Moreover, Lawrence Buell argues in his book The Truth of Ecology as quoted by Dana Philip that literature would be environmental. It would evoke the natural world through verbal surrogates, and would thereby attempt to bond the reader to the world as well as to discourse (Philip, 2003: 7). It can be assumed that through the literary work, the reader will be brought to the environmental world and devastation of earth. Indirectly, literature causes the reader's interpretation of the environment. Thus, it is important to understand the relation between humans and environment through literary work. It needs to notice that ecology is not a slush fund of fact, value, and metaphor, but a less than fully coherent field with a very checkered past and a fairly uncertain future (Philip, 2003: 45). By understanding the relation between humans and environment, it is beneficial to determine the act effectively on the impact of natural destruction and to integrate knowledge and actions. The study of literature and environment works in tandem in determining humans' perception and interpretation toward nature. As Lawrence Buell says that literature and environment studies must make their case for the indispensableness of physical environment as a shaping force in human art and experience, and how such an aesthetic works (2001: 9). It can be assumed that environmental interpretation is a humanistic inquiry. In other word, what people think about nature, and how they have expressed those ideas is what people interpret of the nature. Generally what people expressed the idea of the nature is a Realistic depiction of the world. Thus, it needs a tool to see this depiction. Surely Ecocriticism is a proper tool to see the depiction of the world. Ecocriticism is the most suitable binoculars to telescoped ecological issue and ecological changes in such literary work, as Sheryl Glotfelty (1996: xviii) says that Ecocriticism is the study of the relationship between literature and the physical environment, Ecocriticism takes an earth-centered approach to literary studies. Only Ecocriticicism observes the relation between humans and nonhumans aspects. What Ecocritics do, in short, is attempting to discover nature as absence, silence in texts, and construe environmental representation as a relevant category of literary (Buell, 2005: 30). Ecocriticism encourages the changing of canonisation through entering literary works which carry up natural issue. Ecocriticism ecologically oriented critique of the way in which Nature is constructed in certain canonical texts. Environmental literature constitutes the third way in which Ecocriticism recasts the canon. According to Lawrence Buell (1995, 7-8), an environmentally oriented work should display some characteristics; first, the nonhuman environment is present not merely as a framing device but as a presence that begins to suggest that human history is implicated in natural history. Second, the human interest is not understood to be the only legitimate interest. Third, Human accountability to the environment is part of the text's ethical framework. The last, some sense of the environment as a process rather than as a constant or a given is at least implicit in the text. In such literary work; Cormac McCarthy's The Road the nature as the setting represents ecological changes. Surely, this change causes devastation of earth. Nothing is more miserable on earth but devastation. The world which is the closest place we live at is not convenient again when it was devastated. Thus, literary and environment has interrelation that cannot be separated. Then, it is important to analyze such literary work through Ecocriticism. Ecological issue commonly represented by the presence of natural thing such as; tree, land and also circumstance in the novel which it become the setting. In other word, ecological issue become a centre point of setting. One of great writers in narrating the setting is Cormac McCarthy. Not only known as a king of the setting, McCarthy also has known as famous environmental setting as Addy Haddock (a writer of McCarthy's bibliography) says that his ability to provide eloquent descriptions with smoothly rolling darker undertones and poetically dismal nuances makes him become a writer with powerful setting. Thus, McCarthy is a right author referenced as a study of Ecocriticism. Indirectly, McCarthy's proficient is caused by his settled at a barn near Louisville, Tennessee. All the stones he gathered, all the wood he cut and kiln dried by himself to renovate his small house. Seemingly, McCarthy's life is not far away from the nature. Years later, after marrying fellow student Lee Holleman in 1961, he and she moved to a shack with no heat and running water in the foothills of the Smoky Mountains outside of Knoxville. These experiences of life sharpen his idea toward nature. McCarthy reveals that he is not a fan of authors who do not deal with issues of life and death; it can be assumed that his writing tends to be explored issues of life including devastation of earth. Recalling blithely the months he spent without electricity in a house in Tennessee. Without money, and he had run out of toothpaste and he was wondering what to do when he went to the mailbox and there was a free sample. It made him become more sensitive facing the nature and more respect it. In 2006, McCarthy writes The Road that grants him a change to be interviewed by Oprah Winfrey. Surely, this interview related to his writing especially devastation of earth and won Pulitzer Prize for fiction. McCarthy told Winfrey that related several stories illustrating the degree of outright poverty he endured at times during his career as a writer. He also states that his novel; The Road inspired when he was standing at the window of a hotel in the middle of the night, his son asleep nearby, he started to imagine what El Paso might look like 50 or 100 years in the future. He just had this image of these fires up on the hill. It shows the condition of the nature at the time which the hill was fired up. McCarthy can be categorized as a weird person. People usually gathered with other people who have same hobby or pleasure. However, it doesn't apply for McCarthy. As a writer, he doesn't like to gather with other writer. He would rather hang out with physicists or scientist than other writer. He does not know any writers and much prefers the company of scientists. No doubt if his knowledge of nature is rich. His knowledge of the natural world is vast and includes many of the Latin names of birds and animals. His pleasure gathering with physicists and scientist caused by his interest in science and environment, by absorbing the intelligence scientists, he realizes that in 100 years the human race won't even be recognizable. For him, what physicists did in the 20th century was one of the extraordinary flowerings ever in the human enterprise, which would much prefer to befriend a scientist than another writer. Most of McCarthy's novels are portraying about life or reality which many of them associated to ecological issue. In 1985, Blood Meridian was published. Blood Meridian portrays the desolate and indifferent 1850s Texas-Mexico borderlands. The extreme violence which takes place comments implicitly on both the environment and human nature. The novel's full title- Blood Meridian, or The Evening Redness In The West- is indicative of the novel's portrayal of the environment. A relationship between location, nature and violence is created in the symbolism of the sun as a "blood meridian". To call McCarthy's environments as constructed in Blood Meridian simply violent is an unsatisfactory conclusion. What is more appropriate and evident in the text is that man is inherently violent and the indifference of nature to this creates an amoral setting. In 1979, McCarthy published his fourth novel, Suttree. In short, Suttree tells the reader about a man named Cornelius Suttree, a fisherman, disillusioned scholar, alcoholic, nihilist, existentialist and transcendentalist. The attention to detail identified earlier in Suttree is telling in terms of his relationship with his environment. Generally, to an Ecocritical reading Suttree shows that, stripped of societal anthropocentrism, man is forced to reassess his relationship with nature. It could be said that McCarthy's prose style is often atavistic (anti-civilization, anti-materialism, anti-industrialism, anti-progress and pro-Nature) in that it both reflects natural processes and often appears primitive, stripped of culture. In 1973, Child of God was published. It was inspired by actual events in Sevier County. Child of God begins with Lester Ballard's dispossession from his parent's house. McCarthy's description of Ballard's lone nomadic wandering after he inadvertently burns down his squat uses the same free indirect discourse. Child of God can also be described as an existential text, particularly for the authenticity of its protagonist. Lester Ballard's atavistic tendencies bring him closer to an animalistic level. From those all of McCarthy's novels, The Road which was published in 2006 by Vintage book publisher is the most representative novel which is related to the study of Ecocriticism. The novel is generally thick of environments' issue. The issue for instance is the fire of woods that happened along the country which give the reader an image of burned land, ash and dust everywhere and so on. Because of this reason, the writer felt that The Road is interested to be analyzed through ecological critics. In short, the novel portrays a journey of father and son as the main character in a burned land in America. The issue of devastation of earth becomes the centre point of interest which grasps the whole setting of the novel. The Road brings the readers onto 'the future' in as much as it is set in a time after an ambiguous 'end' has occurred and society has collapsed. The reverse of the most recent reissue claims that it is the first great masterpiece of the globally warmed generation. It is also the first of McCarthy's novels to have provoked Ecocritical study. This wide appeal to the novel relies strongly on its environmental themes. The use of allusion to genre and form elsewhere in McCarthy's novels can be said to universalise his appeal but in The Road the key concern is the 21st century's most immediate global problem; the irrevocable damage global industrial capitalism is doing to our environment. It is difficult to read The Road without feeling the overwhelming cumulative force of the novel's desolation, and this desolation is most prominently present in the landscapes McCarthy portrays. The setting is almost entirely bereft of life; the little that is found is often malign humanity. The Road greatly represents a study of Ecocriticism. It portrays the colourless world because of devastation of earth. This devastation issue is common object of the Ecocriticism study. The Road continually reminds us of the bleakness of the landscape in the earth. As readers, we only experience bright colours through the characters' dreams or memories, if someone happens to bruise or bleed, or through fire or flare guns. The rest of the time we see a gray ash covering the landscape. As a reality, our landscape is actually green and natural. However, The Road shows the possibility of devastation of earth when humans did devastation to the nature and they can't live in harmony with the nature. Therefore, there is no doubt that The Road becomes the most influencing novel toward environment. It proves from the acclaim written in the novel by George Monbiot, an environmental campaigner that says "It could be the most important environmental book ever. It is a thought experiment that imagines a world without a biosphere, and shows that everything we value depends on the ecosystem." According to the brief story in background of the study that gives perception about the devastation of earth in the novel, it appears two questions as the problems: 1. How is devastation of earth depicted in Cormac McCarthy's The Road? 2. How does devastation of earth give impacts to the main characters in Cormac McCarthy's The Road? METHOD The used method is descriptive quality; it means the quality of the data becomes the reference to work rather than the quantity of the data. Besides, a technique is needed to understand the data. Technique of interpretation must be used to interpret and analyze the data. Through interpretation the analysis can be worked. Interpretation is a crucial step that has to do before analyzing the data. Then, extrinsic approach is used as an approach toward the analysis in which environment belongs to it. According to method above, the first thing that has to do is collecting data. In collecting data this research focuses on reading and documentation. Reading novel. In this step, novel becomes the object of the research. The novel is entitled The Road, written by Cormac McCarthy. To collect the correctly data, it needs reading more than once, because to get interpretation, it needs understanding all contents completely with all possibilities both intrinsically and extrinsically. Inventorying data. This step is collecting data through noting the quotations related to the statement of the problems and objectives of the study, it is including in words, sentences, and discourse that can represent devastation of earth in Cormac McCarthy's The Road. Thus, all data that will be analyzed are started and sourced through the novel's contents. Classification data. It is appropriate to the statements of the problems about devastation of earth in Cormac McCarthy's The Road. Tabling the data. It is to simplify reading the data and classify data that is used in the analysis for the readers. Continuously, the selected data or the collected data, which are related to the statements of the problems and the objectives, are analyzed through Ecocriticism in depicting the devastation of earth and its impacts to the main characters in Cormac McCarthy's The Road. MODERNISM The word "modern" closely means to up-to-date, abreast of the times, and going beyond the past in more than a temporally or chronologically literal sense (Greenberg, 1979; 2). Marshall Breman as quoted Jan Rada defines modernism as a trend of thought that affirms the power of human being to create, improve, and reshape their environment, with the aid of scientific knowledge technology and practical experimentation (2008; 6). Breman then argues that modernism is as any attempt by modern men and women to become subjects as well as objects of modernization, to be modern is to find ourselves in an environment that promises us adventure, power, joy, growth, transformation of ourselves and the world-and, at the same time, that threatens to destroy everything we have, everything we know, everything we are (Berman, 1982; 5; 14). The development of modernism emerged two poles that confront each other; science and technology and natural degradation. As Helena J. Keler explanation that the image of 'creative destruction' is very important to understanding modernity precisely because it derived from the particular dilemmas that faced the implementation of the modernist project. This destruction of a holistic universe in the modern era shatters the conception of human beings and societies as total entities, instead inaugurating an era characterized by a never-ending process of internal ruptures and fragmentations within itself (Keler, 2005: 4). According to Horkheimer and Adorno as quoted by Helena, modern capitalist society is engaged in a pattern of domination: the domination of nature by human beings, domination of nature within human beings, and this system of domination is driven by fear of the human and nonhuman unknown the Other (Keler, 2005: 3). Movement of modernism manifests itself in the self-destructive nature of symbolism: when pushed to its logical extreme, the symbolist aesthetic starts to forgo any notion of an organic, necessary relationship between signifier and signified, and simply imposes a particular motif as an arbitrary symbol of something else (Hutchinson, 2011; 58). Modernism often demonstrates the destructive rather than constructive nature. Modernists argue that the ecologically destructive projects are not viable because of climate change but modernism movement (Johnston, 2012: 207). Specifically, Barbara Rose Johnston states that Human conduct that contributes to the destruction of our ecological balance. Such interpretations of environmental change, however, can have undesirable effect of deflecting responsibility, since blame is placed on a cycle of time about which a person can do nothing (Johnston, 2012: 212). Global environmental change, which spans natural sciences, policy and development studies, is currently experiencing its first waves. Perhaps it is time to recognize that already some people are getting their feet wet. On what criteria should one decide to retreat to higher ground or stick it out unmoved until the tide turns. Modernism challenges the modern project of understanding global environmental change and doing something about it when it causes problems (Blaikie, 1996: 81). According to Piers M. Blaikie, modernism First, it challenges all embracing world views or 'meta narratives' which tend to be highly teleological and assume the validity of their underlying assumptions and their claims. Thus, the role of environmental scientists in policy making as 'talking truth to power' and as the only rational and legitimate brokers between the 'real' environment and the rest of us, is rejected. Second, it challenges the tendency that is more pronounced in areas of global environmental change where the local hands on experience of the environment (land degradation, desertification and biodiversity). Third, it challenged that reality is socially constructed. An epistemology which builds models of society and environment with causal connections is challenged by one which is constituted as a series of descriptive accounts according to different actors' perceptions (Blaikie, 1996: 81). Modernism encourages people and countries to over-exploit natural resources, and contribute to reductions in spending on social and environmental welfare (Huckle, 1999: 36). Moreover, environmental reductions being blamed on the impact of foreign cultural domination this has allegedly eroded and damaged the 'essential harmony' between humans and nature (Mawdsley, 2001: 96). Evernden contends that the second instrumental vision of control and domination over nature is the historical product of modernity, more specifically of Renaissance, when a new mode of knowledge, based on reason and experimentation replaced the medieval search for knowledge as contemplation and wisdom (1992). This argument is supported that Modernity is thus responsible for creating Nature by abstracting from nature, and with it a whole history of conquest and domination comes to be enacted. In the words of C. S. Lewis: "We reduce things to mere Nature in order that we may "conquer" them. We are always conquering Nature because "Nature" is the name for what we have, to some extent, conquered" (Lewis, 1978: 42). Latest, Environmental problems and other risks encompass less than the globally catastrophic. More and more disaster experts, development agencies, and citizens' groups are supporting that the globalisation is largely responsible for such human misery (Huckle, 1999: 36). Modernism signed by the development science and technology (Somerville, 2006: 17-18). Further, given the increasing production by technologically advanced capitalism of risks that threaten us all ironically that technology induced catastrophes and environmental disasters (Simon Cottle, 1998: 8). Since the Enlightenment, technology, especially science-based technology, has offered the promise of a better world through the elimination of disease and material improvements to standards of living. On the other hand, resource extraction, emissions of dangerous materials, and pollution of air, water, and soil have created conditions for unprecedented environmental catastrophe and have already caused irreversible damage to the biosphere (Vergragt, 2006: 7). Ironically, the persisting contradictions between a better life created and supported by technology for the wealthy few, also caused the increasing environmental degradation and persistent poverty for the vast majority calls for a deeper exploration and understanding of the nature. Philip J. Vergragt then, states that technology will support and enhance a "good life" for all of its citizens, in both rich and presently poor countries, without compromising the Earth's ecosystem or the prospects of later generations (Vergragt, 2006: 8). Thus, science and technology which shaped to the sophistication give man a power to colonize the earth. POSTCOLONIALISM Environmentalism in post-colonial discourse has its beginnings in Alfred Crosby's account of the impact of European incursions into the Americas and the Pacific (Ashcroft, 2000: 71). This incursion of course destructs not only the country; physical building and ideology but also the environment and nature. The conquest and colonization of so many extra-European environments produced irreversible changes in land use, in flora and fauna and frequently damaged beyond repair traditionally balanced relations between indigenous communities and their environments, a relationship unlike that of their conquerors crucial to their understanding of their 'being' as of the land rather than merely on it (Ashcroft, 2000: 71-72). He adds that imperial incursions and colonization have been regarded as environmentally destructive, yet as Richard Grove argues, the perception of what had already been lost in Europe, the sense of intrinsic connection between the 'more-than-human' and the human, and thus the urgency of environmental preservation became strikingly evident in Europe's colonies, particularly in the late nineteenth century. Much environmentalism in theory and practice has emanated from former imperial centres such as Europe and the United States. While belated recognition of the crucial importance of other forms of life on earth is both welcome and necessary, its export and sometimes imposition on postcolonized cultures invites the obvious charge of hypocrisy and generates resentment against former imperial states which having degraded their own and their colonies' environments in the 'interests' of progress and 'development' now encourage (or impose) the theory and practices of environmental preservation on other peoples (Ashcroft, 2000: 72). This also frequently creates division within post-colonized cultures themselves, where, for instance, peoples are moved off their traditional lands to make way for game parks, essentially for the benefit of wealthy tourists. Demands for the 'global' preservation of endangered species frequently clash with the policies of post-colonized governments eager to use their regained environmental sovereignty in the interests of a modern capitalism from which it is difficult for them to escape. Devastation of earth has highlighted how human–environmental vulnerabilities are amplified not only by anthropogenic climate change but also by the capitalist exploitation of natural resources (Carrigan, 2005: 1). Harmful environmental conduct exposes several broader dimensions such as the nation's ability to use its resources as determined by domestic political processes, such as; it changes the natural forest microclimates that have been transformed into new microclimates increasing sunlight and lowering humidity (Nazzal, 2005: 6). The ecological crisis is not merely an isolated event but has its roots in the modern materialistic civilization that makes man becomes the butcher of earth (Huggan and Tiffin, 2010: 1). They argue that one way out of this morass is to insist that the proper subject of postcolonialism is colonialism, and to look accordingly for colonial/imperial underpinnings of environmental practices in both colonising and colonised societies of the present and the past (Huggan and Tiffin, 2010: 3) Colonialism greatly changed the environmental condition of colonized country. Alfred W. Crosby (Crosby 1986) as quoted by Aschroft describes the ways in which the environments of colonized societies have been physically transformed by the experience of colonial occupation, imperialism/colonialism not only altered the cultural, political and social structures of colonized societies, but also devastated colonial ecologies and traditional subsistence patterns (Ashcroft, 2000: 69). Indirectly, colonization influences ecological changes in the past which cause ecological destruction in the present day. More importantly, based on Crosby statement in Aschroft explain that introduced crops and livestock not between colonizer and colonized country only supported conquering armies and colonizing populations, radically colonizer altered the entire ecology of the invaded lands in ways that necessarily disadvantaged indigenous peoples and annihilated or endangered native flora and fauna (2000: 69). Arguably this has led to one of the most profound ecological changes the world has seen. Colonization or colonialism can be defined as the conquest and control of other people's land and goods (Loomba, 2005: 8). Colonialism means a conquest which is done by the west or European and American country toward Asia and Africa by exploitation the land, surely it causes natural destruction. Elleke Boehmer has defined colonialism as the settlement of territory, the exploitation or development of resources, and attempts to govern the indigenous inhabitants of occupied lands (Boehmer as qtd. in McLeod 2000: 8). The term colonialism is important in defining the specific form of natural exploitation that developed with the expansion of Europe over the last 400 years (Ashcroft, 2000: 40). With the end of the cold war, global infatuation with neoliberal economics has intensified the peripheralization of the South along economic, political, social, cultural and natural lines (Geeta Chowdhry and Sheila Nair, 2002: 1). Postcolonial critique bears witness to those countries and communities - in the North and the South (Bhabha, 1994: 6). The assumption of postcolonial studies is that many of the wrongs, if not crimes, against nature are a product of the economic dominance of the north over the south (Young, 2001: 6). Thus, the Norh represents the West and the South represents the East. Postcolonialism sees the natural destruction on the South as the impacts of colonization The northern environmentalism considered as the rich (always potentially vainglorious and hypocritical) and the southern environmentalism considered as the poor (often genuinely heroic and authentic) (huggan and Tiffin, 2010: 2). However, northern needs of the natural need were supplied from the south in the name of colonization. Colonialism granted imperial powers the rights to arrogate and exploit the territory of a subject people as well as to appropriate unlimited property rights, post-colonial states acted quickly to regain control over their natural resources both through expropriation of foreign property interests and through the legal arena (Nazzal, 2005: 10). Colonialism, through both practice and discourse, has separated man from his natural surroundings and has given him a false idea about the meaning of nature: on the contrary, nature is not there to be plundered, but to be cared for, tended and made to yield its produce. Then, Man is ennobled by the relationship with the environment, by his power to make things grow and watch over their growth, but the reverse also holds true: devastation returns man to his primitive condition. It is not surprising when the the nature did reverse destruction to the humans. It is the result of what they do exploit to the nature. On the other world, man as the colonizer has colonized the earth which caused the devastation of earth. (Chrisman and Williams, 1994: 1–20). Thus, postcolonialism can be considered as umbrella term of ecocriticism in which it criticizes the relation between human and nature including criticizing humans' behaviour precisely humans' exploitation toward nature. ECOCRITICISM Humans truly can't be separated with environment. human beings are engaged in the eternal search for connection, for that which connects us to others and for that which connects us to ourselves, culture, language, history, belief systems, social practice, and other influences on human development are as much a part of place as the physical landscape one crosses (Dreese, 2002; 2-3). She emphasizes that environmental factors play a crucial role in the physical, emotional, and even spiritual configurations that determine our ideas of who we are. All human beings develop their own sense of place through life that determines why they love certain regions or feel utterly alien in others. The study of relations between humans and environment called ecology. Lawrence Buell defines ecology as the study of the interactions between organisms and the environment (Buell, 2005; 139). Meanwhile, Glen A Love defines ecology as not as merely a study of the relationship between organisms and their living and nonliving environment but also a combination of science and a sense of responsibility for life (2003; 37-38). Ecology as Lawrence Buell say above is drawn in the life circle; the life processes of many organisms put into their surroundings environment whose presence of other organism affects the life processes of these and other organisms sharing the same environment. When these processes are cut by such destruction, e.g. chemical by-products of the life processes of one species (or occupational group) are harmful to another species; the relationship between the two species is "antagonistic." Increased population density increases the probability of antagonistic interactions (Catton, 1994: 80). It is essential to be aware of the environmental damage which caused by ecological changes. The development of humans' ecology slowly damages the environment. The ecology of human development involves the scientific study of the progressive, mutual accommodation between an active, growing human being and the changing properties of the immediate settings (Bronfenbrenner, 1979: 21). Imbalance fine relations between humans and environment emerged a critic called ecocritic or ecocriticism (Buell, 2005; 2). John Elder as quoted by Dana Philip says that The science of ecology confirms the indivisibility of natural process: each feature of a landscape must be understood with reference to the whole, just as the habits of each creature reflect, and depend upon, the community of life around it (1999; 581). Ecology when it counts as science tends to be a lot more reductive, thus many of the core concepts of ecology once notable for their expansiveness have in recent years been cut down to size, made more particular, or abandoned altogether. It now appears that even the ecosystem concept may not be valid biologically, but valid concept or not, an ecosystem is primarily a theoretical entity, and therefore could never be the reality that somehow underwrites poetry, even if that poetry is of the good old-fashioned, supposedly "organic" sort (Philip, 1999; 582). By that kind of reason, Elder argues that culture too may be understood organically: it is the field of relationship between organisms and, as such, a complex organism in its own right (Philip, 1999; 582). Ecology is not merely bound to science and technology, but also moral and politic. Greg Garrard assumes that ecology itself is shifting and contested, the emphasis on the moral and political orientation of the ecocritic and the broad specification of the field of study are essential (2004; 4). Problems of ecology are features of our society, arising out of our dealings with nature, from which we should like to free ourselves, and which we do not regard as inevitable consequences of what is good in that society (Garrard, 2004; 5). Lynn white, Jr argues in his article on Cheryll Glotfelty's The Ecocriticism reader: landmark in literary ecology that environmental crisis is fundamentally a matter of the beliefs and values that direct science and technology and dominating attitude toward nature (1996; 4). Discoveries in ecology and cellular biology revolutionize our sense of self, teaching us that there is no such thing as an individual, only an individual-in-context (Neil Evernden, 1996; 93). Discoveries of course get much of invention. Unconsciously, humans' behaviour (ex: exploitation) toward environment was changed. Industrial Revolution affected humanity's conception of its relationship to nature, warning that technology has created the false illusion that we control nature, allowing us to forget that our "unconquerable minds" are vitally dependent upon natural support systems (Harold Fromm, 1996; 31) Ecocritic or Ecocriticism is an umbrella term, used to refer to the environmentally oriented study of literature and (less often) the arts more generally, and to the theories that underlie such critical practice (Buell, 2005; 138). Cheryll Glotfelty simply writes the definition, ecocriticism is the study of the relationship between literature and the physical environment, ecocriticism takes an earth-centered approach to literary studies (1996: xviii). Ecocriticism might succinctly be defined as study of the relation between literature and environment conducted in a spirit of commitment to environmental praxis (Lawrence Buell as quoted by Dana Philip, 1999; 583). Ecocriticism is, then, an avowedly political mode of analysis, ecocritics generally tie their cultural analyses explicitly to a 'green' moral and political agenda. In this respect, ecocriticism is closely related to environmentally oriented developments in philosophy and political theory (Greg Garrard, 2004; 3) Ecocentrism is more compelling as a call to fellow humans to recognize the intractable, like-it-or-not interdependence that subsists between the human and the nonhuman and to tread more lightly on the earth than it is as a practical program (Lawrence Buell, 2005, 102). Ecological criticism shares the fundamental premise that human culture is connected to the physical world, affecting it and affected by it. Ecocriticism takes as its subject the interconnections between nature and culture, specifically the cultural artefacts of language and literature (Cheryll Glotfelty, 1996; xix). The majority of ecocritics, whether or not they theorize their positions, look upon their texts of reference as refractions of physical environments and human interaction with those environments, notwithstanding the artifactual properties of textual representation and their mediation by ideological and other socio-historical factors (Lawrence Buell , 2005; 30). Literary theory, in general, examines the relations between writers, texts, and the world. In most literary theory "the world" is synonymous with society-the social sphere. Ecocriticism expands the notion of "the world" to include the entire ecosphere or nonhuman, which is physical environment. Several things that have to be seen are: • Transforming this concept becomes social movement that will bring the humans into conscious of the equality between human and their environment and doesn't consider the nature into binary opposition between dominate and dominated. • Ecocriticism encourages the changing of canonisation through entering literary works which carry up natural issue. • Ecocriticism is not only an approach but also a pendadogis tool. • Ecocriticism connects the literary study with the earth to see how is the relation between humans and earth where they stand (Cheryll Glotfelty, 1996, xxii) The majority of ecocritics, whether or not they theorize their positions, look upon their texts of reference as refractions of physical environments and human interaction with those environments, notwithstanding the artifactual properties of textual representation and their mediation by ideological and other sociohistorical factors (Buell, 2005; 30). It can be assumed that Ecocrtiticism sees the text as the refraction of physical environment. Another denigrates attempts to recuperate realism as restricting the field of environmental writing, as ludicrously foreshortened in focus ("its practitioners . . . reduced to an umpire's role, squinting to see if a given depiction of a horizon, a wildflower, or a live oak tree is itself well painted and lively"), and in any case bogus, since "mimesis presumes the sameness of the representation and the represented object" (Phillips 2003: 163–4, 175). Buell has added that this is a conviction that contact (or lack ofcontact) with actual environments is intimately linked, even if not on a one-to-one basis, with the work of environmental imagination, for both writer and critic (Buell, 2005; 31). Ecocriticism can explore what we can call a discursively manipulated nonhuman world in literature, and discuss how it gets marginalized or silenced by, or incorporated into the human language (Legler, I997: 227). Nonhuman environment must be represented as an active presence and player within the text made some astute readers inclined to be sympathetic of the environment (Buell, 2005: 51). The task of ecocriticism, then, is to formulate a conceptual foundation for the study of interconnections between literature and the environment. Literature can be perceived as an aesthetically and culturally constructed part of the environment, since it directly addresses the questions of human constructions, such as meaning, value, language, and imagination, which can, then, be linked to the problem of ecological consciousness that humans need to attain. Within this framework, ecocritics are mainly concerned with how literature transmits certain values contributing to ecological thinking (Glotfelty, 1996: xxi). Ecocriticism offers researcher a way how to analyze such literary work through three steps. First is seeing the representation of nonhuman aspect. This first step is looking how is the nature like rice field, village, wilderness, forest, sea, beach, hill, mountain, valley, river, animal (or treatment toward animal) and city environment pictured in the text. Second is seeing the accusation toward ecology issues. The second step destructs how the natural issue is portrayed with the different way. For instance, the nature is pictured as an inconvenient place again for humans because of the emergence the new value; technology, capitalism, extinction of local knowledge, and development of building which is not oriented to the environment. Last is taking part of text's ideology. In this case examines the relations between writers, texts, and the world. This third step is seeing and taking part of the ideology that contains in the text. How the author's view and commitment toward the nature (Cheryll Glotfelty, 1996, xix). DEVASTATION OF EARTH Those all theories mentioned above are related to the word "devastation" which happened on earth. Modernism granted colonizer a power to devastate the earth in which postcolonialism and ecocriticism tend to criticize that devastation. Certainly, what is actually the meaning of devastation of earth? The word "devastation" itself according to Merriam-Webster dictionary means the state or fact of being rendered nonexistent, physically unsound, or useless. In other word, devastation is deterioration, destruction, vanishing of the earth through depletion of resources such as air, water and soil. Devastation of earth can be defined as a destruction of ecosystems and the extinction of wildlife. Devastation of earth is a term used to describe a situation in which a part of the natural environment (the earth) is devastated or damaged. According to Shakhashiri, earth is areas of land as distinguished from sea and air (2011: 1). It means that the earth is composed by three parts; land, sea and air. Thus, it can be ascertained that if the devastation happened on earth, it will strike those all of earth's parts. The devastation which strikes the air will harm the condition of air in the atmosphere or known as devastated atmosphere, devastation which strikes the land will harm the condition of the soil and change it into erode and barren, and devastation which strike the water will contaminate the clean water into the dirty one. The earth as mentioned above that composed from three parts; certainly those each parts have a role. Land is the surface of the earth where the creatures are growing and developing; the plantations (trees) grow well, the animals breed and the humans dwell the life. Air is the mixture of gases which surrounds the Earth in which it contains a lot of vital substances such as oxygen and ozone. And water is a clear liquid, without colour or taste, which falls from the sky as rain and is necessary for animal and plant even human life. Water is also available in the river and sea. All of those parts of the earth greatly have advantage when it states in the normal/natural condition. However, when it was devastated, the earth turns into less natural and more miserable. That is the picture of the devastation of earth. DEPICTION OF DEVASTATION OF EARTH The devastation of earth as Hughes says has happened in every historical period and in every part of the inhabited Earth (2001: 1). It means that devastation of earth happened in the whole surface of the earth. Devastation has stroked the whole environment; atmosphere, land, and sea. Postcolonialism argues that colonialism has an intervention on devastating the earth. Colonialism has devastated the earth as Ashcroft says that the conquest and colonization of so many extra-European environments produced irreversible changes in land use, in flora and fauna and frequently damaged beyond repair traditionally balanced relations between indigenous communities and their environments (2000: 71-72). He adds that imperial incursions and colonization have been regarded as environmentally destructive. Devastation of earth happened over earth. It means that devastation happened on land, atmosphere and sea. The land has changed into gullied, eroded and barren. This changing surely as the impact of devastation of earth which is done by the colonizer in colonizing the land. Everything which stands on the land has changed, There was no reborn flora and fauna in McCarthy's The Road. However, the presence of the flora and fauna is the rest of the previous world. Indeed these flora and fauna have changed as the impact of colonialism. Flora in McCarthy's The Road is dominated by the trees. However, most of the trees have changed into gray, dark and black. It is so pathetic when the father and his son faced the standing black trees and they realized that it changes. Horribly, it seems like ghost of trees. The changing of the trees is not underlined on the changes of its colour but also its presence. It means that the trees are not only changing into dark and black with its standing but also there are many trees which die and fall to the ground. The changes of fauna can be seen when the father and his son was camp in the forest and listening for any sound, it draws that the bird has changed its behaviour by holding migratory to circle the earth. The birds can no longer life in harmony with the environment by occupying the forest. It is caused the changing of trees which turn into dead. Thus, it forces the birds to change themselves. Other fauna changing draws when the father who found an odor of cows. However, the cows are extinct since years ago. He asked to himself whether the cows are really real or not. He finally realized that it is extinct. It shows that the cows are changed from the presence to absence. The burning of a certain thing; such as the trees, surely produces a residue or combustion. It can be carbon and ash. It can be imagined how large the amount of ash will be produced if the whole land of forest were burned. Certainly, the ash will cover everything that has seen. A horrible fire of forest has produced a horrible ash too till everything is covered by ash. The ash has moved along the wind till it covered the city and everything in the city, The fire of forest makes the amount of ash become uncontrolled. The moving of ash filled the air and atmosphere in which it makes everything coloured covered by ash and dust. Hence, everything becomes colourless. The ash changes the landscape become gray. It can be assumed that the graying landscape is no other causing by the moving ash. The occupying of ash in the atmosphere makes the day become unseen and dark. The result of the residual combustion is not ashes merely, but also carbons that harm the environment. Ash and carbon both fill and occupy the atmosphere. As the greenhouse effect idea, that the ash and carbon also dust which in a large amount and uncontrolled in atmosphere will form a mantle which wrapped out the whole of earth. This causes our sight of the sky become dark and gray.The sky and cloud are devoured with ash. The cloud becomes ashen and gray. Severity, the ash and carbon have contaminated everything in the air including the sea water vapor. Then, the result is clouds of ash. Ash and dust have affected the form of the cloud to become gray. Probably its content has been also affected. When the clouds changes into gray, it can be predicted that the rainwater which come down from the clouds will also be gray. It is supported with the presence of the ash mantle that wrapped up the earth. Certainly, everything which come down from the sky; rainwater has to pass this mantle, consequently the rain water will be coloured as gray by the ash mantle. The ash mantle has coloured the rain water. The rainwater which drips down to the earth is seen as the gray sheets of rain. Rainwater that is usually used by humans to fulfil their needs such as to irrigate the fields has been contaminated by ash and carbon so that its contents no longer can be used for the benefit of man. Consequently, there will be no crops and there will be no natural food. Mantle of ash has blanketed the earth during the unknown time. As described above that everything which fell from the sky will pass this mantle so that everything will be contaminated by it. The result, everything which fell will be gray. After several days the father and his son watched the gray sheets of rain, the weather quickly changes into snowy. Everyone knows as it has seen that snow is falling from the sky. The snow actually is similar to the rain, including their formed and their fell. The sea water vapor which is formed into cloud in the sky will fall as the rainwater, however, because of the extreme/cold weather, the rain water freeze into ice and it changes into snow that is white and soft. This falling snow of course has to pass the mantle of ash and it changes into gray. The next devastation of earth is turned to everything which lay on the surface of the earth covered by darkness as the ash effect. Everything stands in the earth turned to be black such as the dead trees which burned by fire forest, and the rain water and snow which fell as gray turn into black in the land. The dead trees which burned by fire forest surely create a black view of trees. The trees which burned in incompletely will make an appearance of burnt and black trees. The rainwater and snow which are grey in their falling turned to be black in the land. The large number of those rainwater and snow gathered as one in the ground create a new colour, more intense and black. The gray flakes which fell down turned to the dark slush. Dark slush can be assumed as the slush which is thicker than a flake. Thus, the slush which is as the result of flakes changes into black. It is also applied in the rainwater; the water in the land is not the whole from the rainwater, some from the river and so on. However, the thick rainwater which fell down in gray proved that its water is dominated to black water. the slush which is melted flows through the ash and turned to the black water. THE IMPACTS OF DEVASTATION OF EARTH ON FATHER'S ATTITUDE Living and dwelling in such devastated earth surely give impacts to the humans who walk over it. The father and his son reveal those kinds of impacts. The father who lived before and after unknown disaster seems undergoing a lot of impacts. It is different with his son who born after that disaster. He tends to be innocent, only watch and observe what his father did. There was an idea to end the life when the father still lived with his woman. She always forces him to end their life because there was nothing else to do in the ruined world. However, the father keep his believe that humans have to struggle. The experience of dwelling the life before the unknown disaster made him stronger. The father realized that what the environment did to him is the result what the humans did to the environment, as Lawrence Buell says that human culture is connected to the physical world; nature and environment, affecting it and affected by it. In other word, humans have affected the environment and have been affected by environment. The woman forces him because they lived in unusual life, they lived like zombie. The devastation of earth causes their life as like as zombie or walking dead in a horror film which the father and his son have a role as the victims. They have to avoid even to face the zombie to keep alive. Dwelling the life in such devastated earth; the air was filled by the ash and dust forces them to wear a mask. The devastated earth; unfriendly air forces him to wear mask (canister mask) and even wear biohazard suit. As the affection of the devastated earth, the father and his son have to worry their life, Mostly he worried about their shoes. Worrying is something that the father in his son has to do. There is no certainty living in such ruined world. It is a common thing for them to worry anytime, worrying of food and shoes. Food is essential thing to keep alive. It is the reason why they worry of food. If they can't find some foods, it means they will die. The shoes are important stuff to hold a journey. As explain before that the weather extremely changes a while. Few days were raining, and another was snowing. Shoes keep the father in his son feet to keep away from coldness and freezing which can take their life. The weather is extremely cold. It is not surprising that the weather turns to colder and colder. The weather has changed anytime; sometime it rains and often snow. The coldness of weather doesn't only force them to eat the food that already fermented as above but also threaten their life. The coldness is very extremely danger for them. Moreover it is pictured that the cold can crack the stone and takes their life off. In such condition surely makes them hard to breathe because in the coldness the air contains thin oxygen. Dwelling the life in such devastated earth actually makes him aware of surrounding even the weather. The sounds like forest fire, fallen trees, and so on makes his ears disturbed and consequently he has to keep awake. Living in such devastated earth makes him to be more aware toward everything that threatens them. The father and his son have experienced many kinds of problems. Everything that happened to him does not break his spirit to keep alive even when they are in starving. He always believes that he would find something to eat. the father always optimistic dwelling life. the devastated earth makes him become more optimistic. Struggle is a must to do to find another thing to be eaten to keep the life. Keep trying is the key for the good guys who living in the ruined environment. By keeping trying, they can survive dwelling the life in such environment. Keep trying is not enough to live in such devastated earth. Always suspect the possibility that may happen has to be done, because no one knows what will happen, but the threat of nature always happen all the time. Thus, another thing that has to do is to remain vigilant about the environment. The devastated earth forces him to become "cautious, watchful" and always "on the lookout". He believes that no one expect a trouble. However, living in the devastated earth, the thing that has to do is to always expect it. Thus he was always wary of something bad that may happen. Nothing can be expected from the nature. The father always believed it. He no longer agrees if people prepare something for tomorrow. Although he always optimistic of what he did, he never believed it. For him, even though he's preparing for tomorrow, he doesn't believe that the nature will prepare for him. What the father believes that is now or tomorrow is the same. This belief keeps the father spirit to face his following days. As a father he would often feel the pain. Physically, he is ill of facing the devastated earth. And mentally, he is ill of the feeling of bearing the responsibility as a father who is responsible for the survival of his son and his own life. However nature should never take the life of his son. He would bet his life for the life of his son. Often he complains to himself about his illness. He pretends as tough man in front his son but actually he felt tremendous pain. It's just that he does not want his son to know. THE IMPACTS OF DEVASTATION OF EARTH ON SON'S ATTITUDE Being born in the devastated earth which the unknown disaster has swept it surely affects the son's behaviour toward environment. The greyscale image of environment has saved well in his mind that forces him to expect something else, something in colour. When they continue their journey, the son had found some crayons. These crayons change his mind that something left on earth in colour. Thus, environment is not filling of gray merely. The crayons seem like a hope for
Issue 12.3 of the Review for Religious, 1953. ; Bellarmine and t:he Queen ot: Virgins John A. Hardon, S.J. ST. ROBERT BELLARMINE is widely known in theological circles as the great champion of the Papac, y. At the Vatican Council, h~s Controoersies.were the principal source from which the assembled fathers formulated the definition of papal infallibility. An.d in 1931, when the Holy See declared him a Doctor of the Church, he was described as "The Prince of Apologists and Strong Defender of the Cathoiic Faith, not only for his own time but for all future ages." But Bellarmine has another title to glory, seldom pointed out, which should endear him in a special way to priests and religious who are directors of souls. St. Robert was for years the spiritual counsel-i " lor and confessor of St: Aloysius Gonzaga, to the day of the latter's death in 1591. So attached was Bellarmine to his spiritual son that he was largely responsible for his early beatification, which he lived to see, and asked to be buried near the body of his "caro Luigi" as a perpetual remembrance of their mutual affection. Pope Benedict XV was sufficiently impressed by this circumstance that he proposed, "for the imitation of confessors, the prudence of that 'wisest of spiritual directors, Robert Bellarmine, who moderated ev'en the' penitential ardor of St. Aloysius Gonzaga." St. Aloysius is the heavenl~ patron of Catholic youth, ahd the chosen exemplar of heroic chastity. We should 'not be surprised, therefore, if his spiritual director was personally so much devoted to the Immaculate Mother of Virgins that be drew from her life and example the inspiration which he transmitted to Aloysius. Bellarmine once wrotethat, "Every great man in the Church has been most de-voted to the Blessed Virgin Mary: Ephrem, Bernard, Dominic, Fran-cis of Assisi"--and we may now add, as the following sketch will show, Robert Bella~rmine, the spiritual father of Aloysius Gonzaga. Bellarmine's Personal Devotion to the Mother of God . St. Robert w~is devoted, to the Blessed Virgin fr6m his earliest years. According to his schoolmate, later Canon Vincent PatiucheIli, as a young boy Bellarmine used to recite daily the Office of the Bles- 113 JOHN A. HARDON sed Virgin, often in company with Vincent as the two of them walked slowly ~long the road. Bellarmine retained this custom of reciting the Ottice of Our Lady throughout life. In the same way he kept the custom to his old age of ~aily saying the Rosary. ,~Iexander Jacobelli, who was the cardinal's almoner for twenty years, testified at the beatification process that, "He ~never omitted saying the ~OfIice and thd Rosary of the Blessed. V!rgin Mary, during which he. was often found melted in tears." " HOwever, Robert .was not satisfied with only a single recitation of the.Rosary. The beads were Iite~a!ly his constant companion. In the words of his chaplain, "when fatigued with study, Bellarmine would find recreation in reciting the beads wiih uncovered head:'.' And again, "his relaxation was to say the Rosary of O~r Lady.". On his frequent journeys as Archbishop of Capua, attendants noticed that he always followed the same "ritual: celebrate Mass, say the Itinerarium,' and, rosary in hand, enter the carriage for the journey. Juan de Serayz, a close friend of Robert, has left some interesting details on bow Bellarmine would say.the Rosary. It was June 14, 1618, the feast of Corpus Christi, th~it Bellarmine and Juan were returning from a procession at St. Peter's Basilica-. "As we got int9 the carriage," relates Juan. "he told me that he was ablb to say the third part of the Rosary exactly three times, from the time the pro-cession left the Sistine Chapel to where it finally ended at the Altar of Exposition in St. Peter's When I asked him, out of curiosity, hbw he said the Rosary, he told me that he separated the decades of the Angelic Salutation with an Our-Fathe.r, adding to eacB decade a short prayer corresponding to the different mysteries, .and preceding the decades with a short meditation on the following mystery. Then with emphasis he said that he recited the Hail Mary's sJow.l~l, s!owl~l. When I observed that this did not leave much time for keeping his partner company, he answered that during the whole procession he did not say a single word to his~ cardinal companion." We can understand, therefore, how painful were the doctor's Or-ders during Bellarmine's last illness, when he was forbidden not only to say the Breviary but also the Rosary. . For, as his brother explained, the doctor knew with what ardor and devotion he applied himself to these prayers: Finally, the doctor was moved by ~he dying man's pleas an.d mitigated the orders first given to the servant, allowing'the sick man "a moderate use'of the Rotary," although everyone knew that, "his intense application to this prayer would'be a great strain 1!4 'Ma~/, 1953 BELLARMINEAND MARY upon him." To the Office and the Rosary, Bellarmine added the Saturday fast in Mary's honor. He fasted th'ree days a week with the same. rigor that he kept the Lenten fast, that is, most strictly. According.to a syllogism which he wrote on the subject, he argued in this way: Our justice should be greater than that of the Pharisees. Matt. 5/20. But the Pharisees fasted two days a week. Luke 18/12. Therefore, I should fast at least three days a week! So besides the fasts for the vigils and the Lenten fast, and besides the whole of Advent, he kept a sacred fast on Wednesday, Friday, and Saturday of each week. That he kept the Saturday fast in honor of Our Lady is clear from the Sermon which he gave on one occasiofi for the feast of the Immaculate Conception, when he said that among the practices most pleasing to the Blessed Virgin and her Divine Son, and most useful to grow in their, love and friendship, is the daily recitation of the Rosary and the Saturday fast in Mary's honor. It was only under express orders,from hi~ confessor ~o fas~ only twice~a week, that in his old age Bellarmine relinquished ~he Saturday fast. Bellarmine and the Immaculate" Conception According to available evidence, Robert Bellarmine was the first bishop of the Catholic Church to have formally petitioned the Holy See for a definition of the Immaculate Conception. It was made while he was serving as cardinal member, of the Congregation of the Inquisition. The petition is dated August 31, 1617, and carried two main questions: Is the Immaculate Conception of the Blessed Virgin definable doctrine; and is it expedient at the present ,time to define this doctrine? Then follow three thousand words of careful theoiogical exposition and answering of objections, calculated to break down the resistance of ~ertain critics in the Roman Curia. One of the reasons whch Bellarmine gives in favor of the defini-tion is especially revealing. "It is possible," he says, "for a mere creature to be without an~i sin. Such, .for example, a~e the good angels in heaven. Consequently, the ~ame must be true of the Virgin Mother of God, who is more .pure than the angels. Otherwise she would be less pure than the angels, at least by the presence of sin. For tru.e purity consists of two qualities: absence of sin and nearness to God." The point is that if Our Lady is more pure than the angels in closeness to God, which all admit, then she is also as pure as they 115 ,JOHN A. HARDON Review for Religious in the absence of sin, since purity comprehends both qualities with-out discrimination. St. Robert's devotion to the immaculate Conception is also at- . tested by the number of sermons which he preached on this preroga-tive of the Mother of God. Besides other testimony, there are two extant letters which Bellarmine wrote on the subject i one in 1617 to an English priest, and another in 1618 to Philip III of Spain, in both of which he promised to do everything in his power to promote the defense of the Immaculate Conception. Juan de Serayz, previously quoted, testified at the Beatification Process that Bellarmine bad a singular devotion to the Immaculat~ Conception. After this general statement, h~ added that, "his de-votion was manifested in all the Roman Congregations on which the Cardinal served. And relative to. this question, he often told me that he would not rest until the doctrine was defined. ' 'There is no. need of convoking a General Council in this matter,' he said, 'since the Pontiff can easily pronounce the definition by means of a papal b~ll.' " It is significant that when Pius IX defined the dogma in 1854, he did so without convoking a General Council and by means of a papal bull, exactly as BeIlarmine had suggested. It was Bellarmine's mind that the definition of the Immaculate Conception in his own day was not only opportune but even neces-sary, as he wrote to King Philip, "to remove the terrible scandals which are daily committed against the 1donor of God and with such danger to the the souls of the faithful." Only two months before his death, Bellarmine was still 'urging the cherished definition. On August 1, 1621, says the chronicle,. St. Robert engaged the Holy Father in a long conversation, and frankly told him that if he were Pope he would not hesitate immedi-ately to define the Immaculate Conception, s~eeing no obstacle what-ever standing in the, way. st. John Berchmans died on August 13, 1621. Shortly after his death, Bellarmine heard of the vow which John had made, signed with his own blood, and declaring: "I, John Berchmans, unworthy son of the Society of Jesus, promise thee and thy Son . . . that until death I, will ever declare and defend thy Immaculate Conception." When the aged cardinal was informed of this "fact, he exclaimed: "What a marvelous act of devotion! What aningenious expression of love, written in his own blood! What he says is most certainly true; I am sure he was inspired to this action by Our Lady herself. 116 MaR, 1~53 BELLARMINEAND MARY For just now in Flanders, while others ,are attacking Mary's honor, this young man from Flanders has been chosen by the Mother of God to defend her." Bellarmine was referring to the forerunners of 3ansenism at Louvain, who were teaching that, "No one except Christ is without original sin. Consequently the Blessed Virgin died because of the sin which she had contracted from Adam." Bellarmine and the Annunciation Cardinal Orsini rec'alled that one year he happened to stop at the Jesuit Novitiate in Rome on March 25th, where Bellarmine' was making the Spiritual Exercises. That.morning, the latter's medita-tion had" been on the Annunciation of Our Lady, and when Orsini called on his friend, Bellarmine immediately began to talk about the sublime'mystery .with such fervor and clarity that his visitor was convinced "he had received a special illumii~ation from God that very morning/' It may be noted also that all his life Bellarmine delighted to mention that he was ordained to the priesthood on Holy Satur-day, ,March 25, 1570, and therefore had the privilege of celebrating his first Mass in honor of Our Lady's Annunciation. Since one of the main points of opposition by the Protestants was clerical celibacy and religious chastity, Bellarmine 'took every occasion to defend this traditional practice of the Catholic Church. There are tl~ree complete sets of sermbns which Bellarmine preached for the feast of the Annunciation, and in several of them he took as his theme the Virginity of the Mother of God, stressing the sublimity of this privilege and the example it affords for our imitation. Thus on one occasion he is commenting on the words, "And Mary said to the angel: 'How shall this be done, because I know not man?' " and explains: "The obvious implication of these words' is that Mary had not only chosen to be a virgin but that she had confirmed her choice by vow. According 'to St. Augustine, the Blessed Virgin would never have spoken this gray to the angel unless she had already vowed her-self as a virgin to God. "Can we imagine a greater courage than Mary's, when she made this choice of a virginal life? Even in our own day, it is no small thing to preserve oneself i'n untainted virginity after we have been taught the dignity ofthis state of life by Christ Himself, after St.Paul has clearly recommended it to us, after the Fathers of the Church have given it unstinted praise, and after so many thousands of people 117 JOHN A. HARDON Re~ietu [.or Religious of both ~exes have embraced the life of,celibacy and kept it inviolate until death. How. remarkable it is, therefore, that the Virgin Mary should have aspired to the palm of this virtue although she had been given no precept to that effect by God, had received no counsel, and the only example" she had to follow was the disrepute in which vir-ginity was held by everyone around her." Bellarmine and the" Assumption Among the lon,gest sermons that Bellarmine preached are three for the feast of the Assumption, which he gave at Louvain in St. Michael's Church: In Rome at the titular Church of Our Lady of the Way; and in the Cathedral Church at Capua, as Archbishop, in t 1604. It is worth noting tfiat the fifteenth of August was one of the six feast days each year ~vhen all the servants and attendants of Car-dinal Bellarmine were obliged to go to Confession and receive the Hol~r Eucharist. St. Robert would himself distribute Holy Com-munion to his cardinalatial family, at the Mass'which b~ "said~ for their intention. Two other of these six days "of.precept" were March twenty-fifth and December the eighth. In,the first of his sermons on the Assumption, Bellarmine returns to his favorite theme in relation to the Mother of God: her spotless p,urity. Contemporary witnesses record thht many of his listeners at Louvain were English Protestants, who crossed the Channel to Bel-gium just to hear him speak. ' "The Mother of Jesus," they were told, "was the first woman in history to have consecrated her virginity to God. She was the first to have pointed out the path of chastity which leads to the highest sanctity. It is common doctrine that no one, either man or woman, bad ever taken a vow of virginity before the Blessed Virgin Mary. ~ "Add to this the ~act that Mary, alone of all others before or after, united the state of virginity with the holy state of matrimony, in the truest and fullest sense of the word. For other virgins may be said to contract marriage only in a restricted sense, in that they be-come spiritually espoused to the Person bf Christ. "But most remarkable of all, she alone joined virginity of body and soul with true progeny, and such progeny as ~vould make her the Mother of God. Other virgins, it is true, are also not without chil-dren, when, by their example, prayers and exhortations, they bring sinners back to God and thus increase the number of the elect. And it not infrequently happens that the unmarried in God's'Church are 118 May, 1953 ~BELLARMINEAND MARY more fruitful in this regard than those who are married, as witness St. Catherine of Siena, St. Clare, and others. However,' with the sole except.ioa of the Blessed Virgin, none of them could at the same ' time remain virgins and also give birth to a natural offspring. All"of which must finally be attributed to a special ~race of God, and also, let us not forget, to the free choice of Mary, who chose to take a vow of virginity, to take a human spouse, and who chose to become the Mother of 'God." The Blessed Virgin in the Apostolate Bellarmine instinctively apl~aled to the virtues of the Mother of God, whenever he urged consecrated religious to the more faithful f~racti.ce of their profession. ~While he was Archbishop of Capua,,for example, a convent, of nuns which he had reformed, was accused of receiving only applicants of noble birth. When. investigatibn showed that the charge was true, St. Robert addressed .to the Sisters of San Gi'ovanni one of the longest letters Which he ever wrote. Following the lead of St.Augustine, Bellarmine praised the Sis-ters for 'consecrating their virginity to Almighty God. He implied that in so doing they were admirably imitating the, chastit~y of the Blessed Virgin Mary, becoming "the affianced of the Lord." But he also suggested that chastity is not enough, unless it is coupled with true humility. "Religious life," he told them, "cannot'co-exist with the spirit of the world, nor can ,it be ruled by it, bu~t by the Spirit of God aloiae. The spirit of the world makes accbunt of nobility and wealth, but the Spirit'of God esteems virtue and holin~s~ of life above everything else." Taking this for granted, he continues: "I thought that the nuns of San Giovanni would have really laid aside the spirit of the world, and have gone out from it not less in body than in soul." NOw (he pointed shaft: "If the Blessed Virgin were on earth and wanted to become a nun, she would never be able to get itito ~;our convent, being a carpenter's wife . This will show you in what favor you will be with the Queen' of Heaven and her "Divine Son, if you persist in such a spirit of worldly'vanity." And he con, cl'udes that, "We must nbt try' to impose our ideas on the.Holy Ghost, debarring Him from calling to His service those whom He pleases," seeing that He chose the humble Virgin Mary to become the Mother of God. Also when exhorting his own religious brethren in Rome t6 the practice of perfect chastity, he counselled them'to "be vigilant over 119 JOHN A. HARDON Review for Religious the first movements of the senses, which is easy~ because then the pas-sions are still weak and a man is strong and able to resist."' Undoubt-edly this means a constant war on our concupiscence, literally. "bearing the cross in our bodies." But in this. religious have the ex-ample of the saints to imitate, notably St. Luke, "whose friendship and familiarity with the Blessed Virgin Mary made him an ardent lover of Christ,~' for whose sake, and with the help of whose Mothe~ he was able to carry the cross faithfully until death. Also outside the cloister, on at leastone occasion, Bellarmine ap-pealed to the purity of the Mother of God in asking for a favor from the Pope himself. In the city of Ro~e, nea'r the Cardinal's titular church of Our Lady of the Way, was a public house of ill repute, which Bellarmineconsidered an insult to the Church. First he tried to do something privately, and when that failed, he wrote a letter to the Sovereign Pontiff, in which he begged, "by the love which Your Holiness has fob the most pure Virgin Mary," to see that this nui-sance was re_moved. Needless to say, his request was promptly granted. Bellarmine's Hymn to Mary the Virgin Among St. Robert's extant writings there is a short poem of twenty stanzas ~;hicb he composed in the nature of a Litany to the Blessed Virgin. The text was first published in Italian some fifty years ago, and to th6 best of l~he writer's knowledge, has never been translated into English. Each verse-line begins with the name "Virgin,~" joined to a title and petition to Our Lady, starting with the letter "A" and going down the Italian alighabet to "V". Tfius the first seven verses begin with the invocation: "'Vergine adorna . . . Vergine bella . . . Vergine casta . . . V.ergin( degna . . . Vergine eletta Vergine felice,. . . Vergine gradita . . ." A free translation of this tribute to the Virgin Mother reads as follows: "Virgin Virgin Virgin Virgin Virgin adorned and clothed with the sun, grant me thine aid. most beauti'ful, mystical rose, take abode in my heart. most chaste, all undefiled, grant me true peac~. deser;cing of all honor and praise, give ine thy love. elect and full of all grace, lead me to God. Virgin most .blessed, star of the sea, dispdl the storms .besetting ' me. Virgin most virtuous, holy and swdet, show me the way. Virgin illustrious, with thy burning light, enlighten thou my mind. 120 May, 1953 BELLARMINEAND MARY Virgin more precious than jewels or gold, make reparation for me. Virgin most worthy of all praise, mother, daughter, and im-maculate spouse. Virgin and Mother, make me more pleasing to Jesus thy' Son, Virgin most innocent of any stain or fault, make me more worthy of God. Virgin enriched with every gift and grace, obtain the remission of my sins. Virgin most pure, grant me" to enjoy the bliss of hehvenly love. Virgin, thou lily ambng thorns, I pray thee for the grace of a happy death. Virgin more rare than the rarest dream, bring joy to my heart, Virgin so great there is none like thee on earth, bring peace to my soul. Virgin most true, loving Mother too, Virgin Mary." ST. CLARE PLAY BY A POOR CLARE Candle in Umbria is the story of Saint Clare of Assisi told in a verse play by a Poor Clare Nun. The play of four acts, eight scenes is suitable for production by college students or by high schools with.special direction. The play was writt¢~l to honor the fohndress of the Poor Clares on the seventh centenary (1953) of her. death. The author is a regular contibutor to Spirit magazine. $I.00 per copy, including the music for the "Canticle of the Sun" which is embodied in the play. Those interested in obtaining a copy of this production should write to: Poor Clare Monastery, Route I, Box 285 C, Roswell, New Mexico. SUMMER SESSIONS Loyola University of Chicago announces several courses in theology scheduled expressly for Sisters during the coming summer session, Jtine 29 to August 7. Th'e Rev. James I. O'Connor, S.J., a canonist from West Baden, Indiana, will conduct an institlate" on Canon Law for Religious (Theol. 298). The Rev. Edward J. Hodous, S.J., a professor of Scripture at West Baden, will give a course on the Letters of St. Paul (Theol. 216). An authority on St. Joseph and author of several books on the saint, the Rev. Francis L. Filas, S.J., is giving a course on the History and Tbeology of the Devotion to St. Joseph (Theol. 253). For further information write to the Rev. L, J. Evett, S.J., Loyola Univet;sity, 820 N. Michi-yah'Ave., Chicago 26, lllinois. 121 Canonical Visi :at:ion ot: t:he Local Ordinary Joseph F. Gallen, S.J. ONE of the many obligations imposed on bishops is that,of vis-it! n.g their dioceses. Canon 343. § 1 commands a bishop to visit all or part of his diocese each year in such a way that the entire diocese is visited at least within every five-year period. The importance of the visitation is evident from the fact that a metropoli-tan is to. report to the Roman Pontiff: a suffragan bishop who has gravely neglected his duty of ,i.sitation. In such a case, the metro-politan himself, after obtaining the approval of the Holy See, may make the v.lsitatio.n.1 The Ordinary's visitation of religious is significant part of .'this general visitation. At least one author states absolutely that his, obligation of making the canonical visitation religious is serious.~ All religious are subject to the visitation except those that are exempt, who are to be visited only in the cases expressly. mentioned in the law.3 The specific legislation on the Ordinary°visitation of religious is found in can~ 512, It is more oractical confine this articld to his visitation of the religious community, distinguished from! its works, and to lay institutes, that is, congrega-tions of brothers a~nd sisters and orders of nuns. 1. Congregations of Brothers and Sisters . 1. Person of.the uisitor. Canon 512 prescribes that the visitation of religious is to ble made by the local Ordina'ry personally or through a delegate. The term local Ordinary includes a residential bishop, vicar or prefect apostohc, and an abbott or prelate nullius. Unlike the law on the ghneral visitation of the diocese, can. 512 gives the'l Ordinary full liberty to make the v,sitation personally or through" delegated visitors;'| The vicar or delegate of the Ordinary for reli-g, ous has vls~torial powers only if these have been expressly assigned to h~m by the O~dmary. When many priests are delegated for the visitation, it appears to be the prefeiable and more efficient practice to assign houses of the-same institute to a particular delegate, as far as lCan, 3431 § 3: 27~4;'4°, 5°. ZToso, 48; Cf. Coronata. p. 654. nora 5. SCan. 344, § 2. VISITATION OF ORDINARY this is possible. This lightens the delegate's burden of familiarizing himself with the life of the house be visits. He should study previ-busly the Rule, constitutiong,, directory, c'ustom book, book of com-mon prayers, and ce.remonial of the institute. 2. Frequenc~t of the visitation. Canon 512 enjoins the Ordinary; to visit every house of lay congregations, pontifical or diocesaia, of men or wpmen, every fifth year. Again unlike the canon on the gen-eral visitation of the diocese, can. 512 does not command the Ordi-nary to visit some of the religious houses every year nor to visit all of them at least every five years. The obligation of the Code is com-pletely fulfilled by one visit in five years, and it is perfectly licit to confine the visitation of all the religious houses to one year. The further question arises as to whether tile Ordinary may make a can-orfical visitation of these houses more frequently than once in five years. He may certainly do so in diocesan instituteR, since cart. 492, § 2 subjects these houses completely to the jurisdiction of the local Ordinary. It is the more probable opinion that the Ordinary may not make more than fine canonical visitation in five years in pontifical congregations of men or women,a A canonical visitation constitutes .an Intervention in the religious life of a pontifical congregation, and can. 618, § 2, 2° forbids such an intervention t6 the Ordinary ex-cept in the cases expressly mentioned it, law. These statements are based on the law of the Code. It~is~not impossible to find diocesan congregations and much more exceptionally pontifical congregations that prescribe a greater frequency of visitation in their constitutions. 3. Visitation of places in pontitfcal congregations. The places that the'Code subjects to the visitation in the houses of these congre-gations are: "the ~hurch, the sacristy, the public oratory, and the c!onfessionals.''s Churches and public oratories are practicall3; never iittache'd to the houses' of lay congregations in the United States. All chapels, whether principal or secondary, in the houses of these insti-tutes are classified canonically as semipublic oratories.6 Canon 512 subjects only public, not semipublic, oratories to the visitation of the local Ordinary. Since it is the intention of this c~non to define the persons, places, and things in a religious house that are subject to the visitation of the Ordinary, it is at least probable that he possesses neither the obligation nor the right to visit the semipublic oratories 4Farrell,, ~01-102; LarraonaTCpR, VIII (1927), 444; Toso, 49. sCan. 512, § 2, 2% 3°. 6Can. 1188, § 2, 2°; 1192, § 4. 123 JOSEPH F. GALLEN of lay pontifical co confessionals erected the religious and of sory to the oratory¯ 4. " Visitaffon of Review [or Reliqious gregations. The same principle is true of the in the semipublic oratory for the confessions of the sacristy, which is to be considered as acces-persons in pontifical congregatiot~s, a) General-ate arid provincialat ;. The general and i~rovincial house, superiors, officials, government, and administration of temporal matters of pon-tifical congregational are not visited by the Ordinary. Canon 512 assigns to the Ord~nary the right and the obligation to visit only houses, not provinces or institutes; can. 618, § 2, 2° foriaids the Or-dinary to intervene .~n the .internal government and .discipline of pon- ¯ tifical congregations except in the cases expressly mentioned in the law, and no particu, lar canon gives the Ordinary the right to visit the generalate or proviricialate as such. The dowries are the only matter of general administration that fall under the canonical visitation Otherwise the gene, ral and provincial house, .superiors, and officials are subject to the ~isitation only as a local house and as members of a local community. IT.he same principles are true of. such intermediate divisions as vice,prbwnces, quasi-provinces, visitations, regions, mish sions, districts, and vicariates. b) Imernal'qoloernraent. The internal government of pontifical congregations is exempt by law from the visitation of the Ordinary? Therefore, th~v .,s,tor does not inquire directly ihto the government of local, provincial, other intermediate, or general superiors. .Both [anons 5 2 8 2 3',° and 618, § 2, 2 ° restrict the Visitation of persons XC1 s, on in the latter canoh, in which both government ano a~sctptme are mentioned but the~ intervention of the Ordinary is imm.ediately re- " stricter to &sc,phne. Internal government :includes not only the gen-eral~ elation of subject's to superiors but also the admission of sub- 7De Carlo,.n. 93. 4°, Ib) ; 5°; Larraona, CpR, VIII (1927), 447, and nora 501 448; Reilly, 99, I I2;[Slafkosky, 96-97; Vromant De Personis, n. 177, IL2),a). For the contrary opmton, of. Farrell, 104. Cf. also Ciacio. 60; Coronata, p. 655, ~ota 2; Goyeneche, C'pR,'III (1922), 335-336; Schaefer, n. 560; XVernz-V~dal, p. 123, nots 91.550 ' SCan. 535, § 2; , § 2. . 9De Carlo, nn. 64, III, b) ; 93, 5°, b) ; 404, c) ; Fanfani, IfDiritto Detle Rehq~- ose, n. 60, 2 , c) ; De Reliqiosis~.n. 70, d) ; Larraona, CpR, IX (1928), 100, and aota 505; Pruemmer! qq. 187, 5, c): 242, 2, c). Cf. Abbo-Hannan, ~. 512, Bastien, n. 141; Bryn, n. 616, 6°: Ch°elodi, ~. 281,~b~: Cocchi, pp. c5)2, 183, Goyeneche, De Rehg~ps~s, 169; Jorabart, I, nn. 827, 2, e); 890, 2, ; Raus, n. 178, 4); Regatillo, n. 746; Schaefer, nn. 560, 1285; Vermeersch-Creusen, nn. 631; 778, 2. 124 May, 1953 VISITATION OF ORDINARY jects into the congregation' and to the professions, their education and formation, appointment t_o various offices and employments, and transfer from house to house. c) R~liqious discipline. The right and the duty of the Ordinary to inquire into religious discipline is specified by can. 618, § 2, 2° as follows: 1 ° "The observance of discipline according to the constitutions." The Ordinary is not a religious superior in canon law. His office in this matter is that of the vigilance of external authority and not of direct government of the religious life. He does not inquire into re-ligious discipline in the detailed and rather individual manner of a higher superior. His right and duty is to ascertain the general state of religious discipline in the house and especially the existence of abuses in discipline. Inquiries bearing on an individual should, not be made unless, there is at least a rumor or founded suspicion of the misconduct of the individual.1° The Ordinary is not obliged to in-terview all tbe religious but only the number and the particular indi-viduals who because of their office, employment, or other circum-stances will be sufficient to enable him to discern the general state of discipline.11 Religious dlsc~phne includes the observance of the laws, decrees,' and instructions of the Holy See except those on government. Prac-tically all of these that are pertinent are or at least should be con- .rained in the constitutions. Inquiry sh6u!d also be made as to whether these lay religiou, s are informed on such important canonical legislation as the duration, continuity, and laws on absence of the canonical year of noviceship; the limitation on the application of novices to external works of the congregation during the second year of noviceship; the necessity of the reception of all juridical profes-sions and especially of the renewal o'f temporary professions; ind the observance of the canonical prescription of three full years of tem-porary vows for the validity of the perpetual profession. A direct investigation is to be made on such matters as the observance of the Code and the instructions of the Holy See on begging and on the canonical prohibition of electioneering. The more proper field of religious discipline is the observance of the vows and of the articles of the following sources of obligation: the Rule, constitutions, legitimate customs, ordinations of the general 10Chelodi0 n. 194, c). nCan. 513, § 1. 125 Review for Religious JosEPH F. GALLEN chapter, an~i regula.tions of higher superiors. The most apt norm of inquiry that can be suggested here is the list of questions of the quin-quennial report to ,the Holy See, especially those contained in Chap~ ter II, Article II of this list. The observanc~ of the vow of poverty demands the pe'rmission of the superior fo~ the disposition of material things, but both the ancient and modern abuses in poverty are in the neglect of common life, for example, ~he possession of money that th~ religious' disposes of dependently or independently for his' own necessities; .the frequent or habitual obtaining of necessities from externs; the failure of the institute to supply these necessities adequately and generously; the absence.of the pres, cnbed and reasonable uniformity among the reli-gious in material things, especially in such matters as trips and vaca, tions; and ¯imprudent and excessive demands on parents for these ne-cessities, particular!y during the postulancy and noviceship: ' The external ~afeguards of chastity are subject to the inquiry of the visitor. Thes~e include the avoidance of familiarity and sensual friendships, care ih reading, prudence in the use of the radio, tele-vision, and in thelchoice of the moving pictures shown to the com-munity. The observance of cloister falls under this heading but it is mentioned individually later in the canon. Tile OrdinarY inquires about fidelity to the prescribed religious exercises: Mass, meditation, Little O~ce of the Blessed Virgin Mary, examen 'of conscte, nce, rosary, spiritual reading, visits to the Blessed~ Sacrament, etc. ¯ The spirit of i cooperation, peace, happiness, charity, the general spiritual Ievel in the house, and the obstacles to all of these come un-der the scrutiny of the Ordinary. The canon orl the purpose of the general visitation 6f the diocese directs the Ord, i!nary aiso positively to promote the welfare of the pkrsons and place~ he visits,t2 His counsels can be of value to 'insti-tutes that are la~'king in initiative, manifest a most unsatisfactory rate of increase o~ membership, have a constricted mental outlook, or live so much. in ~he traditions of the past that they refuse to face modern times in ,their lives in general, their work, spiritual forma-tionl and' educat.~gn of subjects. He can give a sympathetic hearing and even effectivei aid to representations on the universal lack of suf-fici'ent financial r~sources in lay congregations. This fact is the cause l~Can. 343, § 1. 126 ) May, 1953 VISITATION OF ORDINARY of overwork, of some of the weakefied health, df much of the loss of the full fervor of the religious spirit, of inadequate education of sub-jects, of the failure to provide sufficient material necessities and suit-able vacations, and, finally of annoying and undignified ways of raising funds. The whole matter of overwork in its relation to the ~observance of religious discipline should be thoroughly studied. The daily schooltwork of brothers and sisters is more than sufficient labor in itself. Added burdens can readily result in the contradiction of the unprepared teacher and the natural' religious. 2° "'Whether sound doctrine and good morals have suffered in. any way." This clause expresses an~application of subjection to the Ordinary not as religious but in the manner of the ordinary faithful. The local Ordinary is the guardian of the purity of faith and morals in his diocese. Misu'nderstanding of matters of faith and erroneous moral principles can be avoided by a competent course in Christian doctrine during the postulancy~ and noviceship and by further and highly desirable theological courses after first profession. 3° "'Whether there have been any violations of cloister." The Ordinary has the 6bligation of exerting .vigilance that cloister is ob-served in all religious congregations and of taking appropriate meas-ures to correct any habitual, notable, or scandalous Violations.13 Canon law imposes cloister on all congregations of men or women. This law places in cloister the parts of the house reserved for the ex-clusive use of the religious and determined by higher superiors. It forbids the entrance into the cloistered section of any person of the opposite sex except for a reasonable cause. The particular law of some .congregations forbids the entrance likewise of those of the same sex. The law of cloister also demands the observance of the pre-scriptions of the constitutions on going out of the house and 6n the rec~eption of visitors. 4° "'Whether 'the sacraments are, dul~t and regularlt.t received." The Ordinary is to inquire whether the religious receive the sacrament of Penance weekly, as universally prescribed by the constitutions. This is also the appropriate occasion for an investigatibn into the following canonical matters: the competence and regular fulfillment of their duties by the ordinary and extraordinary confessors; the-availability of supplementary confessors; abuses in the matter of special confessors; interference in 'internal and external government by confessors; interference with the rights of subjects regarding the 13Can. 604, § 3. 127 JOSEPH F GALLEN Reweto for Rehfltous suplblementary and occasional confessors and also the confessors of re-ligious women who are seriously ill; the exercise" of these rights in Conformity with right .reason, prudence, and religious discipline; the important directive of the Sacred Congregation of the Sacraments on the opportunity for confession before daily Mass; and any violation of the prohibition of obliging to a manifestation of conscience. The frequency of the reception of Holy Communion is not prescribed by the constitutions but is left to the devotion of the individual ~eh-gious. It is not beyond the power of the Ordinary to inquire about the general frequency of the reception of Holy Communion. If he finds a situation unusual in a religious house, he may be able to sug-gest o'r actually to effect a solution that will render the 'situation normal. 5° Remedial action of the local Ordinary. The defects in reh-gious discipline of lesser moment that the Ordinary has discerned and judges worthy of mention should be communicated to the siapiriors It will be sufficient to advise the local superior of such matters, unless , he judges that an effective correction can be attaihed only by inform-ing the superior general or provincial. If he has found abuses of serious moment, that is, continued or repeated violations of the laws o~ God, of the Church, or of.religious discipline in matters of greater importance, he is to admonish the superiors to correct the abuse. The gravity of these matters will frequently demand or at least cdu,.nsel that the higher superior be informed. If the abuse is not corrected within a reasonable time, the Ordinary himself is to take means to eliminate it. If he has discovered any serious matter that demands immediate correction, the Ordinary himself is to take direct corrective action but in this case he is obliged to inform the Sacred Congrega-tion of Religious of his action.14 5. Financial matters in pontitical congregations. Cation law here asserts the practical restriction of the authority of the local Ordinary to the two following matters:XS a) Dowries. The dowries, which are proper to institutes of women, are under the vigilance of the Ordinary of the habitual resi-dence~ of the higher superioress who is administering them. This right of vigilance demands that the consent of the Ordinary be obtained 14Can. 618, § 2, 2*., lSCan. 618, § 2. 1 °. Only the two financial matters here listed.are ordinarily found in constitutions approved by the Holy See. Cf. can. 533, § 1, 4"; 1515-1517, 1544-1551. 128 Mag, 1953 VISITATION OF ORDINARY for any investment or change of investment of the dowries; he is also to exert care that the dowries are maintained intact and invested in safe~ lawful, and productive securities; finally, he is to exact an ac-count of the dowries un'der these headings at the time of the canonical visitation or even oftener, if he thinks the latter necessary,lg A state-ment should be prepared for the visitor sho~ving the number of dow-ries, their 'value when given, the securities in which they are invested,' and the current value of the securities. b) Funds for divine worship or charitg~. The rather obscure and complicated funds here intended are those: (1°) donated or be-queathed to a house of a religious congregation; (2°) and motivated at least primarily and directly for divine worship or works of charity in favor of externs and to be carried out in the same. village, town, or city in which the religious house is located. Money given for main-taining a scholarship can be an example of such funds. The consent of the local Ordinary must be. obtained for any lnvestment or change of investment of these funds, and he also has.the right of inquiring into their administration. The manner, frequency, and time of the inquiry are left to the decision of the Ordinary.lz The canonical visitation is an opportune tim~ for this inquiry. These same rights of the Ordinary do not extend to such funds given to a province or congregation, nor tO those given solely or pri-marily and directly for the benefit of the religious, nor when the di-vine worship or works of charity are to be performed outside the lo-cation of the religious house or when the choice of the place of their performance is left to the religious. The primary and direct purpose of the gift of funds for a scholarship may be to provide an education for a poor youth or to bestow a gift on the religious who conduct the school; only in the former case would these funds be subject to the norms of vigilance quoted above. 6. Visitation of diocesan cofigregations. The general principle of canon law is that diocesan congregations are completely subject to the local Ordinaries. However, the Code immediately limits this sub-jection by stating that it is such as is described in law.is The prin-ciples that restrict the jurisdiction of the Ordinary over these congre-gations are as follows: (a) he must observe the particular canons that limit his power, for example, the higher superiors of the institute, 16Can. 549; 550, § 2; 533, § 1, 2°; § 2; 535, § 2. 17Can. 533, § 1, 3°; § 2; 535, § 3, 2°¯ ISCan. 492, § 2. 129 JOSEPH F. GALLEN Reoietu for Religioas not the Ordinary, are competent tb admit to the professions; (b) his authority must be exercised according to the apprgved constitutions; (c) the Ordinary of the motherhouse enjoys no primacy of author-ity, since the Code subjects the houses in each diocese to the jurisdic-tion of the Ordinary of that diocese; (d) a diocesan c~'ngregation is a legitimately erected moral person in the Church, with its own proper internal life and field of action: the superigrs possess independent au-thority and are obliged to recur to the Ordinary in matters of inter-nal government only when this is demanded by the Code or the con-stitutions; (e) the Ordinary is not to be considered as a religious su-perior who directly governs the congregation but as an external ec-clesiastical superior, whose authority is that of vigilance over the proper observance of the Code and the const~itutions, of correcting abuses, supplying for defects, and of guiding and aiding the co'n-gregation during the relatively brief probationary period of acquiring the strength and stabili_ty necessary in a petition for pontifical ap-proval. The Ordinary thus acts as an external ecclesiastical superior in the canonical visitation of these congregations. The Code places no limitation on the Ordinary's right of visitation of the houses of congregat!ons. He visits these houses'in everything, internal government, the whole field of discipline, all financial matters, per-sons, and places. Here also the Ordinary is obliged to interview the individual religious only to the extent that he judges necessary for the attainment of the purpose of the visitation.19 The visitation of the semipublic oratories and sacristies of dioc-esan institutes includes an examination into the fgllowing matters: cleanliness; freedom of the oratory from profane uses and its security against sacrilegious thefts and profanations; the conformity of the altar, the t~bernacle, and their furnishings with canonical and litur-gical legislation; the cus, tody of the Eucharist; obedience to instruc-tions on the custody .of the tabernacle key; all the sacred vessels; tl~e sanctuary lamp; the conformity bf the vestments and other furnish-ings with liturgical law, ecclesiastical tradition, and the laws of sacred art; observance of the laws on divine worship and sacred music; fidel-ity to the list of days on ~hich Exposition and Benediction bf the Most Blessed Sacrament are permitted; the admission of priests to the celebration of Mass; and the proper custody of the holy oils. The confessionals in these institutes are examined in the follow- 19Can. 513, § 1. Cf. 4. c), 1° above. 130 Matt, 1953 VISITATION OF ORDINARY -ing respects: their location in' institutes of women in an open and conspicuous place and generally in the chapel: suitability and per-manent accessibility of the place of the confessional; the danger of being overheard, especially ih a confessional in the chapel: a suitable place for the ~onfessions of the deaf; the presence of a narrowly per~ forated grating between the confessor and the penitent; and observ-ance of the law that forbids the confessions of women outside the confessional except in cases of sickness or for other reasons of similar import. The Ordinary always has the right of taking direct and imme-diate action to correct defects and abuses that he has discovered in di-ocesan congregations. However, for the efficacy of the government of superiors and the peace of the members of the institute, it would be better to follow the order of correction described above for pontiff-cal congregations. A diocesan generalate or provinciaiate and the general and pro-vincial superiors and officials, even if the institute or province has houses in several dioceses, certainly fail, under the quinquennial visi-tation of the Ordinary as a local house and members of a local com-munity, The administration of all the dowries i~ also' subject to this visitation of the Ordinary. It is certain that the Ordinary is not obliged to make a ~canonical visitation of the general and provincial houses, superiors, and officials as "such, nor of the general and pro-vincial government and material administration, even if all the houses of the congregation or province are located in his diocese. The argu-ment for this statement is found in the law on the canonical visita-tion, which speaks only of the visitation of houses, not of provinces or institutes.~° It is likewise certain that the Ordinary may make such a visitation, provided all the houses of the province or congrega-tloia are located in his diocese. This right follows from the general subjection of diocesan congregations to [he Ordinary and is in con-flict with no canonical principle. It is more probable that the Ordi-nary may not make such a visitation when the congregation or prov-ince includes houses located in other dioceses, unless he has been com-missioned to do so by the Ordinaries of all these other diocesesl- The principal arguments for this doctrine are that sfich a visitation would affect the entire congregation or province, would contravene the can-onical principle that the Ordinary of the motherhouse enjoys no primacy-of authority, and would thus be obstructive of the rights of 20Can. 5 1 2. 13 t JOSEPH F. GALLEN Reoieu~ for Religious the other Ordinaries. Some canonists oppose thi~ doctrine and hold with solid prob-ability that the Ordinary may make a canonical visitation Of such a generalate or provincialate. Their position is founded on the general subjection of diocesan institutes to the local Ordinary and they deny that this visitation, whose purpose is to promote the observance of the Code and the constitutions, would of its nature conflict with the authority ~r rights of the other Ordinaries.22 In this diversity of opinion, the Ordinary may licitly maintain the right of visitation, since the exclusion of the visitation of such a generalate or provi'ncial-ate from the general principle of subjection to the local Ordinary has not been certainly proved. The controversy should now have a. negligible practical applica-tion. The Sacred Congregation of Religious stated clearly in the new quinquennial report that a diocesan institute actually divided into provinces should have petitioned the status of a pontifical con-gregation before such a division. The Sacred Congregation also ex-plicitly affirmed that any diocesan congregation should.~petition pon-tifical approval as soon as the necessary conditions are verifiei:l. These are practically alwa~rs verified in a diocesan congregation that has spread beyond the diocese of origin. It cannot be repeated too fre-quently that the .diocesan status of a religious ifistitute is not per-petual and definitive but only temporary and probationary and that pontifical status, when the necessary conditions are verified is not optional but mandatory according to the practice of the Sacred Con-grega tion~. ~ II. Monasteries of Nuns Not Subject to Regular Superiors Canonically. nuns are the members of an institute of religious @omen in .which solemn vows at least should be taken according to the prescription of the particular law~ of the institute. Only simple vows are still taken in most monasteries of nuns in the United States, but the injunction of the apostolic constitution Sponsa Christi should soon reverse this condition,24 Some orders of nuns, for example, the 21Bastien, n. 137; Jombart, IV, n, 1323, 7, but cf.'I, n. 827, 2, a); Larraona, CpR, X (1929), 368-377: XIV (1933), 417, and nora 777; 418; Muzzarelh, nn. 145-147; Quinn, 842'90; Schaefer, n. 744, d), but of. n. 745. 22D'Ambrosio, Apollinaris, I (1928.), 417-422: Reilly, 91-97; apparently also Brys, n. 631, IV, 3°; De Carlo. n. 206, III: Vermeersch-Creusen, n. 660, 3, Vromant, De Bonis Ecclesiab Ternporalibtts, n. 238. 23Review forReligious, March, 1950, 57-68; January, 1951, 22; January, 1952, 13-14. z4Statuta, Art. III, § 2. 132 May, 1953 VISITATION OF ORDINARY Carmelites and Dominicans, are subject by the law of their constitu-tions tothe supeiiors of orders of men; others, for example, the Vis, itandines, are not. Monasteries of only simple vows are most rarely in fact subject to order~ of men, even though their constitutions pre-scribe such subjection. The first category of nuns with regard to the canonical visitation of the local Ordinary is of monasteries of solemn or simple vows that are not in fact subject to orders of men. The local Ordinary is obliged to visit all such monasteries every five years35 He may do so more frequently, since these monasteries are subject to him also with regard to the religious life. The consti-tutions also may prescribe a greater frequency of visitation. He viS'its these monasteries in everything, as described above for diocesan con, gregations. All monasteries of 'nuns, whether of solemn or simple vows, are now to have papal cloister.~ The local Ordinary or his " delegate, accompanied by at least one .cleric or religious man of ma-ture age, enters a papal cloister of. women only for the-visitation of places. The rest of the visitation is carried out at the grille37 III. Monasteries of Nuns Subject to Regular Superiors , The distinctive note of this category is that th~ monastery is in fact subject to an order of men. A~ stated above, it may be of sol-emn or'simple vows. The local Ordinary is obliged to visit such a monastery "every five years concerning the observance of the law of cloister and he may make such a visitation as often as he judges it opportune.~ On the occasion of his q~inquennial visitation he also inquires'into the administration of the dowries,a9 The Ordinary alsb has a suppletory duty with regard to a monastery, of this category. If the monastery has not been visited within five years by ~he regular superior, the 1,ocal Ordinary is obliged to visit it in everything, as ex-plained above for diocesan congregations.3°, Other Pertinent Canons abd Principles Canons 513; § 1 and 2413, as also the principles on the. field of c6nsciende, denunciation of the conduct of another, and use and se-crecy concerning.matters learned in a visitation, explained in the pre- 2SCan. 512, § 1, 1" 26Sponsa Christi, Statuta, Art:'IV. 27Can. 600, 1" 28Can. 512, § ~, 1". 29Can. 5 5 0. ~30Chn. f!l2, § -2, 1". 133 JOSI~PH F. GALLEN vious aiticle on the visitation of higher superiors, a~ply similarly the canonical visitation of the local Ordinary.3',32 31Concerning the subject of the penalty of can. 2413. cf. Jombart, Larraona. Muz-zarelli, and D'Ambrosio. as cited in notes 21-22. and Reilly, 173-176. 3ZThe authors cited are: Abl~o-Hannan. The Sacred Canons, I: Bastien. Directo~re Canonique; Brys. duds Canonici Compendium, I: Chelodi, lus Canonicum De Per-sonis: Ciacio, De, Oratodis Semipublicis: Coccbio Commentarium In Codicem lur,s Canonici, IV; Coronata. lnstitutiones luris Canonici, I: D'Ambrosio. Apollinar,s:. De Carlo. dus Religiosorum; Fanfani. ll Diritto Delle Religiose, De lure Relioioso-rum: Farrell. The Rights and Duties of the Local Ordinar{l Regarding Congrega-tions of Women Religious of Pontifical Approtml; Goy6neche. Commentadum Pro Religiosis, De Religiosis; JomlSart. Traitd De Droit Canonique, I. IV: Larraona, Commentarium Pro Religiosis; Muzzarelli. De Congregationibds furls Dioecesam; Pruemmer. Manuale luris Canonici; Quinn. Relation of the Local Ordinart, t to Reh-gious of Diocesan Approval; Raus. Institutiones Canonicae : Regatillo. lnstitutiones luris Car~onici; Reilly~ The Visitation of Religious; Schaefer, De Religiosis; Sl~f-kosky, The Canonical Episcopal Visitatiori of the Diocese; Toso. De Religios~s, Vermeersch-Creusen, Epitome furls Canonici, I: Vromant. De Personis: De Bores Ecclesiae Temporalibus; Wernz-Vidal. De Rdigiosis. "10,000 GOLD FRANCS" MEANS "S,000 DOLLARS" AcCording .to a decree of the Sacred Consistorial Congregation, duly 13, 1951, religious institutes need the permission of the'Holy ¯ See t6 alienate property or to incur a debt when the amount exceeds 10,000 gold' francs or lire. In an article in-this REVIEW (November, 1952, pp. 301-304), we att'empted to translate this amount into American dollars, and we reached the~ tentative conclusion that the approximate amount would be 7,000 dollars. Our estimate was based on sound economic calculations; hence, we suggested that 7,000 American dollars Could be taken as the norm until some more specific norm would.be given by the Holy See itself. On danuary 29, 1953, the Sacred Congregation of Religious pub-lished the official equivalents of 10,000 gold francs or )ire for the principal countries of the world. The equivalent for the United States is given as 5,000 dollars; for the equivalents in other countries, see page 150. As matters now stand, therefore, the permission of the Holy See must be obtained to alienate property or to incur a debt when the amount exceeds 5,000 dollars in our ordinary currency. It should recalled that this permissidn may be obtained through the Apostohc Deldgate, in Washington,if the sum does not exceed 500,000 dollars 134 Conl:ession before Communion Gerald Kelly, S.3. '~N THE FIFTEENTH of Jun, e, 1520, in a memorable docu- . ~ ment which begins with the words, Exsurge Domine (Arise, O Lord), Pope Leo X condemned a multitude of errors of Martin Luther. Among these errors was Luther's teaching on the preparation, required for Holy Communion. According to him, pr~yers~and other pious works, as well as contrition for mortal sin and even confession itself, are useless; all that is required is to .be-lieve, to have confidence that one will obtain grace in the sacrament, and this alone will make one pure and worthy. Thirty-one years later, fin its thirteenth 'session' (October 11, 1551), the Council of Trent considered this same errdneous teaching, and,stated the true doctrine in a chapter and a canon. Chapter VII, "On the preparation to be given thht one may.worthily receive the sacred Eucharist," runs as follows: "If it is unbeseeming for anyone to approach to any of the sadred functibns unless he approach holily; assuredly, the more the holiness and divinity of this heavenly sacrament are understood by a Chris-tian, the more diligently ought he to "give heed that he approach not to receive it but with great reverence and holiness, especially as we read in the Apostle those words full of terror: He that eateth and drinketh unworthil! , eateth and drinketh judgment to himself, Wherefore, he who would communicate ought to recall to ~ind the precept of the Apostle: Let a man proue himself. Now ecclesiastical usage declares that necessary proof to be, that no one, conscious to himself of mortal sin, how contrite .soever he may seem to himself, ought to approach to the sacred Eucharist without previous sacra-mental confession. This the holy Synod hath decreed is to be,in-variably observed by all Christians, even by those priests on. whom it may be incumbent by their office to celebrate, 16rovided the opportun-ity of a confessor do not fail them; but if, in an urgent necessity, a priest should celebrate without previous confession, let him confess as soon as possible." (Waterwotth, The Canons and,Decrees of the Sacred and Oecumen&al Council of Trent, pp. 80-81.) " The eleventh canon :of the same session makes explicit reference to the Lutheran error. It reads: 135 GERALD KELLY Reoiew for Reli~lious "If anyone saith, that faith alone is a sufficient preparation for receiving the sacrament of the most. holy Eucharist; let him be anathema. And for fear lest so great a sacrament may be received unworthily, and so unto death and conddmnation, this holy Synod ordains and declares that sacramental 'confession, when a confessor" may be had, is of necessity to be made beforehand, by those whose conscience is burtl~ened ,with mortal sin, how contrite even soever they may think themselves. But if anyone shall presume to teach, preach, or obstinately to assert, or eveh in public disputation to de-fend the contrary, he ~hall be thereupon excommunicated." (Water-worth, p. 84.) The foregoing teaching of the Council of Trent is the principal source of our present canon law: namely, canon 807, which concerns the celebration of Mass, and canon 856, which concerns the reception of Holy Communion. .An English translation of the latter canon runs as follows: "No one, whose conscience convicts him of mortal sin, no matter how contrite he thinks himself, may approach Holy. Communion without l~revious sacramental confession. If there is urgent neces-sity, and no oppoitunity of finding a confessor, he must first elicit an Act of Perfect Contrition." (O'Donnell, Moral Questions, p. 270.) This law is of the greatest moment. It should be clearly under-stood by religion teachers, catechists, and frequent communicants. Properly to understand it, one must have a grasp of these three propositions: (I) It is always, necessary to be in the state of grace When receiving Holy Communion. (II) It is ordinarily necessary to confess before receiving Holy Communion if one has committed a mortal sin since one's last good confession. (III) In certain extra-ordinary circumstances it is sufficierit to regain grac~ by a'n act of per-fect contrition before receiving. Holy Communion. The purpose of the present article is to explain these three propositions and (IV) to call attention to some precautions to be. taken in order to safeguard the ordinary observance of the law and, to avoid sacrilegious Com-munions. I. It is alwol~s necessary to be in' the State of grace when receiving Communion. One reason for this is that the Holy Eucharist is a sacrament of the living. A sacrament of the living supposes its recipient to be already supernaturally aliventhat is, living the divine life of grace--- 136 Ma~, 1953 CONFESSION BEFORE COMMUNION and its function is to increase this divine life in the soul. A second reason is found in the special purpose of the Eucharist, which, is to r~ourisb. We do not speak of nour.ishing a corpse; nourishment sup-poses that life ~lready exists. The conscious receptiOn of Holy Communion while in the state of mortal sin is a grave sacrilege. It is to receive the source of sal-vation unto one's own condemnation. No one, therefore, should receive this sacrament unless he has a reasonable assurance that he is in the state of grace. I say "a reasonable assurance," because when there is question of our interior state of soul it is not possible for us, apart from ~ special divine revelation, to have an absolute certainty that we are in the state of grace. All that God. expects of us in this and in similar matters is a practical, or working, certainty that we fulfill various conditions established by Himself or the ChurCh for His honor and our own spiritual welfare. For ordinary people there is no difficulty in this.matter. They go to confession; do what they can to fulfill the requisites of a good confession, and leave the con-fessional in peace, sufficiently confident that their sins are forgiven and that they are in the state of grace. And the same is true of them when they make an act of perfect contrition: they are reasonably, or practically, sure that through this act they are restored to God's friendship,' in case they had lost it through mortal sin. (Contrition, said the Council of Trent, is perfect through charity. Hence, perfect coritrltion is sorrow for sin based upon a motive of charity, that is, sorrow because one has offended God, who is the supreme good and worthy to be loved above all things. It is not difficult for those who are accustomed to think of God to make an act of perfect contrition and to mean it. The formula for the act of contrition, as ordinarily taught in catechism classes, contains both imperfect and perfect contrition. This is appropriate, because sorrov~ for the perfect motive does not exclude sorrow for lesser motives.) Some people, such as the scrupulous, have great difficulty in these matters. They alw.'ays feel spiritually insecu~re. No matter what their reason might tell them of their state of soul, its calm judgment is stifled by their fear; and this fea.r makes them feel that they are not, or,may not be, in the state of grace. If such people were to follow their feelings, they would very likely never receive a sacrament of the living, especially the H61y Eucharist. For them~ it is necessary to fol-low sound direction in spite of their feelings--lall the while working towards the goal of being able to make quiet judgments for them-selves, judgments based on facts and not on fea~. 137 GERALD KELLY As is the case with other sins, one must realize what he is doing in order to be guilty of a sacrilegious Communion. Consequently, one who is actually in the state of mortai sia but does n~ot advert this when he receives Holy Communion does not commit a sin: fact, it may be that he receives sanctifying grace through the Eucha-rist itself. Many erfiinent theologians hold that. a sinner (i.e:, in the state of mortal sin) who receives Holy Communion ifi good faith and with imperfect contrition for his sins is restored to grace through'this sacrament. Knowledge of this opinion may be a con-solation to those who are apt to worry about being deprived of grace because of unsuspected unworthiness when they communicate. The case of receiving Holy Communion without adverting the fact that one is in the state of mortal sin can hardly be very common. But it is certainly not an impossibility, especially for some people whose devotions' aie governed by routine. For example, sup-pos~ that a layman is accustomed to receive Holy Communion first Sunday of every month and to go to confession, the day before It might happen that something unforeseen.would prevent his going to confession, and then, following his routine pattern, h~ would communciate Sunday morning without realizing at the time that had been unable to make his usual confession. If he had committed a mortal sin and had made only an act of imperfect contrition'he would still be in mortal sin at the time of communica_ting. Being unconscious of this, he would be in wh~t is called "good faith Communion would proba.bly have the same effect for him as an of perfect contrition~namely, give him sanctifyi.n.g grace, though would still be obliged to confess his sin.' II. It is ordln~rily necessar~.l to confess before receiving Communion ~f one has committed a mortal sin since one's last good confession. To say that one must be in the state of grace when receiving sacrament of the living is not the same as saying that a sinner must go to confession before receiving one of these sacraments. It is pos-sible to regain sanctifying grace either through actual confession through perfect contrition, which includes the intention to co,nfess the proper time. Nothing in the nature of a sacrament of the living makes actual confession a necessary prerequisite; nor is there any special law which makes confession necessary, except for the Holy Eucharist. For instance, if a young man who is to be confirmed tomorrow commits a mortal sin today, he is certainly obliged regain sanctifying grace before receiving confirmation, but an act 138 ¯Ma~, 1953 CONFESSION BEFORE COMMUNION perfect contrition would suffce for ¯thpis rup !o s e .~ A . nd this would" be true also of matrimony, holy~orders, and e~xtrem¢ unction if these sacraments were received apart from Holy:Communion,or the cele-bration of Mass. | ~ . . The Holy Eu~charist, therefo.re, is govern~ed by°an entirely special law~. As we learn from the Council of "l~rent arid the Code, the regaining of grace through perfect contrition.is not normally suffi-cient for the reception of this sa~cramsaecnrat;m Ie ~ntal confession' is ordinarily required. The reason for this seems to be the entirely special .character of the Holy Eucharist. it is the most excellent of sacraments, and it is to be safeguarded as much fis is humi~nly possible against the clangerof abuse. ~ ] Is this law prescribing confession beforle Comrfiunion a divine law or a law made by the Church? The answer to this question is not clear. Some of the greatest of'post-Tr~dentine theologians ex-plain it as a divine law promulgated through St. Paul: St, Alph'onsus Liguori, writing in the eighteenth century, ~dheres. to this explana~ tion as being by far the more common and th~eonlv true one Never-thele. ss, eminent modern theologians express ~lissa~isfa~tion with the arguments that the law is of divine origin arid hold that ~he words of the Council of Trent are sufficiently verifi~ed if the law is consid-ered to be of ecclesiastical origin. In either case--whether divine or merely ecclesiastical the law is strictly binding, and the only excep-tion to it is offcially declared by the Church[ to be a case in which Communion is necessary and confession is impossible, as will be ex-plained in our next section. ~Who are obliged by this law to go to cofenssion before receiving Communion? Only those u:bo are certain tb ~at tbe[j.have committed a mortal sin since their last gUod confession. T~erefore, one who inculpably failed to tell a mortal sin in an otl-lerwise good confes~io~h is ~iot obliged to abstain from Communion u~nti~ he makes another c~nfession. ~'He bus already regained grace thr~ough co~nfession. It is true, of course, that the omitted sin must still be confessed; but it is not necessary to advance one's ordinary time of confession in order to do this, and in the meantime one may receive Holy.Communion even daily as long as ~he commits no further m~0rtal sin. " , It is clear that- if one who knows he forgot to tell a mortal sin in. confession may receive Holy Communion, then one who merely doubts whether be forgot to tell a sin has the~ same privilege¯ BUt what of one who knows be committed a mortal sin and doubts 139 GERALD KELLY Reoieto for Religious whether~ he has been to confession at all since then (not a yery com-mon case), or~,.of one who doubts whether he has sinned mortally (e.g., by sutficient reflection or full co.nsent) since his last confession~ Regarding these cases there would be some difference of opinion among xheologians; but a sound practical rule covering all .such doubts is this: th~ sole obligation is to take some available means of removing the doubt so that one will be reasonably sure of being in the state of grace when receiving HolyrCommunion. ¯ Sometimes what is called a doubt is not a doubt at all, but merely a scruple or a sort of hazy" fear. The best treatment for such ~orries is to pay as Iittle heed as possible to them, even though they accompany the holiest of actions. In other instances, a doubt is a sort of temporary state of mined that can be corrected by the applica-tion of a sound rule of presumption. For instance, one who Wonders whether he gave full consent in some very disturbing temptation, mig~ht' realize in his calmer moments that in similar' situations he never, or practically never, gives in to the temptation. Thus the presumption of not consenting favors him, and he may use this pre-sumption to dispel his perplexity and to form the practical judgment 'that heDis still in the stare of grace. In such cases neither confession nor r~erfect contrition is strictly required before Holy Commun.lon But it may happen occasionally to anyone that his doubt whether he has committed a mortal sin is too solidly-founded to be ignored and that the circumstances of the temptation are so unusual that the ordinary presumptions are not helpful. In other ~ ords. one might have a really sincere and insoluble doubt whether he is here and now in the state of mortal sin. Even in this case confession is not obliga-tory; but if one does not wish to go to confession one should make an act of perfect contrition before receiving Communion. Ac~ording to some good authors even the act of perfect contrition is not str_ictly necessary; but it is hard to find any sound reason for this opinion and I viould-not sponsor it. On the. other hand. many, if not most. authors think that confession is generally advisable in these cases of insoluble doubt. For myself. I would be very slow to recommend the special confession of doubtful sins except to persons who might need this'as a means of corr.ecting a proneness to laxity. III. In cdrtain extraordinary circumstances it is'su~cient to regain grace before receit)ing Communion by making an act of perfect con-trition. A problem proposed to Father Michael O'Donnell (Moral Ques- 1:40 Meg, 1953 tfons, p. ,2,70) can aptly introduce the pCrOeNs~eEnSt$ 1sOecNt BioEnFO. TREh CeO pMrMobUlNeImON concerns a person who d d an impure action and was heartily sorry for doing so, and wanted to keceive Our Ble'~ssedLord the following morning," This person evidently had no opportunity to go to con-fession: hence be made an act of perfect cqntrltlon 'and promised Our Lord he would go to confession'at the first opportunity and tell that sin of impurity and fulfilled that promis~e a few days later." He now wants to know whether he did wrong an going to C6mmunion. This is a very human problem. One can almost feel the anxiety of the questioner. Father O Don-_ewl rlgbtllv sets b~ m:nd at r~st by saying that. since he acted in good faith. He has n6 need to worry. It is one thing to decide wh&her one has beech guilty of sin, another thing to tell one what to do in the future. I~ cannot be repeated too . often that past actions arenot to be judged by present knowledge. Many of us have done things in perfectly gobd faith which we later learned were forbidden. In acting thus we ~ere not guilty of sin: in fact we may have been highly pleasing to God because we ~lid what we thought was righf under the circumstadces. So, too, we may have done things in a sort of perplexed state i~n which .we did the best we could to decide what was right and then d~d it. but with a sort of vague anxiety. This is not ,what aut, bors referIto when,, they coffdemn acting "in practical doubt.' The °practica1~lldoul~ter is not merely troubled by a vague worry or perplexity; he is one who has a serious reason, for questioning wh~tber what he is about to do is sinful and then, witl~out forming his conscience, be does' it Xnyway. I call attention to this principle that pas~ acti6ns are n~t to be judge.d by present knowledge, because it is n~t entirely unlikely that some readers of this article may have had an experience similar to Father O'DonnelI's questioner. Lacking a ~lear knowledge of the law of confession before Communion, they may have received Co}n-reunion without previous confession in some. instance in which, ac-cording to the explanation given here, they were not justified in doing so. Let them be content to use the new knowiedge as a guide for the future and not make it a cause of anxiety abou~t~tbe past. Many laws admit of exceptions by reason of some extraordinary circumstances or combination of circumstances[ Thus, a mothek who must care for a sick child is excused from Slunday Mass; the "poor who live on what they receive from others are excused froin tb~ law of abstinence; and so forth. The law pr~scri'bing cbnfession before Communion also admits of exception; but the" Church considers ~bis 141 GERALD KELLY Reoteto [or Rehgtous matter of such importance that she officially declares just what cir-cumstances constitute the exception. For a legitimate exception there must be a combina~tion of two extraordinary circumstances: (1) im-possibility of going.to confession; and (2) necessity of receiving Communion. Both conditions must be verified. And both need some expla~nation. 1. Confession lmpbssible. Authors generally illustrate this matter with the example of person who is0 already kneeling at the Communion rail before he realizes that he should have gone to confession. It is clear that if he is to receive Communion now (whether 'that is necessary will be ¯ treated later), then coflfession before Communion is impossible. He ~annot stop the priest.at the altar rail and say: "Will you please bear my confession before giving me CommuniorL" " F~ther Edwin F. Healy, S.2., in Christian Guidance (p. 105), uses the example of a father of a family who has planned on receiving Communion with his children on their mother's anniversary. ,He intends to go to confession before Mass, but when they reach the church they find that the onlh, priest of this parish is already begirt-ning Mass. As Father Healy points out, it would be out of the question for the man to leave the church and go elsewhere to con-fession if he is to receive Communion with his family at this Mass'. Example~ of inability to get to confession are not limited to these last-minute cases. The impossibility might last for some tihae, espe-cially in a small town when the pastor is absent and when inclement weather or lack of time would prevent one from going to another town. Moreover, there can be cases in which a priest can be reached yet, confessi6~ is impossible: _for example, if the priest Would not hear the. confession, perhaps because of scrupulosity. Or the only available priest might be one without tl'ie faculties to hear confessions. This would not be very common in our country; but it could happen, for instance, in the case of'a priest who would be outside his own dio-cese. And it would be more common in some countries where it is customary to,limit the jurisdiction of young priests to a certain class of persons. At the time of the Council of Trent the limitation of confes-sional faculties was not at all uncommon: hence cases in which an available priest migh~t b~ able to hear one's confession were not rare This seems to be one reason for the rather strange wording used by the Council in declaring the law of confessing before Communion 142 May, 1953 CON~ESSION BEF(~RE COMMUNION / Confession is necessary, it says, if one has a i'co/~ia confessoris." The Code preserves the same expression, "copia ~onfesarii?' The literal meaning of copla is 'a plenty, an abundanc~e," an,d the very use of the expression implies that it might be possible to have a priest pres-, ent, yet no confessor would be available, VaI r.ious authors try to press this idea by saying that confession is neIcessary: if a confessor is present to whom one is obliged to confess: if a suitable confessor is present: if there is an available priest to wh6m one could go to con-fession without grave inconvenience. The foregoing are various ways of sayin~ is present or can be reached confession may bility. I have aI~eady cited two examples cannot hear the confession, and the priest Another example of this practical impossibil case in which confession cannot be made privacy. Still another case, very clear in tF. that,even when a priest be a practical impossi-af this: the priest who who will not hear ~t. ity of confessing is the without the necessary eory but not nearly so clear in its application, is that in. which the very going to confession would create suspicion in the minds of others that one had s~nned seriously. I say this is clear in theory becaus~e such a danger to one's reputation is certainly an extraordinary inconvenience that would, make confession morally impossible. And I ladd that Jr'is not clear in its practical application bechuse the dangelI is more likely to exist merely in the minds of,certain oversensitive in~lividuals than in actual fact. It is sometimes said that this kind of sltuat~on is not uncom-mon in communities of Sisters, so that a Sister1 who would go to con-fession before Mass would be open to suspicion. Perhaps there~are some communities in which such gross unkindness and injustice pre-vail, but we can at least h'ope that they a.re ~ery rare and that they will soon reform. " I Theologians discuss and dispute over what they call "invincible repugnance') attached to goin~ to con~fession to a certain individual. All agree, of course, that the mere d~flicultyI of confession, or the mere humiliation of confessing a serious sin-~iifficulties inherent in "confession to some extent for most people~,w.ould not constitute a moral impossibility of going to confession. The debatable case con-cerns repugnance or embarrassment that arises ?from some kind of special relationship with the confessor. This might be blood rela-tionship.: for example, the confessor 'is one's son or brother. Or it might be a relationship of work: for example, the confessor and peni-tent are working intimately together day after day. Or it might be a 143 GERALD' KELLY Review for Religipus relati0nshipZwif I may use the term--of dislike., For instance, sup-pose that a certain priest clearly dislikes me and loses no opportunity of~showing it l~y bein~g rude,.ridiculing me, and so forth. It is easily seen that I might have a repugnance to confessing a serious sii~ that priest which would be entirely special, entirely different from the difficulty ndrmally experienced in confession. No one holds that these relationships always create "invincible repugnance." But many theologians believe that this psycho!ogical effect is experienced in some cases and,that in these cases there is truly extraordinary inconvenience which amounts to a moral impos-sibility of confessing to that priest. Hence,,the~r wo~Id say that such a priest were the only one ~vho could be reached, confession would be a practical impossibility. I am convinced that these theo-logians are c~orrect: and I believe that St., Thomas. Aquinas would agree with them, too. With reference to a similar question--the ne-cessity of making" the annual confession "to 6ne's own priest"-- St. Thomas recommended great liberality in alldwing people to to other confessors, "because," he said, "many are so weak that they would rather die without confession than confess .to that priest." (Suppl., q. 8, a. 5, ad. 6.) A few otheb cases generally cited by authors as constituting impossibility of confessing are these: the danger of scandalizing t, priest: the danger that confessional secrecy will be abused; the danger of revealing one's accomplice in a sin. Granted that such ~onditions existed, they would make confession morally'impossible: but I think their actual existence would be rare. 2. Communion Necessarg Because" of the variety of situations which mak~ confession moral impossibility, the first condition for the exception to the .of confession before Communion is not entirely uncommon. But second condition is also required--necessity of going to Communion --and this is seldom gerified. To illustrate this condition we might reconsider three of the cases previously mentioned. In the problem presented to Father O'Donnell the questioner apparently had no opportunity of going to confession. But his only reason for going to Communion was that" he "wanted to receive Our Blessed Lord the following morning." This desire, though it may be very strong and though it is very laudable, does not. make Com-munion a necessity. There is a necessity of going to Communion Ma~, 1953 CONFESSIO,N BEFORE COMMUNION' only when abstinence from Communion would be accompanied by' some very extraordinary incorivenience. Another case is that of the person who is. already kneeling at the Communion rail when he realizes that be should have gone to Con-fession. Clearly, as we pointed out, confession is now impossible. And if he could not leave the rail without exposing himself to suspi-cion, there would also be a necessity of communicating: that is, ab-stinence from Communion would be akcom13anied by the extraordi-nary inconvenience of danger to his reputation." Granted that this circumstance existed he could legitimately receive Communion after having made an act of perfect contrition. A third example was taken from Father Healy's Christian Guid-ance. Since Father Healy uses this particular example primarily to illustrate a necessity of communicating, it may be helpful to quote it in its entirety: "It has been the custom for some years, that the whole Baxter family receive Holy Communion on December 12, the day on which Mrs. Baxter died. Mr. Baxter had received Holy Communion the d~ay be, fore at the Sunday Mass and now he comes to church with his grown children. Unfortunately, he committed a serious sin ~he pre~ vious afternoon, and he i~ counting on going to confession before Mass. However, when' Baxter arrives he finds that Father Treacy, the only priest at this church, has already begun the prayers at ~he foot of the altar. Baxter cannot pretend that he violated the Eucha-ristic fast, for his children know that he did not. ' He cannot feign sickness, for he is obviously in the best of health. Unless he receives Holy Communion, his family will conclude that he is in the state of mortal sin." Father Healy comments: "Given these circumstances, Mr. Baxter may make an act of perfect contrition and licitly go to Holy Com-munion at this Mass." I believe that theologians would generally agree with this solutidn because the drcumstances all build up to an entirely exceptional situation--a situation which not only excludes the possibility of confession but also .makes abstinence from Com-munion a source of extraordinary inconvenience. And if the case were changed so that the children were young, instead of grown up, there might be the added factor of danger of bad example if the father were to abstain from Communion in the cir~umstances de-scribed. A case in which similar circumstances might prevail would be a wedding, when the bride and groom had planned on receiving GERALD KELLY ~ Review for Religious Co.mmunion together it the NuptialMass. It may be taken as a sound working 15rinciple that if abstinence from Communion would jeopardize one's reputation or give bad example, then Communion is necessary, in the sense of canon 856. But as I suggested,with reference to confession, it is easier to enunciate a principle like this thin to-judge its practical application. It is sometimes said, for instance, that these inconveniences are apt to ex-is't in a convent, or when Sisters go to Communion daily in the parish church, or when they receive Communion with the children on special occasions, such as the First Friday. We are dealing here with a question of fact, and I certainly would not want to be dogmatic m affirming or denying the existence of the conditions. If they exist, they constitute a necessity of communicating. But clearly the Church d6es not want them to exist; and there is no valid reason why they should exist, because occasional abstinence from Communion is cer-tainly not a ~ound basis for either suspicion or scandal. All theologians say that the mere desire to receive Communion does not rfiake Communion a riecessity. In other words, the sorrow felt by a devout person who is deprived of Communion is not an extraordinary inconvenience in the sense of canon 856. This is un-doubtedly true when the omission of Communion would be required foronly a day or two. But I think there is room for an easier judg-ment in the case of a devout daily communicant, e~pecially a reh-gious, who might have to omit Communion for a rather l~ong time. I am thinking 15art~cularly of an earnest religious who might very rarely commit a serious sin and who on one of these rare "occasions might be in circumstances in which confession would be impossible for a week or so. I believe that abstinence from Communion during all that time would constitute an e~traordinary hardship for such a religious a hardship of such an exceptional nature as to constitute a justification for receiving Holy Communion after regaining grace through perfect contrition. This case is admittedly rare; but it can happen, especially in some rural districts. Throughout this present section I have tried to~ stress two points: first, that the combination of circumstances demanded by the latter part of canon 856 ~should be seldom ~erified; and secondly, that it can be verified occasionally, even in the case of religious. But when-ever a religious finds that these exceptions are frequent, there is some-thing radically wrong a situation which should not exist andwhich must be corrected. In this regard, I should.like to refer to a question 146 ! May, 1953 ~ONFESSION BEFORE COMMUNION answered inan earlier number'of this REVIEW (V, 70-71) that con-cerned a young Sister with aproblem that called for frequent con-fession. She was in a islace where such frequent confession was prac-. tically impossible and she thought that "frequent abstaining from Communion. especially as this might often be for several days a~ a time, would enable others to suspect her trouble." I believe that the answer we published at that time bears repetition here! "It is not easy to answer a problem like this in a few words; but we can give a general idea of the points that must be considered. An occasional emergency when Communion is judged necessary and con-fession is impossible is understandable and might occur in the life of almost anyone. But a state of affairs that makes such emergencies more or less habitual ought to beremedied. Ii~ the case referred to in the question, the religitius should ask for a change of reside~ace that .would enable her to confess when necessary and to obtain competent dire. ction concerning her problem. If she cannot bring herself to ask for the change and is unabld to cle~ar up the problem, she ought seri-ously to consider whether she has the requisite qualities for leading the religious.life. Decisions like this ought to be made while religious are still young. If some problems are not faced, and settled in the early years of the religious life they can eventually reach a point where a satisfactory solution is practica'lly impossible." , The change of residence suggested in this answer can hardly be made jtidiciously unless thesuperior is given some information as to the nature of the problem. (Cf. REVIEW FOR RELIGIOUS, VI, 242- 47.) Humility, therefore, is a requisite for the ~eligious: but need-less to say a religious who is unwilling to practice such humility when salvation itself might be concerned has lost his sense of values. On the other hand, the superior should be approachable, sympathetic, and very careful to observe, strict secrecy. IV, Precautt'ons to be taken to avoid the unnecessary use o[ excep-tions to the ordinary law o[ con[ession be[ore Communi, on and to guard against sacrilegious Communions. Under date of December 8, 193 8. the Sacred Congregation of the Sacraments issued an instruction for local ordinaries and majo~ reli-gious superiors which called attention to the fact that frequency of Communion could le]d to diminished esteem, for the Blessed Sacra-ment and that reception in groups could lead to sacrilegious Com-munions. The purpose of the instruction was to outline a number of steps tobe taken to preclude these evils. There is a complete English 1417 GERALD KELLY version of this instruction in Canon Law Digest, II, 208.-15; an out-line in REVIEW FOR RELIGIOUS, III, 268-270. In the same number of the REVIEW (pp. 252-67), is a commentary on the instruction by Father I~mile Bergh, S.2., together with some notes by the editors and some references to other commentaries. Since these various ref-erences cover the matter completely, I shall conclude the present article with only brief references to some of the main precautions. The first precaution is t~ give proper doctrinal and ascetical in-struction regarding the Holy Eucharist. This kind of instruction should engender a profound esteem for the Blessed Sacrament, a de-sire to communicate frequently arid worthily, and a wholesome abhorrence of sacrilege. Through such instruction one would see that daily Communion is a great privilege, but not a necessity Moreover, though Communion is not reserved to the saints, it does suppose a minimum disposition of freedom from mortal sin, and nothing justifies its conscious reception in this state. And although One need not have tl~e most perfect motive, such as disinterested love of God, one should have a supernatural .motive, such as the desire to avoid sin, preserve grace, grow in grace, and so on. Should instruction be given, not only about the necessityof re-gaining grace through confession, but also about the exception which permits .the reception of Communion with only an act of perfect cbn-trition? If one were to judge from some of the religious texts I have seen, one would conclude that the faithful are to be told only about the necessity of confession, and nothing about the exceptions men-tioned in canon 856. This does not seem ~air. If the faithful are obliged to keep a law, they are entitled to know what the law means, how seriously it obliges, and wh~t are at least the more common legitimate exceptions. I admit that this has to be adapted to the age of the people. Yet surely even a child can be taught that if he com'- mits a mortal sin he should go to confession before receiving Com-munion, but if he cannot avoid going to Communion and cannot get to confession, then he should make an act of perfect contrition before Communion. He migh~ also be told that if ever he should have to do this, it would be well for him to explain the case in the next confession and see.whether the confessor would want to 'give him some advi~ for the' future. A second precaution is to provide ample opportunity for confes-sion before Communion. For religious in particular this means safe-guarding the liberty of confession as granted in the canons: and for 148 May, 19~3 CONI~SSION BEFORE COMMUNION parishes, schools, institutions, and religious houses,, it means that whenever it is feasible a confessor-should be available before Mass. This latter provision should certainly be very helpful in larger con-vents, but I do not clearly see how it would be either convenient or effective in some very small convents. A third precaution is to avoid practices that make it difficult for individuals to abstain from Comfiaunion. It is ordinarily not pru-dent, for instance, for ateacher to say to a pupil, or a superior tb a subject: "What's the matter--are you ill? I noticed you didn't go-to Communion this morning." Also, if a "general" Communion is bad, it should be in such a way that no one feels obliged to go or tl~at no attention will be called to those who do not go. So, too, prizes are not to be given for frequent Communion, and contests that highlight ¯ the reception of Communion by individuals should not be had. As regards circumstances that make it difficult to abstain from Communion, the instruction, referring especially to the effect of these things on young people, said there should be "no rigid and quasi-military "or~ter in coming up, no insignia to be worn by those who receive Communion, etc." Some commentators have inferred from this that communities of religious women ought to abandon their custom of approaching the Communion rail in a certain order. Some have put this rather strongly, ~as if the instruction demanded it. One of the milder comments runs as follows: "It would certainly be praise-worthy and accord.in.g to the spirit of the Instruction if the rigid and almost sacrosanct order of aproaching, the communion rails (Mother Superior, the Assistant, the senior nuns, etc.) were abolished: in con-vents human respect may do more mischief than in men's communi-ties." No doubt, good might come from dropping the order of preced-ence; but I do not shar the great enthusiasm of some writers about its possible good effec.ts. For one thing,1 a large number of otir ~reli-gious are' in small communities, where abstaining from Communion wouldbe noticeable no matter what order or lack of order prevailed, And even as regards larger communities, I wonder how long it would take, after the prescribed order of precedence had been dropped, for the religious to establish their own order. Most. of us are confirmed routinists. Give a community .enough time--and I doubt whether much time would be requ.ired-v-and one would note that the same ones go to Communion first, the same ones go las~, and of course the" same ones are'in the middle. Perhaps I am wrong. But if I am 149 GERALD KELLY .right, then the best precaution is notin the "mechanics" of going Communion, but in the general cultivation of a mental attitude which allows everyone liberty of spirit, both in going to confession and in abstaining from Communion. NATIONAL EQUIVALENTS FOR."I0,000 GOLD FRANCS" According to the announcement of the Congregation of Religious (see p. 150) the official equivalents of l O,O00 gold francs or lire for the principal countries are North and Central America 5,000 American dollars Argentina 100,000 Argentine pesos Belgium 250,000 Belgian francs Brazil 150,000' Cruzeiros Canada 5,000 ~ Canadian dollars Colombia 15,000 Colombian pesos Egypt 2,000 Egyptian pounds France 2,000,000 Franch francs Germany 20,000 German marks Great Britain' 2,000 Pounds sterling India 25,000 Indian rupees Italy 3,000,000 Italian 1ire Netherlands 20,000 Dutch guilders Philippines 15,000 Philippine pesos Portugal 150,000 Portuguese escudos Spain 200,000 Spanish pesetas Switzerland 20,000 Swiss francs Turkey 20,000 Turkish life Uruguay 15,000 Uruguayan pesos Venezuel~ 15,000 Venezuelan bolivars Countries not listed above should take as their norm the value of a neighboring country which is found to be in analogous conditions. :PROCEEDINGS OF CATHOLIC THEOLOGICAL SOCIETY 'At the seventh annual convention of the Catholic Theological Society of Amen'- ca, which was held at Notre Dame, Indiana, 3une 23-25, 1952, the following sub-jects were presented: "On the Essence of the Sacrifice "of the Mass," by Emmanuel Doronzo, O.M,I.; "The Common Good and the Socio-Economic Order," by Ger-ald Kelly, S.3.; "The Problem of Theology for the Laity," by Charles E. Sheedy, C.S:C. : "The Physician's Duty to Preserve Life by Extraordinary Means," by ,John A. Goodwine; and "The Current Protestant Critique of Catholicism in the Umted States," by Msgr. Thomas 3. McCarthy. Copies of the Proceedings are available to clerical non-members at $2.00 per copy. Older from: P. O. Box 24, 3amaica N.Y. 150 The Mys!:ic l Pr yer ot: h' argaret: Mary . A. Herbst, S.3. ST. MARGARET M~RY is one of the great mystics, oi i'fiodern times. On the visions and the revelations she received from Qur Lord is based, historically speaking; Devotion to the Sacred Heart in its modern form. This article will try to illustrate each of the degrees of mystical prayer from her own life and. writings. It should be noted that it is not easy to do this in such a precise manner that the quotation might not also apply to the other degrees. Let me preface a few remarks. ,In the first place, we ought not look askance at, be suspicious of. or afraid of the mystics.There really is nothing wrong with them nor with mysticism.'. Those who are humble and obedient, and keep in touch with their spiritual director need have no fear of becoming_psychopathic or of being deceived by the devil. Secondly, visions, levitation, and the like are merely acci-dental phenomena of the mystical life. They are not at all necessary to a life of infused prayer. Thirdly,, one who has lived a fervent re-ligious life for a.period of years ought to be ready for infused or mys-tical contemplation if God chboses to raise him to it. It is the "logi-cal," but not the necessary, sequence of acquired contemplation. Father Poulain, the author of the well-known work, The Graces of Interior Pra~ler, defines infused contemplation: "Those supe~- natural: acts or states which no effort or labour on our. part can suc-ceed in producing, even in the'slightest degree or for a single inst~lnt, are called mystical." They are.infused, poured into the soul as a pure gift of God, without our being able to attain them by our own efforts. 'This .is higher, ex, traordinary contemplation. We cannot soar to'these heights without the wi,ngs God furnishes. He determines when, how, and for how long it is to be given. It is passive prayer: the soul no longer takes the initiative, but God fastens its attention lovingly onHimselfl The s0ul is not idle though. It is intensely active under the operation of grace. It is a special kind of knowledge of God which lies somewhere between the knowledge of faith and the b~atific vision and shares in faith's obscurity. It really baffles descrip-tion and has in it mysterious suffering and intense happiness. It is an intellectual experimental knowledge of God. 151 C A HERBST Reotew for Rehg~ous St. Margaret Mary describes it: "I felt Him always near me, as one feels himself near another at night but cannot see him because of the darkness. The pdnetrating eyes of love make me see and feel Him in a most loving and certain way, and under various aspects . .This infinite grandeur encompasses me with its power and so takes posses-sion of mine and of my whole body and soul that I think I can say that I no longer have any power over myself." (Letter 1~3.~) The first degree or state of the mystical union is the Prayer of Quiet. Here God takes over the higher faculties of the soul, the will and the understanding, but leaves the imagination and the exterior senses free. Therefore there can be distractions. The soul experiences God's presence and reposes joyously in it, but only f.or very brief pe-riods of time. As an initial stage of this prayer of quiet there is the First Night of the Soul, or Night of Sense. In this the one domi-nating thought or idea of the prayer of simplicity is intensified, there is habitual aridity and a great, anxious y~arning for God. The dis-taste for things of sense grows and God works gently and almost un-noticed on the soul in a special way. A characteristic of this Night is inability to follow set forms of prayer. St. Margaret Mary says: "I did my utmost to follow the method of pray, er and other practices which were taught me, but I was not able to retain anything. It was in vain that I read my points of meditation, for all variished from my mind, and I could neither learn nor retain anything except what my Divine Master taught me." (Autobiography, No. 47.) The second degree of mystical prayer is the Prayer of Full Union. Now God takes over not only the will and the intellect but also the imagination and interior senses. Therefore there are no more dis-tractions. The soul is fully occupied with God. St. Margaret Mary describes it well when she says that God "presented Himself to me in the mystery in which He desired me to consider Him, applied my mind so closely to it, and kept my soul and all my powers so ab-sorbed in Him that I felt no distraction . . . being then so absorbed in prayer that I never felt weary" (Ibid., No, 12). , Any doubts or fears of being deceived are gone now. God's presence is ?xperienced "in a manner so real and sensible as to be beyond all doubt, by reason of the.effects which this favour produced in me, fearful, as I always am, of deceiving myself, in anything that I say of what passes in me" (Ibid., No. 53). .In this degree there is "profound peace, joy, and satis{action" (Letter 133). It is sometimes called the semi-ecstatic union. The exterior senses continue to act and one can, therefore, 152 Ma~ , 1953 PRAYER OF MARGARET MARY though with great effort, cease from prayer. Th third state of infused contemplation is the Ecstatic Union or Spiritual Espousals. Now not only the interior faculties are absorbed in God but the activity even of the exterior senses is suspended. .The whole person, body and soul, is taken over by God. The body be-comes fixed and rigid as though dead. ,Communication with the ex-terior world is all but severed. The power of voluntary movement ¯ is gone. One cannot emerge from this state at will, but only when God determines or at the command of a superior. Since St. Margaret Mary was a great ecstatic, she can describe this state for us. "I felt myself wholly penetrated with the Divine Pres-ence, but to such a degree that I lost all thought of myself and of the place where I was, and abandoned myself to this Divine Spirit, yielding up my heart to the power of His love" (Ai~tobiography, No. 53). "On orie occasion . . . feeling wholly withdrawn within myself by an extraordinary recollection of all my senses and powers, Jesus Christ, my sweet Master, presented Himself to me" (Ibid,, No. 55). "After such a signal favour which lasted for a long time, I remained for several days,.as it were, on fire and inebriated (with divine love) and so completely out of myself, that I had to do my-self violence in order to utter a single word" (Ibid., No. 54). "I lost all cor;sciousness during that time and I no longer knew where I was. When they came to withdraw me, seeing that I could make no reply, nor even stand except with great difficulty, they led me to Out Mother. On seeing me thus, as it were, completely beside myself, all burning and trembling on my knees before her, she mortified me to the utmost of her power, which pleased me and filled me with incred-ible joy" (Ibid., No. 58). Let it be remarked that the Pray.er of Quiet, the Prayer of Full Union, and the Prayer of Ecstatic Union are but three degrees of the specifically same grace of supernatural prayer. In the Prayer of Quiet the .union is incomplete, weak, doubted, obscure. Inthe Prayer of Full Union there are no distractions and the whole interior is taken up with God. In the Prayer of Ecstatic Union even the exterior man, the senses, are captured and absorbed in God. These are three degrees of infused contemplation: weak, medium, energetic. The transitions b.~tween them are imperceptible, much like the colors in the rainbow. It is different with the fourth and highest degree of infused prayer, the Transforming Union or Mystical Marriage. This differs 153 C. A. HERBST Reoieto for Religious specifically, not merely intensively, from the other three. Before entering it the soul must go through the Second Night, or the Night of the Spirit. ' Since mystical marriage is permanent whereas the th~ree preceding stages are transient, thesoul must be profoundly and ~adi- . tally purified from all its habitual, and actual imperfections. The poor, weak soul is dazed and pained by the bright light of God much ag the eyes of the body are by looking into the sun. Green wood must be dried out and blackened by fire before it itself will become inflamed. The sufferings of this Night are terrible. St. Margaret Mary says: "His sanctity is in~xorabl~, and it seems to me there is no suffering more exquisite than that through which He makes a soul pass when'He wants to purify it in order'to corn-, muica.te'Himself to it" (Letter 132). Yet the soul is not disturbed and is perfectly conformed to God's will. ""Yet I suffer all this with perfect serenity, content to cling to His holy will. If only He is con-tent I am satisfied" (Letter 135). The mind and will, the whole soul, even the body, is in anguish. "My whole being, body and soul, is plunged jn suffering., desiring only what is pleasing to my Sovereign Who is sacrificing me, before Whom I am a sighing victim immolated to divine justice" (lbid). But the soul has a great Sense of security. "I sometimes think that all hell is let loose against me to annihilate me, so fiercely am I attacked on all sides. But I am not afraid, deeply intrenched as I am within my strong fortress which is the divine Heart of my divine Master" (Letter 136). The soul is strong, too, and all aflame with the love of the Divine Spouse. But to return to the Transforming Union. Being a mystical marriage, it is most intimate. "I felt myself .wholly penetrated w~th that Divine Presence, but to such a degree that I 'lost all thought of myself and of the piace where I"was, and abandoned myself to this , Divine Spirit, yielding up my heart to the power of His love. Her made me repose for a long time upon His Sacred ~Breast, where He' disclosed to me the marvels of His love and tbe inexplicable secrets of His Sacred Heart, which so far He had concealed from me." (Auto-, bioqrapby, No. 67). The soul is serene in its perfect enjoyment of, God. "My heart is so centered there that it finds repose only if it can enjo, y Him continually: [ was made just for that" (Letter 133). .And, like marriage, this union is indissolul~ie. "And when you com-mit some fault, I shall purge it away with suffering if you do not do 'it yourself with penance. I shall never.deprive you of My presence on that account, but I will make it so painful for you that it will, M~, 1953 take the place of every other torment" (Ibid.). These are the char-acteristics which put thi~ highest degree of infused contemplation in a class by itself. Habitual imaginative visions of Christ may occur in this state. St. Margaret Mary narrates one. "Feeling wholly withdrawn within myself by an extraordinary recollection of all my senses and powers, Jesus Christ, my sweet Master. presented Himself to me. all resplend-ent with glory, His Five 'Wounds shining like so many suns. Flames issued from every part of His Sacred Humanity especially from His Adorable Bosom. which resembled an open furnace and disclosed to me His most loving and most amiable Hefirt, which was the living . source of these flames. It was then that He made known to me the ineffable marvels of His pure (love) and sho(ved me to what an ex-cess He had loved men." (Autobiographg, No. 55.) Visions'of the Blessed Tr.inity are in place here, too. "The Three Persons of the Adorable Trinity presented themselves to me and filled my soul'with inexpressible'consolation. But I cannot well explain what then occurred, except that it seemed to me the Eternal Father presented, me with a very heavy cross beset with thorns and sur-' rounded with various instruments of the Passion and said to me: 'See, My daughter, I make thee the same present which I made to My Beloved Son.' 'And I,' said Our Lord Jesus Christ, 'will fasten thee to the crbss as I Myself was fastened to it and will bear thee faithful company.' The Third Adorable Person then said that, being Love Itself. He would purify and consume me thereon. My soul was filled with unutterable peace and joy, and the impression made upon it by the Divine Persons has never been effaced." (Ibid., No. 59.) This highest form of prayer here on earth brings with it an in-satiable thirst for suffering. St. Margaret Mary had this, too. "I will only sa~; that it has given me such an intense love of the cross that I cannot .live a moment without suffering, but suffering in si-lence, without consolation, alleviation or compassion, and in fine dying with the Sovereign of my soul, overwhelmed .by the cross of every kind of opprobrium, of sorrow and of humiliation, forgotten and despised by all." (Ibid., No. 50.) To sum up. After purifying the soul b~r habitual aridity and an anxious yearning for ,God in the Night of Sense, God takes over the highest part and makes it repose joyously' in Himself in the Prayer of Quiet. In Full Union the imagination and interior senses are also 155 QUESTIONS AND ANSWERS l~eotew ~or l~eltgtous taken so that ~here are no more distractions and the soul is fully oc-cupied qcith Him. In E.cstatic, Uriion the outer senses, too, are wrapt in God, and the whole person, body and soul, is united with Him Finally comes the indissoluble bond of Mystical Marriage, in wh,ch the soul enjoys the mbst intimate union with God possible in this life, a foretaste of the beatific vision. II In an institute in which the. novitiateiasts for two years~ may the first profession be made on the recurring date (two years later) of admission to the novitiate, or must it be postponed for an additional ,day7 For example, a novice is admitted to the novitiate on August 15, 19S3. May he /hake his profession on Au~cjust IS, 19SS, or must he wait till August 16, 19S57 I understand that if there were question of a one-year novlt[ate, profession could not be made till the lapse of one year plus one day. If the same rule does ;not hold in the case "of the two-year novitiate mentioned above, what is the reason for the discrepancy7 A general rule is that the provi.gions of the constitutions are to be observed. Sometimes a provision touches upon the validity of an action. If the constitutions explicitly require two complete years of now-tiate for t~alidit~, then such provisiqn 'would have to be observed for the validity of subsequent profession. In that case, if the novitiate is begun on August 15, 1953, first vows could not be taken until Au-gust 16, 1955. The reason is that entrance to the novitiate is not made at midnight. Consequently, according to canon 34, § 3, 3% since the day of entrance is not counted, the two years of novitiate .would be completed (provided there had been~no canonical inter-ru]~ tion nor suspension of the novitiate) only at midnight between August 15 and 16, 1955. Hence first vows could not be taken until the day following the anniversary date of entrance to the novitiate. Aside from such particular law, the common law as expressed m canon 555, § 1, 2° of the Code, requires only one complete, unin-terrupted year of novitiate for validity. ,Just as in the supposition above, first profession therefore cannot be made onthe anniversary of entrance to the novitiate, but the novice midst wait until the follow-ing day, under pain of an invalid profession. 156 Ma~, 1953 QUESTIONS AND ANSWERS If the constitutions of an in~stitute prescribe more than one year of novitiate, the extra time is notrequired for the validity of the pro-fession, unless the constitutions expressly declare otherwise (canon 555, § 2). The added time (in Our case, one year) would be for licitness but not for validity of subsequent profession. Custom and superidrs then would' be the best interpreters of the requirements of the constitutions on the point of whether first profession is to be made on the recurring second anniversary of entrance to the novitiate or not until the following day. In either event in this last supposi-tiom neither ~ractice would affect the validity of the profession. This explains why first profession after a two-yea,r novitiate often'might be made on the anniversary of reception into the noviti-ate, while it cannot be made thus after a one-year novitiate. --12m Some religious are of the ol~inlon that certain community prayers, such as the rosary, meditation, and the like, are to be interrupted to say the Angelus as soon as the Angelus bell is rung. Must this be done, or would not the mere recitation of the Angelus prayers three times a day suffice to gain the indulgences? The 1952 edition of the official collection of indulgences, the Enchicidion Indulgentiarum: Preces et Pia Opera, states that the faithful may gain the indulgepces attached to the .recitation of 'the Angelus if 'they recite the prayers at dawn, at noo~n, anal at eventide, or" as soon after these times as they can (no. 331). It is not necessary to~interrupt the rosary, meditation, and the like, in order to say the Angelus as soon as the bell is rung. Is it proper to seat the st,',dents at Mass according to whether they will receive Holy Communion or not? It has been the practice to designate certain sections for those who are going to. Holy Communion and other sections for those who are not. Thereason for such procedure is to obtain order. In its reserved Instruction on precautions to be taken against abuses in the daily reception of Holy Communion (the complete English text is in the Canon Law Digest, .II, pages 208-215), the Sacre~d Congregation of the Sacraments in 1938 remarked that "the danger ofreceiving Communion unworthily.is increased when the faithful, especially the young, approach the Holy Table; not singly but generally and in a body a.s. .happens.frequently 157 QUESTIONS AND ANSWERS Reuteto [or 'Rehgto,,s in colleges and institutions for the training and education of Chris-tian youth." (Canon Law Digest, II. 209). Again, "When Holy Communion is being received, all those things are to be avoided which create greater difficulty for a young person who wishes to abstain from Holy Communion, but in such a way that his absti-nence will not be noticed: hence there should be no express invita-tion, no rigid and quasi-military order in coming.up, no insignia to be worn by those who'receive Communi6n, etc." (ibid., 214). The observance of order is, of course, a worthy motive. How-ever, the purpose of the Sacred Congregation, as manifested in its Instruction, is to safeguard the worthy reception of Holy Commun-ion by discouraging anything which would make communicants con-spicuous. Seating communicants in a special place makes them con-spicuous. ml4-- "The Mother General holds the first place in all the houses of the Community. Then follow the Members of the Council in the order of their election; ~hen the Secretary General, unless she is a member of the Coun-cil, and the Adminlstratrix General, in the Motherhouse: in other houses these latter take their rank after the Superior ,of the house." What is meant by these latter? Does it refer to the last two Offices mentioned, or does it refer to the Council Members also? Ira Council Member visits one of the houses where the Sisters are stationed, does she take .precedence over th'e Local Superior who is only an appointed person while the Council 'l~lember was elected? In part canon 106 says that: 1. One who represents another enjoys the precedence that per.son has. But anyone who is in a council or similar me~ting as a proxy yields precedence to those of thesame rank wh~ are personally present. , 2. A person who has authority over other physical or moral persons has right of precedence over them. These are general norms. The highest superior of the institute, therefore, always and everywhere has precedence over all his subjects If someone represents him, that person likewise enjoys the precedence of the superior represented. Provincial and local superiors have pre-cedence in their territory or houses, unless a higher superior or h~s proxy is present. In regard to other officials, there is great divergence among different religious,institutes. "In ~ach case the constitutions or else legitimate custom will have to be considered. 158 QUESTIONS AND ANSWERS In our specific case, the general councillors are being considered in their proper role, and not as proxies. Do the constitutions give them precedence over local superiors in the latters' houses?' It is not clear that.they do, since the ouestioned words these latter might be inter-preted as ~ivin~ or denying such precedence. (As a matter of fact, in some institutes b~r a clear provision of the constitutions general coun-cillors have such precedence, especially in more recent congregations; in others they do, not.) Since the constitutions do not seem t6 settle the matter clearly, the solution would be sought in legitimate cus-. tom, which in this case~ would mean the way in which the,disputed phrase of the constitutions has been habitually interpreted, If 'no such consistent interpretation exists, it seems that the" words these latter refer to the secretary general and theadministratrix general, so that councillors general would take precgdence over local superiors even in the farters' own hoi~ses. ! Is it absolutely necessary that the entlre'concjrecjatlon turn and face each station of the cross in order to obtain all of the indulcjences attached to that pious exercise? Ordinarily a person making the stations of the cross must movg from station to station ai part of the requirement for gaining the in-dulgences attached to that exercise. When t.here is question of a large group of people, however, confusion or disorder might result from so many moving about. The Sacred Congregation of Indulgences on August 6, 1757, decided that in that case the method proposed by St. Leonard of Port Mafirice for making the stations is to be used. According to this method the people remain'in their places, while a priest.with two acoly'tes moves from station to station, stopping ~it each to recite the customary prayers to which the faithful reply. This decree was reaffirmed in a response from the Sacred Penitentiary, March 20, 1946.(A.A.S., XXXVHI [1946], 160). In connection with the foregoi.ng method of making the stations, the Subsecretary for the Section on Indulgences in the Sacred Peni-tentiary, Serafino de Angelis, in his book De lndulgentiis (1946): n. 341 b, remarks that the' people are to be advised, while remaining in their places, to face each station, rise, genuflect, and recite the pray-ers. From this one would conclude that, when the way of the cross is being made according to the method of St. Leonard of Port Mau-rice, it is not absolutely necessary for the.entire congregation to face each station in order to gain thedndulgences. 159 . QUESTIONS AND ANSWERS The use o~ St. Leonard's method has b~en extended by several official pronouncements (one of these: the reply of the Sacred Peni-tentiary mentioned above) to the members of religious institutes in like circumstances in their chapels. In such circumstances only'one religious, man or woman as the case may be, moves from station to station. By its response of March '20, 1946, the Sacred Peniten-tiary recognized this method also for use in boarding schools and the Will you kindly tell me how many votes constitute an "absolute major-ity" in a house of thirteen vocals7 Also how many votes constitute a "rda-tlve majority" in the same house? When there are thirteen valid votes, seven of them constitute an absolute majority, since such a majority is effected by any number exceeding one half the number of valid votes. A relative majority is had by a candidate who receives more vahd votes than any other candidate, but less than all the others taken to-gether. Thus in our case if three'candidates received respectively six, four, and three votes, the candidate with the six votes would have a relative majority over the other two candidates. What five scapulars comprise thefivefold scapular? The following scapulars are popularly known as the "fivefold scapular" or the "five scapulars." 1) The brown scapular of the Blessed Virgin Mary of Mount Carmel: proper to the Carmehtes, the best known of all the scapulars. 2) The wfiite scapular (with a blue and red cross) of the Most Holy Trinity: proper to the order of Trinitarians. 3) The red scapular of the Passion of Our Lord Jesus Christ: pr6per to the Congregation of the Mission (Lazarists) 4) The black scapular of the Seven Dolors of the Blessed Virgin Mary: proper to the order of the Servites of Mary. 5) The blue scapular of the Immaculat~ Conception: proper to the order of Cler,cs Regular (Theatines). HOSPITAL CONFESSION CARD A plastic-coated Confessio'n Card for the sick, with prayers before and after ,I confession, has been designed by the Rev. Thomas Sullivan, C.S.V., chaplain of St. Luke's Hospital, Aberdeen, South Dakota. It is similar in size and design to the Communion Card (REVIEW, Sept., 1952, p." 248) by the same author, now m use in more than 250 hospitals. Both cards bear the i.mprimatur of Bishop liam O. Brady of Sioux Falls. Each sells at 20 cents and may be ordered from the Presentation Sisters, Aberdeen, South Dakota. 160 Book "Reviews THE SACRED CANONS. By John A. Abbo, S.T.L., J.C.D., and Jerome D. Hannan, A.M., LL.B., S.T.D., J.C.D. Pages in Volumes: I, xxll -k 871~ II, 936. B. Herder Book Company, Sf. Louis, 19S2. Two-volume set, $19.00. "Amon~ other objectives, the work, was begun to answer in some degreeothe spontaneous demand for a better knowledge of ecclesiastical law that has arisen in English-speaking countries among religious who are not clerics and among laymen, especially in the professions.'.' It is from this standpoint that this book is reviewed. After a brief his-torical introdtictioh the learned authors give a statement of the law as contained in the canons of the Code, together with a running commentary. The order of treatment and the division~ of the work are identical with that of the Latin Code, and the numbers of the canons are used instead of paragraph numbers. In the distribution of the matter the authors have made their book especially .useful to non-clerical religious and to the laity. Of the 1800 pages of text con-rained in the two volumes, over 1500 are devoted to the commentary on the three first books of the Code of Canon Law, whereas books four and five of the Code, which are of lesser interest to non-clerical readers~ are taken care of in little more than one hundred pages. Of particular importance is the treatment given tothe seven sac-rament~, which is usually omitted in whole or in part in treatises on Canon Law and transferred to the writers on Moral Theology. 209 pages are devoted to the canons dealing with "Religious" and will" be of great use for religious Brothers and Sisters. All the latest decrees of the Holy See are reported, and there are numerous references to American civil law/especially in the titles concerning church property, An index with over 4500 references, which makes it easy for the reader to find any particular subject, concludes the work. The publisl~ers plan "to keep this commentary up to date by adding, at each reprinting, a supplement containing decisions of the Holy See issued subsequent to the first edition, and these will be available' to purchasers of earlier printings at a nominal cost. The only defect in the book is the lack of a table of contents. While the clerical reader~ will easily follow the canon numbers with which he is familiar from the Latin Code, ,the non-clerical reader has no way of getting a bird's-.eye view of the entire field in order to b~- 161 BOOK ANNOUNCEMENTS ' Re~Jieto fbr Religiou~ come acquainted with it, so that he may choose certain parts for reading and study. Su~ch a table of contents should be added to the next printing, and copies made available to all purchasers of this first edition. , We recommend this book to all religious---especially to religious Brothers and Sisters who will find it a great help in solving personal problems as religious, as well as a source of information in preparing classes in. religion and church history. Not only higher superiors, but every religious communify should have a copy of it. --ADAM C. ELLIS, S.J. BOOK ANNOUNCEMENTS [For the most part. these notices are purely descriptive, based on a cursory examina-tion of the books listed.] BENZIGER BROTHERS, INC., 6-8 Barclay St., NewYork 8, N.Y. The Burning Flame. By Francis Beauchesne Thornton. The story of Guiseppe Sarto, the peasant boy who became the saintly Pope Plus X, told in popular style by Father Thornton, an associate editor of the Catholic Digest. " Pp. 216. $3.00. BRUCE PUBLISHING CO., 400 N. Broadway, Milwaukee 1, Wisc Dear 8istec. By Catherine de Hueck, Brief letters to help Sisters train lay leaders. PI~. 80. $2.00. BIBLIOTHEQUE DU SCHOLASTICAT, L'Immacul&-Conception, 1855,, rue Rachel Est, Montreal .34, Canada. La Virginitd Chrdtienne. ~ By Francois Bourassa, S.J. A full treatment of the subject of Christian virginity, showing its oppor-tunities for full ahd harm6nious development of persgnal perfection. Pp. 174. $1.25. CATECHETICAL GUILD, St. Paul 1; Minnesota. Pocket book editions of You Can Change the Worl
Issue 3.3 of the Review for Religious, 1944. ; MAY 15, 19,44 ~Voi~UME,.III Ri VI, I W' FOR :i I LIGIO,,US .VoLuMEIII :" MAY 15, 1944 ~ NUMBER3 ° ONTENTS GOOD CONFESSIONS AND BETTI~R CONFESSIONS--r ~ 'Gerald Kelly, S.J.' ; . 145 THE-QUEgTION OF VOTING Edwin F. Healy, SIJ . 158 CONCERNING BOOKLETS . . . . . THE CARE OF SICK RELIGIOUS Adam C. Ellis. S.3 . " 1"67 WE SALUTE THEE. MARY'. MOTHER OF GODT William B. Fah~rty, S.3. " ' .,'175 WHO IS THIS RODRIGUEZ? Augustin~e Klaas, S.J. " " 181~ ,TWO HYMNS TO ~MARY" -F~ran¢is N. Korth.-S.J . . 1.92 COMMUNICATIONS .(On Retreats and Vocations) . : 198 BOOK REVIEWS~ (Edited by Clement DeMuth S.3.)-- The Man"from Rocca Sicca: Subdeaconship~ Masyk.noll Mission Let~ .tars: Cardinal Mercier's Conferences: Venerable Vincent Pallotti: "Con- " , ,else Catholic' Dictionary: Lourdes Interpreted by the Salve-Re~ina; Teaching Confraternity Classes: Publlc,Speaking . ! . . ~ ¯ . 204 DECISIONS OF THE HOLY SEE OF INTEREST TO" RELIGIOU~ ~210~ BOOKS -RECEIVED . 2110 QUESTIONS AND ANSWERS 2-1. Redecorating Stations of the Cross . x . '.;. ~ . . . : 212 22. Visit Required for Gfiining Indulgence . 23. Use of Standard Time for Eucharistic Fast . 213 "L24. Voting in Chapter Elections . 214' ' 25. ,Co~frat~rnity of Pil~rim~ " " 2"15 26. Religious Attending Motion Pictures ~. . . : . ". 215 bUR CONTRIBUTORS " ' " . '. ' REVIEW FOR RELIGIOUS, May, 1944: Vol. III, No. 3. PubliShed bbmon~hly: January. March, May, July, September; and November at the,~College, Press. _606 Harrison~Street, Topeka, .Kansas, by St. Mary's College, St. MarTs, Kansas, with' ecclesiastical approbation. E~tered as second class matter January 15, q9~2, at the Post Office, Topeka, Kansas, under'the act of March 3, 1879. Editorial Board: Adam C. Ellis, S.J., G. Augustine~,Ellard, S.J., ~erald Kellyl S~.3,.~ Copyright, 1944, by Adam C. Ellis. Permission is hereby granted for quotations .6f reasonable length, provided due ~:redit be given this review and the author. Subscription price: 2 dollars a year. Printed in U. S.A Before writing to us, please consult notice on ins;de back cover. ood Con essions and Bet: :er Cont:essions Gerald Kelly, S.J. ~'~ELIGIOUS not infrequently exp.eo~ience a vague sense |'r~ of dissatisfaction with their conKssions. They must confess .weekly, generally at a certain time, even though they are not in the mood. At times they must make a rather hasty immediate preparation for confession. Their sins are usually "small sins"; in fact, it is often difficult to fodus on any really, definite sins to confess.A certdin 0 amount of routine seems unavoidable; yet routine confes-sions are strongly condemned by many spiritual writers. Finally, most religious have read or heard of the many advantages of frequent devotional confession, and the~. want to reap some of these fruits ~:or themselves. Yet, despite their holy desires, they sometimes fail to see any good effects of their confessions; they are even inclined to wonder if their confessions are not entirely fruitless. Very likely there is no absolute remedy for a sense of dissatisfaction in those who are striving for perfection. Some dissatisfaction is natural, even helpful. But this holy sense of dissatisfaction is different from discourag.ement, worry, or a vague feeling of uneasiness. As much as pos-sible, the dissatisfaction should be clearly defined, because only then can it be used constructively as a stepping stone to the attainment .of one's ideals. My purpose in the present article is to propose a few rules that may help religious to clafif.y any dissatisfaction they may feel with their confessions ~nd to give some defi-nite direction to their efforts for self-improvement. The" rules enunciate nothing new. No doubt most religious- 145 GERALD KELLY ,. Review for Religious know them well; yet I believe that some fail to apply them and that the results of not applying them .are a waste of effort, a lack Of perfect peace of mind, and sometimes dis-couragement. If all religious, from the novitiate onward, would observe these rules faithfully, they would be'much more satisfied, with their confessions and would reap many definite advantage~ from them. Four Rules In formulating these rules, and in commenting on them, I am limiting the subject to the devotional confession, as this is the type of confession that. religious most frequently make. Keeping this in mind--namely, that we are speaking only of the devotional confession--we can state the rules as follows: Rule I: Be sure to confess, at least ;n a 9eneral way, some real, subjective s;n that you have cerfainly comm;Hed. Rule 2: Have genu;ne, supernatural con÷r;÷;on, a÷ least ;mperfecf, for some s;n ;nclucled ;n your confess;on. Rule 3: Be willincj to accept and to perform anyjustly ;reposed penance. Rule 4: Try to sanctify yourself ÷hroucjh confess;on by cult;vaf;ng a more e~fecfive purpose of amendment. It may be well to call attention immediately to the decided, difference between the first three rifles andthe fourth rule. The first three express minimum essentials; the fourth .expresses an ideal. A penitent who observes the first three rules makes a good.confession; a penitent who keeps not only the first three, but also the fourth, makes a better confession. This is an important distinction. Our. ideal, of course, is to make the better confession; but there is a great deal of consolation and peace of mind in knowing that our confessions are good, even though they could be better. A good confession o~ devotion always produces some grace in the soul. 146 May, 1944 GOOD'CONFESSIONS AND BETTER CON~ESSIONS A GOOD. CONFESSION It would be a wise policy .fob every religious to have a two-fold aim in making hisconfessions: first, to make a 9ood confession by fulfilling all minimum essentials; and °secondly, to make his confession even better by the use of some practicable plan for applying the fourth rule. In keeping with this two-fold aim, I am dividing the remain-der of this article into two parts, which treat respectively of a 9ood confession and a betterconfession. Confession of Sins On the part of the penil~ent, three things are requirgd for the reception of the Sacrament of Penance; confession of sins, contrition, and satisfaction. The first of our rules enunciates the minimum essentials for thd first of these acts. It is certainly not difficult for anyone to fulfill this rule in a d~votional confession. It is sufficient to confess any or all of the venial sins comm.iyted since, the last con-fession, or any mortal sin or venial sin of one's past life: A penitent can even fulfill this rule by alv~ays confessing the same sin from his past life: for example, he once culpably missed Ma~s on Sunday, and since, then, in his devotional confessions, he never mentions anything specifically but that one sin. "There's nothing special since my. last confes-. sion, Father,-" he says week aftgr week,. "but in my past life I once missed Mass through my own fault." Finally, the penitent does not have to do even as much as that in a devo-tional ~onfession. It dan b~ sufficient if he simply includes his sins in a general way: for example: "There's nothing special since my last confession, but I want to include all the sins of my life." ,The repetition, week after week, of the same sin of the past life, without confessing any new matter, is not, of course, the ideal. Nor is it the ideal to make a merely gen- 147 GERALD KELLY Review for Religious~ eral accusation. Yet such accuations are, strictly speaking, sufficient in a devotional confession, provided the.penitent has the requisite contrition--as will be explained in the comments on-the second rule.1 I have referred to such accusations, not to encourage their use, but simply to indi-care how easy it.is to live up to the demands of the first rule. Despite the fact that it is comparatively easy to.observe the first rule, it is also possible for well-meaning penitents-- even religious--to violate it and to make unintentionally fruitless~ confessions. Perhaps a few sample confessions-- entirely fictitious, of course--will serve to illustrate what I- mean. A religious is preparing for confession. To him, as he examines his conscience, the past week looks.biack enough. On Sunday, when he,assisted at Mass he had certainly done everything that the Church requires for the complete ful-fillment of the obligation. Yet he had been no seraph at Mass; he could surely have assisted more.devoutly. On Monday, he had felt a strong inspiration of grace to pass up the butter at one meal: and on Tuesday he had felt an equally strong inspiration to spend a half-h0ur of his free time before the Blessed Sacrament. He had neglected both these divine:"invitations. Finally, despite the fact-that his rule ordered that all. should make their beds before the morning meditation, he had three times ~put off this dis-tasteful action until after breakfast. Of course, 1~is insti-tute states explicitly that merely disciplinary °rules, not involving the vows, do not bind under pain of sin; liuf 1The unnecessary use of the merely generic accusation, without mentioning anything in particular (e.g. "There's nothing special since my last confession,. Father; but I want to include in this confession all the sins of my life"), is particularly to be dis-couraged. By reason of a more or less general custom iri the Church, penitents who make devotional confessions are expected to mention some particular kind of sin, either from their past life or conimitted since their last confession. ~For the benefit of students of theology who might read this article, let me say that in speaking of the confession of devotion I use the words "fruitless" and "invalid" indiscriminately. The valid devotional confession must, I believe, be fruitful. 148 Ma~l, 1944 GOOD CONFESSIONS AND BETTER CONFESSIONS this, he tells himself, is no excuse for him. He enters the confessional and accuses himself as follows: "Since my last confession I was negligent in my prayers; I was ungrateful to God; and I was disobedient. That's all I can remember, Father." Another religious] in preparing for confession, note~ that he has often felt strong resentment against someone who had offended him; that he has 10ad many distractions during meditation; and that 6n one occasion he made a re-mark that hurt someone's feelings. He might note also that the feelings and distractions were not voluntary find that the offending remark was unintentional; yet these excuses do not occur to him. He confesses as follows: "Since my l'ast confession I was uncharitable in thought and speech and was distracted in my prayers. That'll be all, Father." A third religious has had a really trying time of it since his last confession. He has been literally besieged by a strong temptation to impurity of thought; in fact, the temptation has been so strong that he really does not know how he stands before God. He decides to go to confession "just~to be safe." In confession he says: '.'I had a very strong temptation against purity, and I want to accuse my-self in ~o far as I am guilty before God. Th~re's r~othing else bothering me, Father." I have chosen these three fictitious confessions because ."they illustrate defects which, thot~gh very likely uncom-mon, could make a.confession unintentionally fruitless. In the first confession, only imperfections,, not real sins, were confessed. In th~ second confession,, the things mentioned might have been sins, but there was no subjectioe guilt; the uncharitable feelings and distracting thoughts were invol-untary, the offending remark was unintentional. In the third confession there was no certain matter: the penitent may have been guilty of mortal or venial sin, but he may 1,49 GERALD KELLY Review for Religious have committed no sin.at all. All of these confessions are at least probably defective. Yet all could be saved from fruitlessness by the intelligent use of a concluding accusation such as "I include in this confession all the sins of my life"; "I want to include all the sins of my past life"; "For these, and fdr all the sins of my life, especially for . . ., I ask pardon from almighty. God and penance and absolution from you, Father." It is true that accusations like these can become purely mechani-cal and practically meaningless, yet they are infinitely bet-ter than such conclusions as: "That's all I remember"-- which adds nothihg to the confession.; "That'll be all,"-- which sounds like a person burring groceries ; -and so forth. It is hardly advisable to force religious to make subtle dis-tinctions between imperfections and venial sins; but it surely is advisable for all penitents who habi'tu'ally commit only small sins to have some concluding accusation which covers up a.possible insufficiency of matter in their con-fessions. " As I said, these confessions are purely fictitious. If they occurred in real life, a confessor would generally note the.deficiency and ask a question or two that would save the confessions from invalidity. Yet this might not always be ,the case; and penitents should be tiained to make goo.d confesiions independently of questions by the confessor. Contrition The second rule givei the minimum essential for con-trition in the devdtional confession. Here again, it is important to distinguish between the ideal and the essential. Of all the acts of the ,penitent, contrition is the most important; and everyone's ideal should be to have a pro-- found and effective contrition. Yet the confession can be good, even though contrition be far from the ideal. The 150 May, 1944 GOOD CONFESSIONS AND BETTER CONFESSIONS ideal, even in a devotional confession, is perfect contrition; yet imperfect suffices. The ideal is that the contrition extend to all.sins confessed: yet it~ is sufficient if the contri-tion applies to any sin included in the confession.8 The ideal is that contrition be deeply moving, like Magdalen's; yet it is sufficient if the contrition be as unemotional as paying the rent. Important though it is, it is not extremely difficult, to haye sufficient contrition for a fruitful devotional confes-sion. A penitent who has once committed a mortal sin, has repented of it, and now includes that sin in his confes-sion, either by mentioning it by name or by including it in a. general accusation, may take it for granted that he has sufficient contrition if he continues in his good resolve to avoid all mortal sin. A penitent who has committed a delil~erate venial sin in the past and who now includes that sin in his confession, either specifically, or at least in his gen- . eral accusation, ha~ sufficient contrition if he renews his good resolve to avoid that sin in future. Even a .penitent who includes only the "smaller" venial.sins in his confes-sionmthe semi-deliberate sins, as they are sometimes called--has sufficient contrition, if he is sincerely resolved to try to do better in some way, for example by eliminating one kind of sin or a certain class of sins, or even by reducing the: number of his small sins. We generally speak of contrition for sin as if it were one simple act. In reality it seems to involve a rather com-plicated process. It would not be worth our while, in a, aWhen I say that it-is sufficient if the contrition applies to only one of the gins confessed, I mean that this is enough for the absolution and the reception of grace through the sacrament. This does not mean that all the other venial sins are for-given. Sins for which there is no repentance at all ar~ not forgiven either in con-fession or outside of confession. For example, a penitent who has committed two venial sins, has true sorrow for one, but no iorrow for the other, would receive grace through the sacrament but not forgiveness for the one unrepented sin. His confession would be fruitful, but it could be more fruitful. 151 GERALD KELLY Reoietu for Religious pratti.c.al article of this nature, to go deeply into this proc-essl " But it may be useful to indicate here that, in making aft. act of contrition, a penitent should pay particular atten-tibn to two dements of the psychological process: namely, to motivation .and to purpose, of amendment. If these two elements are present, one may safely assume that an act of contrition is good; if either one is 1~icking, there is no real cogtntion. ¯ Motivation is not contrition, but it. is a necessary pre-lude td it. The sinner must realize the evil of his acts before he can truly repent Of them. And he must see this evil ~hrough the eyes of faith if his contrition, whether in or out of confession, is to be supernatural and effective. As we know, faith supplies us with a variety of motives f0r.repen~ance, some more perfect than others. It shows Us sin as contrary to the will of God and therefore some-thingagainst God's infinite holiness and goodness; it shows Us: the Son of God suffering on the Cross for our sins; it reveals sin as ingratitude to God~ o.ur.supreme.benefactor; it tells us of theo richness of heaven, of the terrible fate of hell, of the punishmen.ts of pu.rgatory, and of the temporal purlishments for sin in this life. All penitents shOuld keep in mind that the motive for their contrition should be applicable to the sins for which they wish to be sorry. In particular, it is necessary for those who Want to make an act of contrition for venial sins to remember that not all motives that apply to mortal sins are applic~ible to venial sins. Despite the fact that many books speak of venial sins in the most thunderofis terms, venial sin js not mbr~al sin. Mortal sin destroys the likeness of God in the soul; venial sin dods nbtt Mortal sin breaks the l~0nd.gf friendship between the soul and God; venial sin does not. Mortal sin is deserving of hell; venial sin.is not. In recalling these differences I am not trying to 'belittle Ma~l, 1944 GOOD CONFESSIO~IS AND BETTER CONFESSIONS venial sin. I simply insist on the necessity 9f seeing such sins in their true perspective in order to elicit a genuine act of contrition for them. It is only by stretching words far beyond their obvious connotation that one can make an act of contrition for venial sin "because of the fear of hell." This motive is applicable only in a roundabout way: for example, because venial sins may lead to mortal sin,. which is deserving of hell. On the other hand, there are many motives which do apply directly to v~nial sir/s, even to thd smallest of them. Venial sins are contrary to God's holy will; they defeat His wise plans for our sanctification and for our attainment of a certain degree of heavenly glory; they manifest a failure to appreciate His gifts; they are a shabby return fdr what our Lord did for us; they are deserving of some punishment in this life or in purgatory. It would be well for those who make devotional confes-sions to meditate occasionally, especially during the time of retreat, on motives such as these so that they can briefly and intelligently recall appropriate motives when preparing for confession. From the point of view of motivation, therefore, it is perhaps easier to make an act of contrition for mortal sin than it is for venial sin. At least it is easier to see the evil of mortal sin. As for the purpose of amendment, less is required for venial sins than for mortal sin. No matter what mortal sins a penitent has committed, he has not sufficient contrition unless his purpose of amendment extends to all mortal sins. He must will to avoid all mo]:tal sins in the future. Thus, the ordinary definition of a purpose of amendment as "a firm purpose to sin no more" applies quite literally to mor-tal sins. But this does not seem to be strictly necessary with regard tovenial sins. In facL.with regard to all the smaller sins. taken together, it is hardly possible. Rather, in the 153 GERALD KELLY Review for Religious case of sorrow for venial sins, the essential thing is the sincere will to do better. This distinction between mortal and venial sins, with respect to purpose of amendment, is based on the ft~nda-mental difference between these two kinds of sin. Mortal sin, of its nature, implies a rejection of God's friendship; hence one cannot will to gain or continue in God's friend-ship unless he intends to try to avoid all mortal sin, with-out exception. But one who commits only venial sins is already a friend of God; and this friendship admits of many degrees and of continuous growth. There is no con-tradiction in willing to a~coid some venial sins, but not others, or in willing to reduce the total number of one's venial sins, without proposing to avoid venial sin entirely. _ Satisfaction The third rule enunciates' the minimum essential for the third act of the penitent--satisfaction. I stated this rule ¯ merely for the sake of~omplete.ne~s. The rule itself hardly requires comment or explanation, except perhaps to remark --what is probably obvious--that there is a difference between willingness to accept a penance and the actual per- ' formance of the penance. The willingness is required for the validity of the confession; without this disposition a confession would not be good. But the actual perform-ance of the penance does not pertain to the essence of the Sacrament but only to the integrity of it. A BETTER CONFESSION The first three rules, as I said, express the minimum essentials of a fruitful confession. All who make a devo-tional confession, even religious, should make it their first aim t6 keep those rules. But religious, in particular, should not be content with that. Their aim should be to ,make 154 May, 1944 '" GOOD" CONFESSIONS AND BETTER CONFESSIONS their confessions better, especially througl'i the observance of the fourth rule. ¯ Books and articles on confession offer many suggestions for improving our confessions. I .should like to suggest ¯ here merely one workal~le plan for.using confession as an instrument 6f self-improvement; and I think I can accom-plish my purpose better by an example .than by a long dis-cussion. A religious is. making his annual retreat. In surveying the past year he notices that he has committed many small sins. He.wants to correct th~se, and in particular he wants ¯ to correct two habitual~.faults: uncharitable -speech and small sins against poverty. He, determines:what mearis.he willtake to'avoidthese fatilts, and he makes his resolutions accordingly. When his program:is .all prepared, he sud: denly re.alizes,- with a.twing~ of conscience, that he has made :such resolutions in previous refreats and that in a very sh6rt ¯ time they were either badly mutilated or completely ignored. He knows that during the retiea~ hehada sincere.purpose ¯ of amendment; what helacked was something .to sustain that purpose of amendment thiough the year .follow~i.ng the retreat. . Confronted with the vexing problem of an unsustained pubpose of amendment, thereligious decides to solve it.by effecting a union betweenhis retreat .resolutions and.his weekly confeshions Of the coming year; : :.: ¯ .'. The retreat ends; the daysgo by till it is time for.the weekly confession." . In examining his conscience, the rdi-gious looks first .to ~his retreat resolutions. He has kept them this week. He thanks God for this, renews his good resolutibn and, having finished his examination of con-science, he confesses as follows" "Since my last confession ¯ have ' I accuse myself of these and ot: all the other sins of my life, especially uncharitable speech and sins 155 GERALD K~LLY Reoiew for Religio~e against poverty." Another week goes by, with the same results. The "examination of conscience and the accusation of the two special kinds of sin are made in.the same way. In the third week, there is a weakening. Before confession the religious recalls the motives for avoiding these sins, asks pardon for his falls, and renews his good resolution. In confession he accuses himself as follows: "Since my last confession I was uncharitable in speech twice and committed one small sin against poverty. In my annual retreat I determined to cor-rect these faults, and I want to ask pardon for them now and to renew my purpose of amendment. I include in this confession all the sins of my life." Enough for the example. In giving it I do not mean ¯ that evdrything must be taken literally. Ten penitents might follow the same general plan, yet use ten slightly differing methods in applying it. The important thing is the general plannthe linking of the retreat resolutions .with the subsequent confessions. The plan that I have suggested may not-be suitable to all; but, in the absence of a better . one, it is worth trying. It offers definite help along the lines 'of motivation and of concentrated effort at amendment of faults. Retreat is a time of great grace; seldom Will our motivation be nobler .or.more clearly perceived. Any plan which wili continually recall that motivation must be profitable. And I think it is a truismthat in the spiritual life, whether on the nega-tive ok the positive side, there must be some concentration of effort. We cannot rid ourselves of all faults at once;. we cannot acquire all virtues at once. I iealize that this plan involves "monotony"; but I do, not know of any plan for spiritual progress that'does not involve some "monotony." If more variety is really .required, the objectives can b'e changed occasionally, for ¯ 156 " Ma~l, 1944 GOOD CONFESSIONS AND BETTER COlqFESSIOBIS instance, from monthly recollection to monthly recollec-tion: but I think it is important .that we should never get away entirely from our retreat program unless we are faced with entirely new difficulties that demand our undivided attention. Some may object that the plan is too "negative." To this I can answer only that confession.is sfipposed to deal with the "negative" side of our lives and that I have not proposed this plan as a complete enunciation of our spir-itual ideals. And I might add that, if used perseveringly, the plan is very positive in its results. It makes for a great increase of grace through the Sacrament, for increasing purity of conscience, and, incidentally, for helpful spiritual direction by the confessor. MARIAN LIBRARY Some time ago plans were formulated for the organization of a Marian Library at the University of Dayton. The purpose of the project is to collect all known books on the Blessed Virgin, thus honoring Mary, Patroness of the United States, and establishing a center of research on Marlology in this country. If~ you wish to help in the project or wish further information concerning it, write to: Father Law-fence Monheim, S.M., Director, Marian Library', University of Dayton, Dayton 9, Ohio. BROTHER RICHARD PAMPURI Brother Richard Pampuri was a physician and surgeon, a member of the Hos-pitaller Order of St. John of God, who died in 1930, at the early age of thirty-two. The Brothers of St. John of God now publish a small pamphlet containing a sketch of Brother Pampuri's life and some vocational information about their order. For further information apply to: Rev. Brother Master of Novices, Brothers of St. John. of God, 2445 South Western Avenue, Los. Angeles 7, California. PLEASE~Somo subscribers have not yet sent us their Postal Zone numbers. If yours is not on the wrapper of your copy, will you please send it? ,. 157 The Question ot: V0t:ing Edwin F. Healy, S.J. 44| N WHAT ways may a citizen help in maintaining .a genuine democracy?" asks a Civics' Catechism; and, in the answer, first place is given to "voting at elec-tions." The reason for thus stressing the .importance of voting is ~asily understood when one realizes that the bal-lot can fashion the whole superstructure of our govern-ment. The justice of our laws and the effective and impa.rtial administering of them depend upon those who elect to office our legislators and our administrators. Responsibility for the quality of our government thus lies, to a large extent, in the hands 0f our "voters. The citizens of a nation have the obligation of pro-. m0ting the general welfare of their country. This obliga- ¯ tion is one ot? legal justice. BU( what exactly is legal jus-tice? Legal justice is a virtue which inclines citizens to render to their community what is its due. Men are intended by nature, not to live as hermits, but 'to dwell ' togetl~er in groups or communities. Living in groups, they enjoy many benefits. They are thus aided in developing themselves spiritually and intellectually. ~ They thus par-ticipate in the joys of varied companionship. They feel the protective strength of large numbers bound together for a common purpose. They Share in the improvements made possible by the industry and ingenuity of their associates. They have access to~ commddities, forms of XFather Healy wrote this article at our request. It seemed to us that ~uch an article. might be necessary, or at least very useful, at this time. During election year teach-ers are frequently asked questions about the duty of voting, and religious themsel~,es face the personal problem of judging the utility of their voting and their duty to do so. We believe that in some places ecclesiastical superiors" give specific instructions concerning the fulfillment of this duty. In the absence of such particular guidance, religious should find Father Healy's general explanation helpful.reED. 158 THt~ QUESTION OF VOTING entertainment, facilities for travel, and so forth, whic.h would be undreamed of if all were recluses. All this is just as nature intended it. Human society, then," is a natural institution and it,has certain claims on the members of the community. As Pope Leo-XIII wrote in his encyclical Christian Democracg, ".No one lives in a community only for his personal advantage. He lives for the common good as well." A country, a State, or a city, has the right to ¯ deman'd of its citizens whatever is, necessary to promote the general welfare. A citizen, therefore, must fulfill the duties which correspond vcith these rights of the community. The virtue which inclines citizens to live up to these obligations is calle~d legal justice. Legal justice, for example, prompts one to defend.his country, even though this involves facing the devastating gun-fire of the enemy. Legal justice dis-poses citizens to observe the just laws of their State, to con-tribute a fair. share to the.financial support Of the govern-ment. It is legal justice, too, which imposes on citizens the duty of p.romoting the common good by means of intel-ligent voting. The common welfare is greatly furthered by the con-scientious use of the ballot. Member.s. of a community.,' then, should reflect upon the vital importance of exerc!sing this power that is given them by virtue of their citizenship. Intelligent, competent, honest leade~rs are needed by our country. This fact is brought home to us when we realize that our public officials manage, not only political affairs, but matters which may intimately affect the religious activi- " ties, the educational system, and the whole social and indus-. trial life of a city, or State, dr country. A communistic governor or president, for example, could accomplish much towards u~dermining our democracy. A militantly bigoted mayor could do much harm to the Church. Judges who 159 EDWIN F. HEAL¥ are guided by a false philosophy will injure the community in which they live~ One can, therefore, readily understand how much is involved in the selection of those who conduct the public business of our country. It is regrettable that, in spite of its importance, not all who are entitled to the ballot exercise this privilege. It has been estimated that as many as one half ofthose who were .eligible to vote have absented themselves from the polls in some election§ of the past. This was true ev.en in impor- .tant presidential elections. In elections of less general inter-est it has happened that only about one-fourth of the elig-~ ible voters appeared at the polls. Moreover, in primary elections, which select the candidates for o~ce, this apathy in public affairs is often far more pronounced. Such indif-ference ¯ to matters which concern the common welfare encourages corruption in our government. Many of those emp~owered to vote fail to do so because of laziness, or because of some slight inconvenience Which is involved in their particular case~ It requires fair weather to lure some citizens to the polls. Others refuse to vote because they are dissatisfied with the choice of candidates offered by our political parties. Others, again, feel the futility of trying to-defeat one who' is supported by a powerful, well-organized political machine. Often enough citizens excuse themselves from their duty of ~roting on the assumption ¯ that their single ballot will make little difference in the final o results. Although it is possible that one vote may change :the outcome of an election, one must admit that this is highly improbable. Let us suppose, however, that thou-sands of uprightcitizens were to excuie themselves from voting on the plea that "My vote won't matter".--cou,ld not the resulting loss to the desirable candidate easily bring about his defeat? This point should be remembered-by those who honestly desire to fulfill-their civic duty.¯ At 160 May, 1944 TNE QUESTION OF VOTING times, moreover; one is inclined to forget that his failure to east a vote will, in many cases, be equivalent to casting a Vote in favor of a candidate who will harm the public welfare. Althougl~ the common good can be advanced so much by the honest voting of the members of the community, there are a great many cases ~where the choice made at the polls is not dictated by conscience. Not a few of our citi-zens, it is said, sell their votes to the highest bidder. Besides this, there are no doubt many thousands who write their ballots according to the instructions which they have received from some ward boss who has befriended them in one manner or another. A.petty politician obtains votes for his candidate in various ways. He procures jobs on the city payroll for certain ones who will be able to influence the opinion of many acquaintances. He protects Others who are running a business which is forbidden by the law. He "arranges" matters with a friendly judge for thosewho have been arrested for violating minor city ordinances. At election time a dollar here and .a few dollars there buy va!u-able votes. Vo~es which are delivered to the ward boss because of a favor .received do not represent the genuine preference of the v6ters for the candidates selected. They represent merely the preference 6f a single individual, namely, that of the petty politician who has gained control over these votes. Frequently enough the ward boss is quite dishonest. Biibery, lying, injustice are common tools by which he "gets results."~ He has but one choice in any election' and that choice is the candidate that has 'been selected by his political party. Be that candidate good or bad, the ward boss will support him by every means available. We can re.adi!y understand, therefore, that the ward boss's choice may turn out to be one which will be quite injurious to the ¯ ¯ 161 EDWIN F. I-ii~gi.~ :" '/tevie~o ¢or. i~et.,'gio,,s~ go~d of the community. If we recall to. mind the thou-sand~ of those whose purchased votes are merely the rubber-stamped selection of some w~lrd boss, we shall realize what an unfair advantage an unscrupulous candidate may have over one who is honest. Thousands of voters, it appears, are influenced at the polls by one c0nsideration:."What immediate advantage will this'person's election, bring to me?" They seem never to give thought to the effect which the candidate's victory may have on the State or country as a whole. They focus. their attention on some petty benefit which they them-selves will receive. Ordinarily the major consideration for them i~ the question of jobs. Many of those who are employed by the ~idministration which is in power vote for that administration's candidate as insurance against the. iossof their.jobs. They realize that, if the candidate of another p~rty is elected, in all probability he will replace then~ with those who have proved their political allegiance .to him. Th~ere is; of course, no fault to be foun~l with men anal' wom~n-Who endeavor to protect themselves against the loss of their jobs, but it should be evident that .such Pr0.tectiOia .mustnot betheir primary consideration. It should not inteifere Wi~h the fulfilment of.~ their duty .to p.".r0mote thi~: ~0mmon good: Hence;" if.:a 'certain candidate is unfit .for o~ce, he sh0uld: not be. Voted for, no~ matter what patter loyalty might dictate. . " -~ . ¯ . :- . An0~her"~ype 6f citizeri~ ~hat concerns. .us- :in this queso: tion is the one who a~cepts his duty of voting very lightly. Hema~r be an Upright and an intelligent'pe.rson. He may .be irreproachably honest in all his de.alings.with his neigh-boi. He may be a generous contributor to charitable insti-tutioiii. But he fails to do his sha~e in the task of electing competent public officers. With men 0f this type, there is .no pretence ~t making a serious effort to !~arn the qUalifi- 162 Ma~t, ~19 4 4 THE QUESTION*OF.~ VOTING cations:of the candidates listed on the.ballot. They kno~" little of the good qualities or of the bad ones of those: who are running for office. They may .base their opinion of the candidate on such superficial points as that of a winning personality, a magic voice, social standing, the nationality ~ of his parents, and so forth. They form snap judgmentSOf the candidate's ability and do not b~ther, to investigate the soundness of their conclusions. They accept a party plat-form at the value given it by its defenders'and refuse ~to read the arguments of its opponents. " When one recalls, then, the large number of those who are guided in voting by unfair influences and by superficial considerations, the importance of the honest, educated, conscientious voter becomes apparent. " Consequently, it.:is not too much tO expect that especially th6se whoare ¯ blessed with sound 'Christian. training and with at:,least average intellectual gifts employ these benefits' at election time to promote the common good. They should ex~rcise 'all the influence in their power to protect the less fortunate, who are being.exploited by unsciupulous political .bosses. From what has beenexplained above,-it is' deaf,.then, that ci(i'zens~ are obliged :in conscience to, fulfill ~the"du'ty 6f voting. Is this 6bligation a serious one? .Yes, it is, ff0n~e.'-s vote will probably defeata candidate for.office who -would bring? graveharm :to the. comi-fi:unity. A very indompetent. person~ for example,. or-one who'is strongly anti-religio~s~ wouldbe such a candidate. Ordinarily,,however, in this country,' this condition is not verified, .and so the duty to vote is, not grave. Moreover, there is no obligation at :all - ¯ , to vote: (a). if I am certain that my vote would have no effect on the final results of the election; or (b) if ~¢6ting -. would prove seriously'inconvenient or gravely injurious to me. Hence, ,if I were quite sick, and going to the polls would increase my illness, I should be excused from the 163 EDWIN F. HEALY . " Review f.or Religiou~ duty of voting. Even though one's vote would clearly riot affect the course of an election, nevertheless, it is preferable that one go to the polls anyway, in order to give to others the g6od example of taking interest in civic affairs. This, of'course, applies, particularly to persons of authority, whose actions are a guide to many. Besides, my vote is not altogether useless, even if my candidate has no chance of winn';ng the offce, for his. prestige will be increased by each additional vote which he receives. With reference to the duty ofv0ting it should be noted that one' is obliged to vote bonestl~l, that is, he must be guided in his choice of candidate by his genuine desire tO furthe~ the common, welfare. He must select the candidate wh~ is bes~ fitted for the office. The one voted for must l~e qualified to carry .out the requirements of the position sought. It may be that a man is morally blameless, but if he 'is inefficient, inexperienced, dr poorly gifted intellec-tually; his election .would. not be to the best interests of the community. Moreover, one must vote intelligently. He must make sure that he does not waste his vote. A vote is wasted if the ballot is not marked in accordance with the directions given, because such a ballot will be discarded without being counted. An erasure, or blots, or blurs, or -some sign that may be interpreted as a distinguishing, re.ark, . can invalidate the ballot. Writing in ink, instead of pen-cil, marking an "X" outside the prescri.bed box or circle, voting for several candidates for an office when only one may be selected--these are some of the ways in which one can waste his ballot. Not infrequently it happens that the shortcomings of a candidate for some public office are reviewed in detail in newspapers and magazines. The charges made-against candidates by a news organ of an opposing political party are at times very damaging. What is to be said of the moral- 164 Ma~ , 1944 THE QUESTION OF VOTING ity of the practice of exposing the faults and errors of one who is running for a public office~ To call attention to the mistakes and misdeeds ofthe candidates can be a service to the community. The men and women who are seeking publicoffice are thus revealed in their true light, and so the voters are able to judge whether or not the election of such candidates would prove to .be injurious to the common welfare. It is, of course, forbidden to exaggerate a candi-date's deficiencies or to make slanderous statements about him.However, it is altogether licit to mention certain facts in his life: faults, past crimes, evidences of favoritism, dangerous tendencies, examples of inefficiency, ignorance, bigotry, dishonesty, and so forth, when these are of a pub-lic nature. Even hidden crimes or defects may be pub-lished, if these render the candidate unfit for such an office. The reason is dear. Candidates give up their right to keep secret what the common good requires to be known about them. Moreover, those who hold public positions can be said tacitly to consent to the open scrutiny .of their official acts. They are, after all, but the agents of their constitu-ents; hence those whom they represent have the right to demand an acc6unt of their official conduct. The realiza-tion that their actions will thus be analyzed in newspaper and magazine may perhaps exercise a restraining influence against violations of duty. Since, then, writers are allowed. publicly to review the faults and misdeeds of candidates for office, such articles of theirs may be' read without scruple. Not many years ago a certain socialist urged that all nuns be deprived of the right to vote. The argument adduced to justify this recommendation was, we believe, that such women have no interest in civic affairs. In reply to this suggestion it should be made clear that religious men and women, as a rule, have very much at heart the common welfare. Moreover, their interest is not merely an aca- 165 EDWIN F. HEALY demic one, for by their daily lives of prayer and sacrifice and good example they greatly benefit the community in which they live. Because they love their country and ever seek its best interests, they are eager to have only candidates of ability and integrity elected to office. They cast their votes in accord with the dictates of their conscience. Who would deny that their choice at the polls is as carefully considered and as intelligently weighed as that of the average citizen? CONCERNING BOOKLETS The Congregation of Holy Cross is publishing a revised edition ofDirections for Nooitiates of the Congregation of Holy Cross, written in 1895 by the saintly Father Gilbert Francais, Superior General of th~ Congregation from 1893 to 1926. The book contains a simple, fervent set of instructions designed to help novices in the various exercises of the novitiate. Though the book is really the Family Bool~ of the Congregation of Holy Cross, masters and mistresses of novices of other in-stitutes should find it useful. Paper-bound: 182 pages; $I.00. Published by The Ave Maria Press, Notre Dame, Indiana. The Holy Cross Brothers publish a very attractive and informative booklet en-titled Holy.Cross Brothers. This booklet may well be held up as a model of clear, simple, verbal instruction on the life of a Brother and of the apt use of photographs to illustrati the text. The Brothers will send a copy to any priest or religious who is interested. ~Write to: Director of Vocations, Sacred Heart ,luniorate, Watertown, Wisconsin; or tb: Direcior of Vocations, St. 2oseph ,luniorate, Valatie, New York. Similar to the booklet on Holy. Cross Brothers is anew brochure, Jesuit Life, prepared by the' Jesuits of the Missouri Province. This province comprizes Colo-rado, Illinois (south and west of Springfield), Iowa, Kansas, Minnesota, Missouri, N. ebrask~, North Dakota, Oklahoma, South Dakota, Wisconsin, and Wyoming. Residents of this territory mas; secure copies bf Jesuit Life free by applying to: Reverend Father Provincial, 4511 West Pine Blvd., St. Louis 8, Missouri. An Army of Peace is the title of an unusual historical pamphlet--"The Story Of the Sisters of Loretto at the Foot of the Cross as told by Modern Youth." This pamphlet was originally planned and written by the American History Class, Loretto Academy, Kansas City_,. Missouri. "1941. Two years later it was revised by the students of Loretto Heights College, Loretto, Colorado. The illustrations (very "cute"--if you don't mind the word) are the combined work of students of Web-ster College, Webster Groves, Missouri. 48 pages. 10 cents each; 11 for $1.00; 50 for $4.25; 100 for $8.00. Order from: Loretto Heights College, Loretto, Colorado~ 166 The C~re 0t: ~ick Religious Adam C. Ellis, S.J. BECAUSE of the regularity of their lives, their simple but wholesome diet, and the peaci~ of mind resulting from serwng God, rehg,ous usua.lly enjoy remark-ably .good health. It ~s mewtable; however, that there be some sick rehg~ous. These should be looked upon.as bles-sings in a community, and they shoulld be given proper care, both physical and spiritual, according to the letter and the spirit of. ecclesiastical legislation. . Phgsicat Careof the Sick ¯ The Code of Canon Law contains nip specific legislation regarding the physical care of. the sick. This is provided for ¯ in ~he constitutions of individual lnst~tutes, ~which in ~turn are based upon the. provisions laid down ~n the Normae issued by the Sacred Congregation of Bi,~hops and Regulars, June 28, 1901. We may, therefore,' tal[e these latter as.the .basis for our remarks:. ¯ . ¯ Art. 183 requires that each religious, house,., as 4:ar.as. possible, shall have a special place for an in~, rmarg. Though it is impracticable in a small communit~ to reserve aplat~ in the :house for occasional sick members, it is customary-to have a well-eqmpped ~nfirmary ~n the motherhouse, ~n the novitiate, in the house of studies, as w~ell as in all larger communities. These places should b~e kept bright and cheery, ~vithout, however, introducin~ luxuries not in keeping with '.religious poverty. - Art. 184 states that one or more re'embers of the com-mun~ tg, should be set aside for the care ]of the sick. These persons should be endou~ed u~itb all tb le qualities necessar~l 167 /~DAM C. I~.LLI$ Review for.Religio~s f~r the proper fulfillment of their office, and should be -noteworthg fo~ their Fraternal charitg. It is their dutg, under, the direction of superiors, to provide For atl.the necessities of their sick charges, with regard to nourishment and other remedies. In modern times no religious institute should find. any difficulty in having one or more of its members trained as .professional nurses. Many of our Catholic hospitals have training schools for nurses, and religious are always wel-come to go there for training in a religious atmosphere. Every large infirmary in a religious house should have its own diet kitchen in which the special dishes required for the si~k may be carefully prepared either by the religious-nurse in charge or by an assistant. We may remark here in passing that it is not contrary to common life to give a special diet in the community refectory to those religious who need it, ~ven though they are well enough to carry on their work. In many com-munities it is customary to l~ave a special table in the refec-to. ry for those who are on diet, thus saving unnecessary steps for those who serve at table. Art. 185 tells that when necessar!l a doctor should be called, and his prescriptions should be FaithFullg carried out. All things considered, the community doctor should be chosen by reason of his understanding of the nature of the religious life in general and of the special work performed by the community in particular. Then he will know more readily the circumstances Of his patient, and will not be inclined to prescribe extraordinary remedies which are . usually available only to the wealthy. Superiors should be generous in providing for the needs of the sick members of their community. It seems to have been a special characteristic of many founders of religious institutes that they were most solicitous for the care of their 168 Mag~ 1944 THE CARE OF SICK RELIGIOUS sick members. Such a tradition should be carefully pre-served. For major operations, as well as for the cure of.certain diseases, it will be advisable to send a religious patient to a hospital. Ordinarily religious should be taken to a Cath-olic hospital where they will .receive the loving care of other religious and will not.be deprived of the religious atmos-phere. Both superiors and religious nurses should be familiar with the laws of the Church regarding exemptions from fast and abstinence, Sunday Mass, and other like matters, so as to be able .to quiet any scruples on the part of their charges. Spiritual Care of the Sick Art 186 of the Norm~e prescribes that the spiritual needs of sick religious should be attended to no less. ear-nestlg than their material needs. The principal :spiritual needs include confession, Communion, and Extreme Unc-tion. On all these matters the Code of Canon Law con-tains some explicit provisions, on Which it may be helpful to make a few comments. Confession: Sick religious should have the opportunity of going to confession whenever the community 'does, that is, weekly to the Ordinary confessor, on occasion to ,the extraordinary confessor, though they should be asked first whether they wish to avail themselves of these opportuni-ties, ,and should not be forced to do so. Special provision is made in canon 523 for religious women who are ill: "'All religious women when seriouslff ill, even if not in danger of death, mag, as ofte/~,as they u3ish during their serious illness; invite an~t priest whatever to hear their confession, provided that he be approved to 169 ADAM (2. ELLIS- Review [or Religious bear the confessions of women, no? can the superioress either directly or indirectly pre~ent them from doing so." It may be well to note that the canon does not require that the religious be in danger of death, but it suffices that she~be seriously ill in order to use the privilege.The judg-ment as to the seriousness of the illness should be left to the doctor or to a competent nurse. The very fact that it is deemed necessa.ry to callo the doctoi would generalIy be a sufficient indication that the illness is serious, since it is not customary for religious to summon a physician for slight ailments. Again, a patient who is running a fe.ver, or who. is obliged to be in bed for a week or more because of illness, would certainly come under the canon. In case of doubt ¯ about the seriousness of the illness, the sick religious should be given the benefit of the doubt. Sick religious on their part should be reasonable. It would hardly be in keeping with the spirit of the law to call for a confessor wholives a long distance away from the community, thus involving expense for the community and .grave inconvenience for the priest in question. It should also be kept in min~l that the 'canon impose~ no special obligation on the priest who i~ called to answer thd summons,.and the sick religious should be patient and resigned if the priest is delayed incoming or does not come at all. 'Holy Communion: Let us. first recall .that the reception of Holy Communion is a privilege and that, while the Church urges her. children,' especially religious, to use this privilege frequently, even daily, still there is no obligation to do so, except during the Paschal. season. Hence a reli-gious, whether sick or. well, who abstains from the recep-tion of Holy Communion, should not be looked upon as singular, This is a matter which is strictly personal, and one which should never be commented upon in commun-ly0 May, 1944 THE .CARE OI~ SICK :RI~LIGIOU$ ity life. As to sick religious, theremay be many reasons w.hy they do not wish to receive Holy Communion on any specified day. Hence the practical rule to be followed is to ask them each evening whether they wish to receive On the following morning or not. They should be given the opportunity of communicating daily Should they wish to do so, but they should ne.ver be made to feel that they are obliged to do so, much iess forced to do so. Dispensation from the Eucharistic Fast. Canon~858 § 2 makes a partial exception to the law of the Eucharistic fast for certain sick persons. "'The sick who. have been .in bed for a month without cet~tain hope of a speedq recooerg maq, with the prudent advice of their confessor, receive Holq Communion once or twicea week, even though theg ma~] have taken medicine or something b~t toag of~.tiquid food beforehand." . The sick who have.beenin bed for a mot~tb. This does not exc!ude:the patient's being able. to. sit up during cer-tain hours of the day. Besides, there are some sick persons who; because Of th~ nature of their infirmity, cannotlie in bed,- b.ut are confined to a chair Or couch. They certainly may use .this privilege. Likewise those sick persons who are able to get up for an hour in. the morning and go :t6 the chapel for.Mass and Holy Communion; may. use the privi-lege. The .canon does n6t require .that they receive.'H61y Communion in bed in order to.use the privilege. " . " It should be noted, however, that this privilege-may not be used until a person has.actually.been ill. for amonth. The opinion of a doctor that the sick person will be in.b~d for more than a month would not justify that person in using the privilege immediately, but he:must .wait until he has bee~a ill for about thirty days. This number of days.is ,to be counted morally, not ma, thematically, It may be difficult to determine exactly the day on wh'ich a person 171 ADAM C. ELI~I8 Review/or Religi~ous became ill. He may have been feeling poorly~ for several days before be went to see the doctor and was ordered to bed. Such days should be counted to make up the month. Without~ certain hope of a spee'dg recoverg. These words exclude mere conjecture or probability. Unless it is certain, therefore, that the person who has been confined to bedby illness f;3r a month will.be well in a very few days, he may use the privilege as long as. his illness lasts. With tb~ prudent advice of theconfessor. ,This does not mean that the confessor grants the privilege of receiving Holy Communion not fasting--the law does that--but it implies .that his judgme.nt may be, required that the sick person is properly disposed. Hence a sick" religious who is mora.lly certain that be is in the state of grace and properly disposed need not ask the permission of his confessor to use the privilege granted by the.law itself. Once ortu;icea vaeek. These words are to be inter-preted strictly. The sick person may use the privilege not more than twice a week. He may use it on any two days of the week, even though on the other days he observes the Eucharistic fast in its entirety and receives Holy Commun-ion. ¯ Medicine or something bg wag of liquid food. The medicine taken may be liquid, or in the form of solids such "as pills, powders, and the like. Any food taken, however, must be in the form of a liquid, that is, it must be of such a nature that it can be drunk. Under this head would come such items as egg-hOg, thin gruel, milk, fruit juices and the like. Religious nurses will do well. to remember that the privilege granted in canon 858 is for all sick persons; not merely for religious. It may be well to mention here that religious who are chrohic invalids and who find it difficult to observe the 172 ' Mag, 1944 -. THE CARE OI~ SICK RELIGIOUS ]~ucharistic fast-either because of physical weakness, ' or because of the'need of taking medicince during the night, can obtain an indult from the Sacred Congregation of Religious to communicate even daily after having taken medicine or liquid food. It will suffice to write a simple letter stating briefly the nature of the disease, and asking for the privilege~ It will help to expedite matters to have the local Ordinary give his approval to the petition. , As for the Last Sacraments, canon 514 provides as fol-lows: "'In every/clerical institute the superiors.have the right and the dutg to administer, either per. sonall[t or bg delegate, the Holg Viaticum and Extreme Unction, in case of sick-ness, to the professed members, to the novices, and to other persons duelling day and night in the religious house reason or: service, education, hospitatitg, or health." In the case of lay institutes, that is, congregations of Brothers and Sisters, this right belongs to the pastor of the parish in which the religious house is located, or to the chaplain designated by the Ordinary to replace the parish priest (canon 514, § 3.). In convents of nuns, the ordi- -nary confessor or his substitute has this same right and duty (canon 514, § 2). Viaticum. Holy Communion is given to the sick by way of ,Viaticum whenever tl~ey are :in danger of death. It may be received daily as long as tha~ danger lasts, and the sick person is exempted from the Eucharistic fast during this time (canons 858 and 864). The opinion of a doctor, or of a competent nurse may be followed regardihg the danger of death. The sick person need not be actually dying, but it suffices that the illness be such that death may be the result of it. Extreme Unction. This sacrament may and should.be administered to the sick who are in danger of death. ~It may be administered only once during the same illness, ADAM C. ELLIS unless ,the sick person shall have recovered, and again fallen into danger of death (canon 940). Again the. prudent judgment of the physician or a capable nurse should.be fol-lowed both ~as regards the danger of death and subsequent recovery. The administration of Extreme Unction should not be put~off until the patient is actually dying, but should be " administered while the patient is in full possession of his senses. Sick persons, including religious, should be in-structed regarding the secondary effects of this sacrament, one of which is the recovery of health, if such be the will of God. Conclusion It will not be out of place here to urge religious supe-riors and those who have the care of sick religious entrusted to them to do all in their power to care for the material and spiritual needs of the sick. Let them, in thei~ charity, .use measures to prevent, as far .as possible, the beginnings Of sickness, by not overburdening their subjects, by supply-ing them with a sufficiency of good wholesome food, and by providing proper relaxation and recreation within the .bounds of religious propriety. In this connection religious superiors must learn to say "NO" to the .many demands put upon them f(~r.help or work which they cannot undertake without putting too great a strain upon a commun~ity which may be already. .overburdened. They will serve the best interests of the Church and of their own institutes by refusing such work until .they have a sufficient number of subjects properly trained both intellectually-and religiously to undertake such additional burdens. 174 ~ ¯ We, Salu!:e Thee, Mary, h ot:her God! William 13. Faherty, S.J. NO ONE has ever had the persevering energy to list all the titles of Mary. Each country, yes, almost every Catholic locality, has its own beautiful manner of invoking our lovely Lady. In the Litany of Lotetto alone we. appeal to her in over forty ways. Some titles, such as the Blessed Virgin, have universal esteem. Others possess only local popularity] Of all the loving appellativ~s by which her devoted fol-lowers call on Joachim's daughter, the .greatest is "Mother of God." So astounding is it to address a human being in this manner, that we might hesitate to. employ it, were it not revealed doctrine, its use sanctioned by. the Church. In the May 1943 number of REVIEW FOR RELIGIOUS, Father Aloysius Kemper, S.J., analyzed the doctrine of the Divine Maternity. The interesting controversy .that led to its sanction is the theme of this article. The antagonists in this case Were two leading bishops, Nestorius of Constantinople, and St. Cyril of Alexandria. Dispute and discussion of a controverted point of doctrine not infrequently lead to its settlement by conciliar defini-tion. So it was in this matter. .The Council of Ephesus (431) settled the question. But that is running ahead of the story . The Fifth-Century World . Accustomed as we are, in this modern era, to think.of the e.astern shore of the Mediterranean as non-Catholic . territory, we find it difficult to visualize the fi'fth-centur7 setting. Constantinople was the center 6f the Empire, not 175. W. B. FAHERTY Revie~u [o~ Religious Rome, so recently sacked by Alaric and his Visigoths. Not Italy, or Spain, or France, but the Province of Asia on the XVest coast, of modern Turkey was the most Christian sec-tion of the Mediterranean world. St. Patrick was just then preparing .for his missionary trip to Ireland. The great St: Augustine of Hippo was in his last years~ So much for the scene, now what about the Drarnatis Personae? Into the easiern capital as its patriarch came Nestorius, a priest of Antiokh, who soon became known for his zeal-ous hounding of heretics. Worried over'the danger of polytheism, still so strong in the pagan parts of the Empire, as well as over an error concerning Christ's humanity taught by~ a priest, Apollinaris, Nestorius leaned backward in regard to the doctrine of the Divine Maternity. Against him stood St. Cyril, the Patriarch of Alexan-dria, rugged as Gibraltar, a man renowned for the strong virtues of John the Baptist rather than for the gentle quali-ties of dohn the Evangelist. Far away, at Rome, Pope Celestine odcupied the Chair of St. Peter . Theological WarFare The first barrage of battle came when the priest, Anasta, sius, a protegi of the Phtriarch of Constantinople, preached against the use of the extremely popular title for Mary, Tbeotokos (God-bearing). Call her merely Christ-otokos (Christ-bearing), he ordered. Consternation spread arnbng the-Constantinopolitans, for this title, Tbeotokos, had been indaily use for over a hundred years. Almost everyone in the audience had been familiar with it .from ehrliest childhood. The people were.gripped by a dismay and bewilder-ment almostinconceivable to us who live in a milieu that 176 May, 1944 WE SALUTE THEE, MARY, MOTHER OF GOD tends to take doctrinal differences as easily as the changes of the ieasons. Nestorius answered ?omplaints with excom-munication and imprisonment, then mounted the pulpit and bulwarked Anastasius' position. The Patriarch. of the Eastern Capital had flung down the gauntlet. Proclus, the bishop-elect of Cyzicus, a lesser name in this theological battle, accepted. the challenge. Despite the presence of Nestorius in the audience, he rose to the defence of the popular opinion. The Patriarch coun-ter- attacked with a whole series of sermons. Not along the shores ,of the Golden Horn alone, but throughout the East, news of these teachings spread. Across the blue Mediterranean they carried, like the sails of the Phoenicians, to the ancient land of the Pharaohs. St. Cyril rose to the defence of the tiaditional opinion with several letters. First to his own people, then to the monks of Egypt, he gave the true explanation of the Incarnation. He -mapped out a detailed counter-offensive against Nestorius. Two letters to that Patriarch complained of the teaching that had thrown the faithful throughout the East into war-time excitement. Availing nothing by this, Cyril referred the matter to Rome. He sent to the Holy See his correspondence w.ith Nestorius, a collection of the con-tagion- filled sermons, and a work of his own just com-pleted. ¯ A local council, convoked at Rome by Pope Celestine in the .summer of 430, condemned Nestorius. Early in August the Pope commissioned St. Cyril to carry out the condemnation, giving the Patriarch of Constantinople only ten days to retract 'his false teaching. Celestine wrote similar letters to Nestorius himself, to the clergy and people of Constantinople, and to John, the Patriarch of Antioch. The last paragraph of the Pope's authoritative letter to Nestorius is a good.summary of the whole epistle. "You 177 W. B. FAHERTY Review t~or Religious know clearly.out opinion. Unless you preach concerning Chris.t, our God, those things which the Roman ChUrch, the Alexandrian Church,-and. the whole, Catholic Church teach~s, and the most holy. Church of the Cityof Con-stantinople held up to the present, and you separate your-self from that foul novelty as the Scripture enjoins, and condemn it in a written profession within ten days from the day on which you are aware of this. sentence, you will be expelled .from the communion of thewhole Catholic Church" (Mansi, IV, 103~4.35). ~ ~ This was a lightning attack on Nestorius. He was condemned and his rival .was chosen to. give the coupde-grace. What would he do? The cornered Constantino-politan parried the thrust with an. evasive reply and.-a promise to abide by the decision of the general council he had asked the Pope to convene. The Anatbematisms Cyril. was busy, tOO, preparing.the death blow. He drew?. UP twelve statements, called "The:.Anathematisms,'." to which,Nestorius was asked to.subscribe. Though these , ~ere couched in sucha way as tO make evasion impossible, they contained, certain difficulties of terminology. What Cyril understood to mean:-one thing, Nestorius interpreted-in a way that bordered on the false teaching of Apollinaris. So, .,instead of submitting, he issued, twelve, counter-anathematisms, John of Antiocia now stood With Nes-torius. Other bishops of the region of Antioch a.ttacked the twelve statements of Cyril, especially the third, which seemed to teach only one nature in Christ. When everyone seemed, drugged-with anathematisms; the Emperor Theodosius II con, yoked a general council to be, held at Epl~esus in Asia Minor, on Pentecost Day,~' June 7, 431. Ma~t, 1944 WE SALUTE THEE, ~ICIARY, MOTHER OF. GOD Ephesus is today a miserable village on the-west coast of Turkey, not far from the Italian naval base at Rhodes. But in Roman times, it bore the pr6ud sobriquet, "The Torch of Asia." One of the chief ports of. the Levant, it was the center of the cult of Diana in the days of St. Paul. Recall the riot recorded in the Acts, when the streets rang with the cry, "Great is Diana of the Ephesians." From a pagan stronghold it became by the third cen-tury a populous Christian city. Here St. ,John lived in later life. Here sprang up a great devotion to the Mother of God, supplanting the worship of the pagan goddess. To the main church of the city, dedicated to Mary, the bishops were making their way in the spring Of 431. The Council Convenes Since the Antiochean prelates had not arrived by June 7th, the opening of the Council was delayed. On ~he 22nd Cyril opened it, though the Papal Legate and the Patriarch of Antioch were still on the way. This seemed a high-handed act on the Alexandrian's part, for he had no com-mission to preside over the Council. Perhaps he extended hi~ powers as commissary in the indictment of Nestorius. The Acts of the Council record that two bishops, both bearing the name of Alexander, one from Apamea, the other from Hierapolis, had come from John of Antioch to tell Cyril to wait no longer. Yet these same two, along with sixty-six others, personally voted against the opening of the Council in the absence of the Syrian bishops. Nes-torius refused to recognize the jurisdiction of this incom2 plete number, and consequently would, not appear or put in any defence. Yet the first, meeting was held. A crowd of Ephesians g~ithered outside the Church of Mary as the sessions opened. Would Nestorius be con-demned? Would the popular app+llation of the Virgin be 179 W. 'B. FAHERTY '~: ' approv~O.~"~ C~rril, ,whom the Acts Of the Council describe as ".holding the.place of the most holy Celestine, Bishop of the Roman Church" (Mansi, IV, 1123);. presided when the ~ase of Nestorius was discussed. Various pertinent docu-ments were read, and a vote taken.'One hundred and ninety-eigh.t bishops subscribed to the condemnation. The setting sun, had reddened the waters of the Ionian Sea and the quiet .of evening wrapped the city be'fore the first long sessi6n was over. When the bishops filed from the Church, the word of the condemnation spread lik~ elm leaves in autumn among the expectant multitude. Where once rang the ~ry, "Great is Diana of the Ephesians," the shouts of "Theotokos, Theotokos" reechoed in honor of Mary, the Mother of God. With a thousand flaming torches, the Ephesians led the Fathers of the Council in tri-umph back to their temporary residences. A few.days later the papal legates arrived with a defini-tive letter from Celestine. The assembled prelates Were merely to promulgate the decision already made against Nestorius and make it universal. In the third session (2uly lst)the Roman legates confirmed the measures taken. With this the doctrinal work of the Council was a.lmost at an end. ¯ Several trying weeks, were to elapse before the adjournment.-During this interval Cyril preached the sermon in which he spoke the words of our title. Nestorius was deposed from his see in October of the same year, and a moderate prelate, Maximinian, succeeded him. Thus e~ded the Theotokos cgntroversy. For all time it was settled that the universal brotherhood of the-Chris-tian people could salute Mary as the Mother of God. 18o Who Is This Rodriguez? Augustine Klaas, S.J. AUGUSTA Theodosia Drane, the future Mother Francis Raphael, gifted writer and Provincial of the Dominican co.mmunity of Stone, England, tells in her memoirs of her first meeting with Rodriguez. She was about twenty-five at the time and still an Anglichfi. "One day in Mr. Maskell's library I stumbled on three volumes in dark green cloth, the title of which took mY fancy 'Religio.us Perfection.' I carried them ~0ff. It was Rodriguez. A girl of sixteen reading .the Waverley novels for the first time would be a feeble comparison. Better was .this than any conceivable novel, for here at last I found reality. It was precisely what I wanted, what I had always felt the want of: and I Used to cry out, 'Oh if I had only had this bbok at fiftee.n, what a different being I should have been!'~.Imp°ssi'ble not. to be a glutton over these books. I read them by davy; I'read them by night; I read them aloud to my sister, who .was vexed with my enthusi-asm and did not relish the Fathers of the Desert; and When she objected, I walked down to Petit Tot and read them there. I went right through them in a week, and then I be-gan again, and went right through them a second time. If I ever hear depreciating remarks about Rodriguez, as if he were an old fogy, I feel as if I could slay anyone who does not lo;~e him as I do! I think he saved my faith." (A Mere-. oir; edited by Bertrand Wilberforce, O.P., p. 51.) Most religious, perhaps, have not felt the initial impact of Rodriguez' spiritual classic quite so acu(ely as this Angli~ can young lady. At least they have not expressed .them-selves nearly so enthusiastically. Yet, it must be admitted 181 AUGUSTINE KLAA$ that the work of Father Rod/iguez is one of the all-time spiritual best-sellers, and certainly, after "the Spiritual Exercises,;. the most influential spiritual book written by a Jesuit. It has formed and molded tens of thousands df ~eligious, priests, and layfolk for three hundred years and in importance has been placed by discerning critics immedi-ately after the Imitation of Christ, alongside such notable works'as Scupoli's Spiritual Combat and'Francis de Sales'. Introduction to a Devout Life. Pius XI in 1924 addressed to the major superiors of all religious orders and congrega-tions of men an Apostolic Lette.r, in which referring to the training of novices, he says: "Most useful to read through and study will be the writings of Saint Bernard, and of the Seraphic Doctor Bonaventure, as also of Alphonsus Rodriguez . Their power and efficacy, far from failing and being weakened by lapse of time, seem today rather to have increased." (AAS, XVI, p. 142) Who, then, is this Rodriguez? : The Man Alphonsus Rodriguez, unfortunately, has always suf- ¯ feted from the petty annoyance of mistaken identity. And no wonder, since some thirty-five Jesuit writers bear the name of Rodkiguez, four of these prefixing Alphonsus. 'Most frequently he is confused with the Jesuit lay-brother, Saint Alphonsus Rodriguez, who was his contemporary and also a spiritual writer. It is worthwhile, therefore, to set things right by sketching the main events of his life, about-which there is almost nothing in English, and also to add a few interesting details about his great spiritual book. For an account of his early year~', two documents, signed by himself, are of special value. The first is a statement 1~82 Ma~ , ! 944 " " WHO I8 THIS RODRIGUEZ? written by him in the third :person when he was received.:.as. a Jesuit novice in Salamanca:- "He was examined by Father Rector, July 141 1557. Native of--Valladolid, 19 years old, son of Doctor.Rodri-guez and. I)ofia Maria Garcia; a student, has done two years of theology; has profited, greatly from his studies. Signed: Gonzfilez Alonso .Rodrlguez. J In the margin occur these words: "He has.received the tonsure." ¯-Four and a half years later, in January 1562, Alphon-sus, then a Scholastic, filled out-a questionnaire for the Jesuit Visitor from Rome,. Father Jerome Nadal, in which¯ he gives us acandid.portrait of himself (Monttrn.entaS.d.; Nadal, Tome. II, pp. 532-533) : " "My name¯is Alonso Rodriguez. -- Three months from now I shall have completed my 24th year.x , -- I am from old Castile.and V-alladolid. m My parents-are living: -- They have sufficient to support them. --. I have two sisters who are nuns, and four brothers: one.is a monk, another is a priest. , the other two have. almost nothing~ except what their parents may leave them .,. neither is married. " -- I have no debts or obligations, .excepta half-real. which I found and. though knowing to whom it belonged, I did not return it ;.now I have nothing, and even. if I had anything, it seems I could not return it.-- In the world I was devout and given to prayer and almsgiving; and so I prayed a lot, but I did not often frequent the.sacra:. ments, nor did I know anything about mental prayer.-,- I made a vow to be a religious or a monk " On account: of my vow and desire to serve God, .I entered the Company without any consolations., four and a half years ago . . ~ It is a year and a half since I took the vows. ~ Once I XHence, Alphonsus Rodriguez was born in 1538, and, not in 1526, as is stated in Father Rickaby's English edition and elsewhere.' 183 AUGUSTINE KLA~$ Review/or Religious made:the exercises of the First Week for eight or~ nine days. -- I have served in the lowest'offices of the house, made a pilgrimage, served" in hospitals., taughtcatechism. - "I desire to persevere until death in the Company and, with the grace of the Lord, to Obey in all things, no matter how difficult and hard they may be, and to keep the rules very perfectly,, as something in which my perfection con-sists. I desire very much to undergo all the mortifications and experiments of the Company, as though I had just recently entered it, and I desire my superiors ~to take great care to mortify me, because I need it very much, since I am very remiss in mortifying myself . On the other hand, Our Lord gives me promptness to obey in all things . . . Particulaily do I wish to be instructed in prayer .(about whichI am very ignorant) in order to know how to make further progress. -- Wherever the greater service of God our Lord may be, thither am I inclined to go; even though it be to the confines of the earth, I shall go there with good will; and I desire to be able and capable of undeitaking difficult and great things with the div.lne favor. -- Sala-manca, January 15, 1562. Alonso." ¯ Questioned about his studies, he adds: "I have studied thirteen years: five of grammar and three of arts in Valla-dolid, and am now studying theology for the fifth year in Salamanca. I have been thought to be very healthy through-out my studies. I have an inclination for studies, and especially, for theology. But I have little talent for them, especially for metaphysics. Memory is poor and intelli-gence likewise. I know very little about anything, but it seems I know more theology than anything else. I am a bachelor of arts." Obviously Alphonsus.was a young man of high Spir-itual objectives coupled with a humble estimate of him-self. This depreciating inventory of his talents and virtues, .184 May, 1944 WHO Is THIS RODRIGUEZ? however, was not accepted by his. superiors, for after his studies and ordination to the priesthood he was immedi-ately made master of novices in Salamanca at the precocious age of twenty-five. And the records of the time note also that he was "very skillful in solving cases of conscience:" Three years, later, in 1~566, Father Rodriguez left the novitiate at Salamanca for the joint college and seminary at M0nterrey in Galicia, where he taught moral theology in the seminary. Certain little moral treatises written during this period were highly esteemed by Father Thomas San-cbez, the distinguished Jesuit moralist, who made use of " them in his own writings. R.odriguez wasalso rector of this institution of some eight hundred students for six years (1570-1576), and, despite his many duties as rector and professor, f?equently preached "with some ability," heard confessions, and taught catechism in the town's ¯ environs. In 15 79 we find him. in his native cit.y of Valla-do! id, engaged in the Works of the ministry and solving cases of conscience. He remained there for six years. In 1585, by special Order of Acquaviva, the Father General, Rodriguez was sent from his own province Of Castile to that of Andalusia"to be rector and mas[er of novices at the famous college and novi'tiate of .Montilla. He was sent as a troubleshooter to solve some peculiar diffi-culties ~involving the training of young religious. His own provincial superior, Father Villalba, was loath to let.him- .go! "In very few men are so many qualities found together: It is truly a considerable loss for our province. He is very learned, an excellent religious, and made for training young religious in spiritual life and devotion. Of that we have no less need in Castile than in Andalusia." (Astrain, Historia IV, p. 745) On the otherhand, the success of his work at Montilla can be gaged from a letter written two years later to the 185 AUGUSTINE KLAAS Review /:or Religious General by the Andalusian Provincial, Father Gil Gonz.~- lez Dfivila: "One finds there the true formation of the Company and the real way. of training novices . Those who come from" it live according to the true religious spirit, the spirit, of obedience and abnegation, and are. distin-guished for these virtues? To my mind, the best present that Your Paternity has made tb our province . has been to call to it Father Alphonsus Rodriguez; and I hope that if the Fathers of the. third probation pass through his hands, the fruit will be still more precious . '~ (Astrain, ibid, IV, p. 745) Another n~ark of confidence was shown ¯ him when he was chosen to represent the Andalusian prov-ince at the Fifth General' Congregation of his order, held in Rome in 1593. This Congreg.ation put an end to those internal difficulties of the Spanish Jesuit provinces-for .the solution of which Father Rodriguez had labored with such consummate prudence and ability. Five years later Rodriguez left Montilla, having been appointed a general inspector of the Jesuit-establlshments in the province of Andalusia. That done, he.was in Cor-dova the following year, hearing .confessions and giving retreats, and there he remained for eight years, until 1607, when at the age of sixty-nine he once more took up his old duties as master of novices, this time in Seville, and added to them the duties of spiritual father of the community. This was to be his last appointment. During the final two years of his life he was plagued with ill-health and the infirmities of age, so.much so that he could no longer offer up the Holy Sacrifice of the Mass. Then, on-February 21, 1616, "after having received all the sacraments with full consciousness and with such serenity that he seemed rather to sleep than to die," he quietly passed away at the goodly age of sev2 enty-seven years and ten months. Father Alphonsus Rodriguez was an exceptionally 186 .7 May, ,1944 WHO IS THIS RODRIGUEZ? well-balanced character--not brilliant, but prudent, reli-. able, and stead~: Father Nieremberg, who knewhim well, describes him as "affable, thoroughly saturated with the charity of Christ, without a trace of bitterness or sadness; a faint, gentle smile on his countenance." He was much given to' prayerful retirement and perhaps for that reason was som. ewhat timid in meeting externs, He was notwhat we call today "a contact man." "I do nol~ know how to dea! or observe the amenities with e~:terr~s, as my duties demand," he wrote humbly to the General. And Father. GonzMez, the Andalusian P~ovincial, mentions in an offi, cial letter the ."timidity of the superior'.' and ',his emba'~- rassed mannerisms," but adds that this difficulty can be remedie~d by having recourse to ~ther Fathers--and he might have added that the suppl3; of such is usually plen-tifui. : Nevertheless, despite this annoying h~indicap, he was a capable superior, demanding an exact account of what was being done and giving orders so precise that "he seemed. thoroughly attentive to each detail withoutany distrac-tion." His decisions once understood and their carrying out assured, he gave himself heart and soul to the spiritual direction of his novices and subjects. Here he was the mast ter perfectly at ease. In an unobtrusive way, he was a man of constant prayer, mortification, and meticulous observance of rule. When h~ was told that his austerities might shorten his life, he made the disconcerting, but very discerning reply, "An unmortified religious man. is already dead." His own religious brethren do not seem to have been too much aware of his more than ordinary sanctity, for when the 3esuits of Madrid were officially proposing to a certain prelate of the Rota the beatification of Rodriguez' fellow-townsman and contemporary, Father Luis de la Puente, the great author-° 187 AUGUSTINE KLAAS "." Review [or Religious ity on prayer, the prelate exclaimed: "Good! but why not make the same recommendation for the saintly Father Alphonsus Rodriguez ?" His Book At what period of l~is life did Father Rodriguez write his Practice of Perfection and Christian Virtues? The bulk of it was written and delivered as exhortations during the thirteen years he was master of novices at Montilla. 'At the bidding of superiors, he arranged the material and improved it during his stay at Cordova, and finally published the first edition in 1609 and the second in 1611 at Seville. ~During the last year of his life, though suffering greatly -from his infirmities, he revised the whole work for a third edition. :. When he was informed on th~ Feast of the Puri-fication, 1616, that the printing of it was completed, he folded his hands and said. cheerfully, "Now thou dost dis- .miss thy servant, O Lord, according to thy word in peace" .(Luke 2:29). Two weeks later he was dead. The book has gone through more than fifty editions in Spanish, and has been translated in.to at least twenty lan-guages, including Arabian, Tamil, and Chinese. Among the French translations we find one made by the Jansenists in 1673, in which the.y secretly inserted their erroneous doc-trines on grace. ¯ The first English version was ¯published between 1697 and~ 1699, the translator being none other than Sir John Warner, Baronet, of Parham in S{affolk, otherwise known as Father John Clare, S.J. He is an interesting pe.rsonage. With his young wife he was converted to the true faith and both decided to become religious. She became Sister Clare of the Poor Clares of Gravelines; he.became a Jesuit. They made their solemn profession on the same day, August 15, 1667. Subsequently he became procurator, and later 188 Ma~l, 1944 WHO IS THIS RODR~GUEZ? provincial of the English Pro;cince, but spent most of his life as master of novices and spiritual father at the English novitiate at Warren, Belgium. It was there towards ~he end of his life that he made his translation through the medium of the French version of Abb~ Regnier des Marais,. and saw it through the nearby press of St. Omers. Father Joseph. Rickaby, S.J., the most recent English translator, made some use of it, for he notes in.his preface: "it has cost the present translator a world of toil and trouble. In my veneration for the quaint old seventeenth century version, still read amongst~ us, I endeavored to base my work upon that, instead of doing what I was ultimately forced to do, translating straight from the" Spanish." Practice of Perfection .and Christian Virtues is prima-. rily and .almost exclusively an ascetical, not a mystical work. To criticize it unfavorably, as some have done in recent years; for not discussing mystical prayer at length is unfair. Such was not the purpose of the book. Its author's principal aim was the training of young religious; accordingly, being a man of prudence and common sense, and a go6d pedagogue, too, Rodriguez adapted his teaching on higher prayer to the limited capacity of his disciples, who were mostly beginners in the spiritual life. He is not "anti-mystical.''~ The work deals not so much with the theory of asceti-dism as with its practice. The author.says that he.put the. word Practice in the title because "things are treated in it ih such a .way as may render their practice, very easy." Nor is the subject-matter discussed comprehensively in all its details: "I have laid before" you, as clearly and briefly as I was able, such things as are more essential and more corn- 2To cite but one eminent authority: Father Herbert Thnrston writes in The Month (Vol. 154~ p. 425) : "There can be no question that Father Rodriguez recognized and extolled the higher prayer." Cf. Rodriguez, Practice Vol. 1, pp. 254, 255, 262. 189 AUGUSTINEKLAAS " Revle~v for Religious mort to our profession." However, this practical, limited scope does not on .that account place his spirituality on a low plane. Rodriguez seeks to lead religious.to the highest sanctity by faithfulness to duty in little things, byperfect performance of ordinary adtions, by unremitting purity of intention, by habitual and ever closer conformity to the will of.God. He endeavors to form religious of sustained prayer, m6rtification, apostolic zeal, °and all the virtues; and he points to the loftiest exemplars, Christ and His saints, for "to attain to perfection, one must fix his eyes on what is highest and most excellent." And who will say that he has not succeeded? ¯ The principal sources of Rodriguez' doctrine are Holy Scripture, the Fathers of the Church, and the great spir-i. tual masters of the.past, with a particular pr, edi!ection for those stal~carts, .the religious of the desert. Among the ¯ most frequently .cited authorities are Saint Augustine (271 .times), Saint Bernard (2.5.8 times), Saint Thomas Aquinas (86 times),., and Cassian. ~is. .p.Huries . Ccoasmtilpiaons aitnido nab iosv de ethaer .oa.nrddi n.amrYet~h .0i.dni lcia.t!e:r ahriys~la mnegruita,ge ~hough somewhat .prolix. He has imagination and a ,ki, ndly humor--'.'pepper and¯salt," as one.writer says. For examp!e~ he says that a religious who jumps h, astily a.nd light!y from virtue to x~!rtue is "likd a cat w.~lking on hot coals." I.n addition, all will agree that Rodriguez has an indefinable unctionall his own. " 0fcourse, A!phonsus Rodriguez is. by. no means the perfect author. In his knowledge of things scientifiC, his-torical, and hagiographical, he is a man of his times. He considers certain apocryphal works authentic; too often he copies his sources at second hand; he draws ~considerably on the uiapublished exhortations of his Provincial, Father Gon-zfilez D~ivila, without giving him due credit. A few points 190 Ma~t, 1944 WHO IS THIS RODRIGUEZ? of his doctrine can be legitimately contested and evem impugned. Some of his examples and anecdotes are con-sidered today to be lacking in good taste: many'of, these have been excised in recent editions. But, after all, these. are only minor flaws in an author whose work is a master-piece of spiritual writing, that has successful"ly stood the test of time, and that even.with readers who are more than" ordinarily critical and exacting. It is today the most widely used spiritual textbook .of religious .the world over. A definitive critical edition would indeed be Very Welcome: Many witnesses could be Cited to proire the value and popularity of Rodriguez. Forexample, Father Faber calls the book "an inestimable treasure of the Church." Found-ers and foundresses of religious congregations have been especially lavish in their praises. Our own Mother.Chbrini drew up a list of five books as constituting a sufficient, spir-itual library for her congregation. They are: the Imitation ¯ of Christ, the St~irituat Exercises; the Religious in Solitude Of Father Pinamonti, S.&, the :Bride o[ Christ Of Saifit Alphonsus Liguori, and thePractice of-AlphonsusR0dl!- guez. Saint Alphonsus. Liguori and Saint John. E~dgs. often recommended~ the. Practice. Let Saint Vincent de Paul; the founder of the Lazarists, be our last witness.~, In an instruction to his.religious icongregation dated May: 17, t 658, accompanying the book of Rules he was sendiiig,: he exclaims: "'O Lord, who hast bestowed such blessings~ .on .many books, for example, on the"one we are now re, adihg - at table, so that well-prepared souls migh~ reap .therefrom considerable fruit, in order to free themselves from their faults and go forward in perfection, grant, O Lord,. th) blessing on this our little book . " Father Pierre Coste, the saint's official biographer, says that the book being read at table was none other than the Practice of Per-fection and Christian Virtues by Alphonsus Rodriguez. 191 Two Hymns t:o Mary Francis N. Korth, S.J. SEVERAL mon.ths a'go a reader of REVIEW FOR RELIGIOUS'wrote to the editors for information concerning a hymn beginning with the words, "Te Matrem." As the editors had no definite information to offer, they addressed the question to the other readers (cf. Vol. III, p. 70). In answer to this request a large number of letters w~re received. These letters carried a great deal of interesting information concerning two hymns to Mary, Te Matrem Dei Lau-damus and Te Mariam Laudamus. The present writer has collated the' information and digested it into the following paragraphs. The hymn Te Matrem Dei Laudamus, often referred to as the "Canticum. S. Bonaventurae," adapts the canticle Te Deurn to the praise of Mary. It is usually printed at the end of five psalms in honor of the Blessed Virgin Mary, each of which begins with a different letter of the word "Maria." St. Alphonsus Liguori, busy as he was, frequently said these five psalms. For several centuries after the death " of St. Bonaventure (1274), the great 'Franciscan theologian' 'and Doctor of the Church, the Te Matrern was attributed to him. It is found in the early editions of his Opera Omnia, either as a separate canticle or as part of the" Psalterium Majus B.V.M: It is not found, however, in the latest and most critical edition (the Qu~racchi edi-tion) Of St. Bonaventure's worksY Fr.Gallus Haselbeck, O.F.M.,in his Seraphiscbe Marienrninne remarks in substance that, while St. Bona-venture wrote poetical works, there is no poem on the Blessed Virgi.n that can really be proved to be ~is work. (See also J.H. Sbaralea, 8upplementum et Castigatio ad Scriptores Triurn Ordinurn S. Fran-cisci,' Romae, Editore Nardecchia, 1908, Pars. I, p. 1640 It seems that the Te Matrein Dei Laudamus was composed for the Great Office of the Blessed Virgin. This Office never gained uni-versal "recognition and has not become a part of the' Liturgy of the Church. However, the Te Matrem itself has'been used extensively at various times for p.ublic and private devotion. Venerable Vincent Pallotti, founder of ~the Pious Society of' Missions, propagated it through his books and.used it for May devotions. Several of our corkespondents told us about anothe'r hymn, Te Mariara Laudamus, similar to the Te Matrem. The Te Matrera 192 1944 Two HYMNS TO MARY has 44, 45, and 46 verses respectively in the three available Latin versions (all have the same thoughts with a few divergent verse-arrangements) and 43 verses in the two Engli.~h translations at hand.1 This hymn (the Te Matrem) is an almost literal transposi-tion of the thought of the Te Deum, with the exception of 14 extra vers~s (all beginning with "Tu" in the appended Latin text) inserted in the middle of the canticle. Aside from this inseition, the Te M~trern is a closer parallel'of the Te Deum than is the Te Mariam. The latter, however, with its 30 verses in the Latin (29 in the Eng-lish), comes closer to the length of the T'e Deum. Might this prac-tical identity in length have been the reason for the origin of the Te Mariam? At any rate we are told by one reader .that the Te Mariam is an abridgement of a much longer hymn (the Te Matrem) attributed to 8S. Augustine, ~Ambrose, and-Bonaventure in $chiitz, Su'mma Mariana, IL 310. Father William d. Chaminade,~Founder of the Society of Mary, included the Te Mariam in the Manual of the Servant of Mar~/, a book of prayers and hymns which he corn-- piled for the godalities of the Immaculate Conception at Bordeaux, France. This M~nual was printed in 1820 or earlier. In a copy of the Manual it is stated that Father Chaminade took the Te Mariam from one of the then current. French Antiphonaries. Anotl~er cor-respondent writes that "the Te Mariam is sung in places of pilgrim-age of the B.V.M., at least in some basilicas or places of pilgrimage in France." The Te Mariam is found in the Formular!l of the Society~ of Mary. Separate leaflets are printed at Maryhurst Normal, Kirk-wood, Missouri. At Marynook Novitiate (Society of Mary), Galesville, Wisconsin, "they also have the melody: it is really the . melody of the Te Deum laudamus adapted to the words and phrases of this Marian hymn." A variation of the Te Mariam can be found in The Reign of Jesus through Mary---On True Devotion to the Blessed Virgin according to Blessed Grignion de Montfort, Founder of the Com-pany of Mary. This book, composed in, French by Father G. Denis, S.M.M., was translated into English by'.Father A. Somers, S.M.M., and published in 1926 by Burns, Oates, and Washbourne, ,London, England. To conclude briefl~r: the Te Matrem dates back to the thirteenth 1A version of the Te Matrem under the heading, "CaCti urn Sancti Bonaventurae.". was copied thirty years ago from a Latin bo6k in honor of our Lady; the copyist tells us it has 48 verses. 193. FRANCIS N. KORTH, S,J. Review for Religiot:s century at least;, its authorship is unknown. It is not part of. the liturgy of the Church, but has been used for public and private devo-tions by various groups. A similar but shorter hymn, Te Mariara, has been in use since at least the early part of the nineteenth century. Te Matrem Te Matrem Dei laudamus: Te Mariam Virginem profitemur. Te" aeterni Patris Filiam: omnis terra veneratur. Tibi omnes Angeli et Archangeli: Tibi Throni et Principatus fideliter deserviunt. Tibi omnes Potestates et omnes Virtutes coeli coelorum: et universae Dominationes obediunt. Tibi omnes Chori: Tibi Cherubim et Seraphim exultantes assistu'nt. Tibi .omnis angelica creatura inces-sabili voce proclamant: Sancta, Sancta, Sancta Maria Dei Genitrix, Mater et Virgo. Pleni sunt coeli et terra: maiestatis gloriae fructus ventris tui. Te gloriosus Apo~tolorum chorus: ¯ sui Creatoris Matrem collaudat. T~ beatorum Martyrum coetus cahdi-datus: Christi Genitricem glori-ficat. Te gloriosus Confessorum exercitus: Trinitatis .Templum appellat. Te sanctarum Virginum" chorea amabi- 'lis:. k, irginitatis et humilitatis ex-emplum praedicat. Te tota coelestis curia: Reginam honorat. Te per universum orbem Ecclesia invocando concelebrat: Matrem divinae Maiestatis. Venerandam te veram Regis c6elestis puerperam: sanctam quoque dul-cem et piam. Tu Angelorum Domina: Tu Paradisi Ianua. Tu Scala: regni coelestis et gloriae. Tu Thalamus: Tu Arca pietatis et gratiae. We praise thee, 0 Mother of God: and hail thee, Mary, ever Virgin. The whole world venerates thee: as daughter of the eternal Father. Angels and Archangels, Thrones and Principalities: faithfully serve thee. All Powers and Virtues of heaven: all Dominations obey thee. Before thee all the angelic choirs: the Cherubim and Seraphim wait on thee with exultation. With unceasing voice all angelic crea-tures proclaim thee: Holy, Holy, Holy Mary, Mother of God. Mother and Virgin. The heavens and the earth are full: of the glorious majesty of thy Son. With One voice the" ~lorious choir of Apostles: praises thee as the Mdther . of their Creator. T.he white-robed host of' martyrs: glori-fies thee. as the Mother of Christ. The glorious army of Confessors: names thee the Temple of the Trinity. The lovely company of holy Virgins: prolaims thee as the model of virginity and humility. The entire heavenly court honors thee as Queen. Throughout the entire world ~he Church pays honor by invoking thee: as the Mother of Divine Majesty, Venerating thee as the true "mdther "of ¯ the Heavenl~ King: holy, sweet~ ~ind loving. Thou art the Queen of Angdls: and the Portal of Paradise. Thou art the Guide: to the Heavenly Kingdom and its glory. Thou art the bridal chamber and the covenant of mildness and grace. 194 May, 1944 Two HYMNS TO MARY Tu Vena misericordiae: Tu Sponsa, et Mater¯Regis aeterni. Tu Templum et Sacrarium Spiritus Sancti: totius Beatissimae Trini-tatis nobile. Triclinium. Tu Mediatrix Dei et hominum:. Ama-trix mortalium, coelestis IIlumina- ¯ trix. Thou art the Channel of Mercy:" Spouse and Mother bf the eternal King. Thou art the temple and shrine of the Holy.-Ghost: the tabernacle of the Most Blessed Trinity. Mediatrix between God and man: lovei of mortals, our heavenly enlightener. Tu Agonizatrix pugnantium. Advocata." Thou art the Inspirer of warriors: pauperum: Miseratrix et Refugium peccatorum. Tu Erogatrix munerum: Superatrix ac Terror daemonum, et superborum. Tu.mundi Domina, C6eli Regina: post Deum sola spes~:nostra. Tu Salus Te invocantium, Portus naufragantium: miserorum Sola-tium, pereuntium Refugium. Tu Mater¯omnium Beatorum, Gaudium plenum post Deum: omnium super-norum civium Solatium. Tu Promotrix iustorum, Congrega-trix errantium: Promissio Patriar-charum. Tu Veritas Prophetarum, Praeconium, et Doctrix Apostolorum: Magistra Evangelistarum. Tu Fortitudo Martyrum, Exemplar Confessorum: Honor et Festivitas Virginum. Tu ad liberandum exnlem hominem: Filium Dei suscepisti in uterum. Per Te, expugnato hoste antiquo, sunt apert.a fidelibus gegna c"oelorum. Tu cure Filio tuo iedes: ad d~xter~m Patris. Tu [psum pro nobis roga, Virgo Maria: Quem nos ad iudicandum credimus esse venturum. Te ergo poscinius nobis tuis famulis subveni: qui pretioso sa~nguine Filii tui redempti sumus. Aeterna fac, pia Virgo: cure sanctis tuis nos gloria numerari. S~Ivum fac populum tuum, Domina: ut sirens participes haereditatis Filii tui. E~ rege nos: et custodi nos in aeternum. Per singulos dies: O Pin, Te salutamus. ¯ the advocate of the poor, and the compassionate refuge of sinners~ Almoner of Heaven: conqueror and ter-ror of demons, and of the haughty.-. Queen of Earth and Queen of Heaven: after God, our only hope. Welfare of those who invoke thee: haven of the shipwrecked: solace of the ~retched. refuge of the dying. Thou Mother of all the Blessed, after God their fullest joy: comfort of. all the citizens of Heaven. Thou art the Patroness of the ins_t, thbu gathere.st the wandering: and art the promise of the Patriarch~. Thou art the truth of the Prbphets:" the glory and the teacher of the Apostles and Evangelists. ~ Thou art the strength of Mai~yrs, the exemplar of Confessors: the. honor and joy of Virgins. To frde man from exile, tho6 did~f receive the Son of God in thy~.omb. By thee was co.nquered our enemy of old: and Hea~,en was opened for the faithful. With thy Son thou sitt~st: at the: right hand of~the Father.' Pray for us to Him, O Virgin Mary: ~-: who, we believe, will cgme to. judge us. Wherefore we beg thee to aid us, " " thy. sdrvants who have been re-deemed by thy Son's Preciofis Blood. Help us, gentle Virgin, to be numbered with thy saints in eternal glory. Save thy people, Blessed Lady: that they may partake of the heritage of 'thy Son. Rule us: ~nd p.rotect us for all eternity. Daily we greet ~hee: O 1o~,ing Mother. 195 FRANCIS N. KORTH; S.J. . Et laudare Te cupimus: usq.uein aeternum mente et voce. ." Dignare, dulcis Maria: nun et ¯ semper nos sine delicto conservare. Miserere, pia, nobis: miserere nobis. ¯ Fiat misericordia tua magna nobiseum: quia in Te, Virgo Maria, confidi- IllUS. In Te dulcis Maria, speramus: nos defendas in aeternum. Te decet laus, Te decet imperiu~a: Tibi virtus, et gloria in saecula saeeulorum, Amen. Te Mariam Te dilectam Dei Patris Filiam: omnes angeli pr~edicant. Te 'admirabilem Verbi Matrem: credit inferus et contremes¢it. Te Spiritus Sancti Sponsam: piacu-lares flammae invocant. Te omnes Ecclesiae hill: totis praecordiis exultant: MatRm : immensae miserkordiae, Carissimam sanctae Annae: et unicam Filiam, Dilectissimam a Deo: Josephi Sponsam. Tu vena ~eniae: Maria. Tu slngularis: Mater es gratlae. Tu ad redimendum genus humanum: tuum commodasti uterum. Tu, Gabrieli dato consensu: gaudium peperisti universo mundo. Tu, Regina, a dextris Dei stas: Circumdata varietate, 196 Reoiew £or Religious And with mind and tongue we desire: to praise thee forever. Deign, sweet Mary: to preserve us now and forever free from sin. Have mercy on us, O loving Mother: have mercy on us. Let thy mercy "for us be bountiful: for we trust in thee, O Virgin Mary. ¯ In thee. sweet Mary, do we hope: do thou protect us forever. Praise becometh thee: empire befits thee: to thee be power .and glory forever and ever. Amen. We praise, thee, O Mary: ~a£d proclaim thee immaculate. All sinners have recourse to thee: for thou art their refuge: All Christians: and pious associa-tions with their individual mem-bers, devoutly" acclaim thy Concep-tion. Immaculate, Immaculate, Immaculate: O Virgin Mother of God. There is none who would hide himself from the genial warmth of thy char-ity: for thou art the morning rising. All the angels proclaim thee: as the loved Daughter of the Father. Even trembling hell acknowledges thee: as the admirable Mother of the Word. The Purgatorial flames invoke thee: as the Spouse of the Holy Spirit. All children of the Church: magnify thee in the exuberai~ce of their hearts: As Mother of infinite mercy, As the dearest and only daughter: of Holy Ann, As the Spouse of St. Joseph: and most beloved of God. Thou art, O Mary, the channel of mercy. Thou art the all-excelling Mother of grace. For the redemption of the human race: thou didst accede to the designs of God. And by consenting to Ga-briefs word: thou didst beget joy for the whole world. Clothed in varied beauty, thou stand. est as Queen at God's right hand, Te Mariam laudamus: te Immaculatam confitemur. Te reorum patronam: omnes peceatores deprecantur: Tibi omnes christiani: ,et asceticae congregationes: tibi singuli so-dales in Conceptione tua devote proclami~nt : Immaculata0 Immaeulata, Immaculata: O Virgo Theotocos. Nullus est qui se abscondat a calore tuo: aurora consurgens. May, 1944 Mediatrix ut sis: Dei et hominum. Te ergo quaesumus, nobis subveni: q~ii tuam nominatim illibatam Conceptionem solemniter cele-. bramus. Aeterna fac: angelorumbe~,tltate donari. Protege tuos alumnos: et tuere fasciculum haereditatis tune. Et love illos: et fecunda in oper-ibus. virtutum. Tuis solemnibus congregamur: ad benedicendum tibi." Et extollimus Nomen Marine: super omne post Jesu Nomen amabile. Dignare, per purissimam Conceptionem tuam: nos a peccato praeservare. Ostende pro famulis tuis Filio tuo: pectus et ubera tun, Ut ostendat Patri sUO Unigenitus: latus et vulnera. Nulla erit repulsa: ubi talia erunt carttatts mstgnta. Te decet laus, te decet hymnus: tibi jubilus, ih Conceptione tua Immaculata00 Maria. ab universa creatura. Amen. TWO HYMNS TO MARY In order to be the mediatrix of man-kind. We beseech thee, therefore, come to our help: who with special and solemn cult honor the immaculate purity'of thy Conception. Grant that one day: we may be made partakers of angelic bliss. Protect thy children: and preserve thy little Society,. which is thy heritage. And cherish them: and" make them al~ound in the fruits of virtue. On thy festal days we gather round thee: to sing thy praises; And we extol the name of Mary: above every other name, next to the loving name of JeSus." By thy most pure Conception:. deign to preserve us from sin. In behalf of thy children: show thy loving and maternal heart to thy Son, so that in His turn, thy only begotten Son may exhibit: His side and wounds to His Father. There will b~ no refusal: when such pledges of love .are manifest. Hymns of praise and jubilation are due to thee from every creature: owing to thy Immaculate Concep- - tion, O Mary. Amen. NOTE ON THE SOURCES OF THE TE MATREM: The hymn has been found in an old Community Book of the Redemptorists which bears the date 1860, Other sources (Latin or English) that were indicated in the letters sent to us are: The early editions of St. Bonaventure's Opera Omnia. E.g.: 1584 Venetian edition. Tom. II, pp. 316 ft. Paris edition, Tom. XIV, p. 222b. It is also the 1504 Venetian edition and the 1596 Vatican edition. C'f. above, for the recent Quaracchi edition. Mese Di Mag~io Consacrato A Maria 8antissiraa Regina Degli Apostoli Ad Uso Degli Ecclesiastici, Vincenzo Pallotti. " Regain et Testamentum 8.P.N. Francisci. : ollegit Ft. Hilarius ab Antwe'rpia; Tornaci Nerviorum, 1876. lntroductio ad Vitara 8ecapbicara, auctore P. Ft. Gaudentio, O.F.M. Herder, Freiburg, 1'882. Summa Mariana, J. H. Schlitz, Paderborn0 Junfermannschen Buchhandlung; 1908: II, pp. 310-312. Via Franciscana ad Caelestera Hierusalem, auctore P. Pa~lo a Cr. Laschan. Pustet, 1912. Liber Manualis Minoritae, editus iussu A.R.P. Donati' a Welle,. O~F.M.Cap: Typis Soc. S. dohannis Evang., Desclee, 1931, (Continued on next page) 197 [EDITORS' NOTE: We intended to" publish only letters on retreats in the present number. But after th~ Ma~:ch number went to prdss we received tw9 communica-tions on vocation that we thought should be printed. Hence the present number - contains letters on both subjects. We had to condense some of these communica-tions,, and.we still have some for later publication. More letters on retreats will 'be welcome. Kindly make them as brief as your subject-matter allows. Address then~ to: The Editors of.Review for Religio.us, St. Mary'.s College, St. Marys, Kansas.] On Re÷rears Reverend Fathers: May I submit the following thoughts that came to mind as I read your request for letters on retreats: A. Making a retreat: Experience has .convinced me that. one must put aside the ordinary duties of acti~re life. A change of scene is imperative, espe- .cially. fOi, superiors .and administrators. 2." A "closed" retreat is the only setting.suitable for the in'yard silenc~ .and r&oilection imperative for success. ¯ .3. It is not good policy to cover much readingmatter. What is read should be .th.eologicaHy sound, suited to the. individual, and pro*ocakive of. reflection. ., . 4. A wholesome pr.actice in preparation for retreat is tO xey!ew, pgst r~tre~ts and one'~-!i.fe following them, with an aim of making the present exercises really influential in shaping one's course from then 'onwards: " '.: " Bi. Giving r~kre;i~s: ". . .: . 1. A reverent approach.is the ~nly proper one:.a retreat is the work of God; a work that may mean the salvation Of a soul or "t]~ )nakifi'g c~f a saint. " ": " (Note"continued from preceding page) The Mffror of the Bless6d Virgin Mary and The Psalter of our. Lady, by St. Bonaventure. Trans. by Sister Mary Emmanuel, O.S.B. B. Herder Book Co., St. Louis, 1932. Pp. 294-297. The Catholic Apostolate, published by the Pallotine Fathers, Milwaukee, Wis-consin, Vol. XI, p. 113. (Eng. trans, by the Rev. Jos. Baier.) Deuotion in Honor o~ our Blessed Lady; The Fioe Psalms: pamphlet issued by Tile .International Catholic Truth Society, 405-407 Bergen SL, Brooklyn, N. Y. (It is published by permission of the Redemptorist Fathers.) 198 . :.: . COMMUNIGATION$. ,. 2.The retreat master would .d0. well to avo!d.ipeaking,0f. himself. ¯ , 3. Conferences should be kepton a i~igh plane: deeply and supernaturally spiritual. They should be delivered with simplicity and sinceritg. . - .:. .:. ¯ ,. 4. Retreat m~isters would d0.well to avoid.the .use.of."We." '.'We know," "We realize," "We must," "Yet, we often," and.so forth. Retreatants like to accept the conferences .as coming from God, and the retreat master's identifying himself with the retreatants tends to frustrate their efforts. 5.-Novelties or novel themes should not be used to make an impress.ion, or to convince that the retreat master is "different," or the retreat "different." Sometimes this is done to the" neglec~"of important fundamentals, for'example~hell, obedience,' silence:' " 6. Truths that are old and obvious must be reconsidered in every retreat; and time-worn advice must be repeate.d. ~ . 7.Fresh. presentation is necessary-to draw and maintain interest and attention. .- ~: .:,.~ ¯ " .' APriest : " ~'~! R~)~rend' Father~ i . : '" ' ":""" " .MY .be.st retie~s begin" after"~h~y ~iie"~ohipl~ted. ' Fout'raeiia6rab]~: retreats of mY r~ligi6u~ life: ~i~e' 6nes whi~h,s~and ou for ~me.tl-iing in~'' :rather than ":taking~o~ei~hing .outi" Th~ 'ba~ed on 6ur H61y Rule. " Thh.iekieat 'ifiasker hgd"~en't" for~a coibY,) th~N~iice M~s~ress t61d us, and"made thd Spiritual Effeici~d~ ai3"pl~i dfi:edtiy to our daily; ll; ~s.' Thi'Hbl~;' Rfile became a living:, under.h~s direction. ~ . ' . . ' ' '"" ";~'::':' Anbther father showed ia his conference on the Sacrament of- Penance how very often nuns forget to confess envy:and jealou.sy,and:, to:make their purpose of.amendm.e.nt cen~gr.about love.of neighbor. It: makes one's faults against charity, show in .true.ligh~t. whe'n:.s,h~. confesses the basic, cause, .e:g. envy.S(ill another father he!d~:f0r.th such high ideals of sanctity that "_Christ the Ideal of: th :M0nl~ Marmion is included in. my privat.e spiritual read~ng at. least. ¯once every year since. ¯ . ':. Last summer we l~ad a retreat based on the most.beautiful medi-tations I have ever heard.- The director acually showed us hove.to 199 CoMMuNICATIONS Review [or Religious meditate. I p~ay for him every"day as h bendfactor because h.e has so helped ~y meditation problem. " : i'didn't like a retreat in which we' meditated on the Passion on Easter Sunday because the Exercises put it at ,that time. I didn't like a retreat in Which every meditation began with the sanie formula. "I ha~e never liked '"hell-fire" retreats. I could nevdr be scared intobeing good. I could be converted through 16ve of G~d. I do not like to be "'read at" during retreat. If the director uses notes" I. like to have him look at his audience, now and then. Finally,. thirty-five to forty-five minutes are long enough for any conference. If a retreat master hasn't converted me in a thirty minute. talk, he never will by talking over an hour. A Sister Reverend .Fathers: ,When I make a retreat, I don't like the retreat master to in(ro-duce "novel" things to the~ extent of getting away from-afiy of the old and fundamental truths. And if the retreat master uses the Exercises of St. Ignatius, I like him to bring in the: additions, annota-tions, and so forth, because I think that these help us to understand the¯Exercises and to make a bitter retreat, Also~ I think the explana-tions of the points ought to be short enough to allow the retreatants to meditate for a while by themselves. And I like to have a few little .stories and examples in the explanations of the points, because these lessen weariness and dryness.' Fifi~lly~since you've asked for sug-gdstions-- I believe that most of us who make. retreats are greatly aided if w,e feel that the retreat, master practises what he preaches: A Brother ~everend .Fathers: ' I am living in an infirmary where permanent invalids and some elderly Sistersare housed. For several yea.rs we have had retreat mas. ters who seemed more concerned about having us comfor'table and sympathized'with 'than about stimulating our spiritual lives. But a recent retreat master 'gave us a retreat for normal religious, who should understand "that suffering is basic, to spiritual growth, and~ who, if they understand their fundamentals, should strive to look upon suffering as a privilege in their spiritual lives and to use prayer 200 May, 1944 COMMUNICATIONS and the Uniting of their pains with the Suffering Savior for their own spiritual growth and for Other souls. If any group of religious needs to be stimulated to take their Courage in both. hands and to be willing to struggle bravely "and to fight valiantly, I believe it is the invalided religious. This recent retreat master, helped us. to do just that. Though I" have had devotion to the Holy Spirit for thirty years, it hadn't occurred to me that this is a particularly sturdy, "as well as liturgical, devotion. The retreat master expl.ained it as such; and he recommended it highly' to our sick--to make of us valiant women in our trials, soldiers of Christ, rather than self-pitying children." It gave me much joy to hear this because in my own eleven years of invalidism and hospitalization I have wondered why so many reli-gious look upon their suffering as a tragedy and an" opportunity for sel~-pity. This doesn't seem to be a normal Outlook, especially if one has any knowledge of the suffering which is borne in the world, even in the loveliest of homes. To conclude: From my knowledge of r.eligious, I believe Sisters like a sound exposition of practial truths, a "rousing up" on prin-ciples, a thorough overhauling of their every-day living--always with a definite solution through prayer and the Sacraments. This may sound like a large order; but I give it relatively and in contr"ast to the retreat in which one is left with volumes of theory or pages 9f mysticism. I have no quarrel with the beautiful mystici~sm of the Church. I love it. But women seem so often to become mysti.fied instead of mystical! Perhaps men do, too; I wouldh't know, but I have always thought that they are more apt to keep two feet on the ground. A Sister On Voca'don Reverend Fathers: In response to your invitation to "talk about vocations," we are eager to take advantage of this opportunity tO say something for the vocation to the contemplative life. ¯ Rev. 3oseph.3. Strauss, C.SS.R., in his communication on The Little Flowe~ Mission Circle, states that vocations need encourage-ment. This is particularly true of vocation.s to the contemplativ~ life. When a girl feels a desire to enter the cloister, she knows she is aiming high. She does not fed any too sure of herself, a.lthough she feels strongly drawn to a life of prayer and penance. Now, if she is 201 COMMUNICATIONS Rboieto t~or Relibious told that such a life is too difficult, that it does not accord with the spirit of our age, that it is useless, that she' could do more for God in" an active Order, she begins to doubt that God wants her in the clois-ter. She does not expect her parents to "feel, enthusiastic over her separating herself from them so completely, but .when she is dis-couraged by confessors, former teachers, religious friends on whose good judgment.she has always relied for guidance, the result often is that she enters an active Order where she does not firidcontentment, and very often leaves after a shorter or longer trial. This observation is the result of our,own personal e_xperience,in interviewing those who desire to enter our Order after ileaving an active one, or members of active communities who desire to make a change. We feel that if all those who have felt a desire to embrace our life had been duly encouraged we would not experience a want of vocations. - Poor Clare lquns Reverend Fathers : The letters in yo.ur REVIEW FOR RELIGIOUS concerning rdigious vocations have interested me. I strike my breast on many scores. For example, I have not put religious pamphlets in conspicuous places where young girls seeking information may receive the vitamins to increase or satisfy this hunger. Material about nursing, social work, and teaching is easily obtained, but they see.little about religious life. I hang my head when it comes to bringing up the subject in conver-sation. I wait f6r the girls to question; they wait for the Sister to instruct. The result is that nothing happens. In.'my prayers the petition for more candidates tags at the end of other requests which seem of more immediate importance. Unwillingly and u.nknowingly I m~y have shocked today's youth. They see us at such close range and are quick to criticize any lowering of their ideal. "The world is sO much with us" that it is easy to slip into its mannerisms. Now after accepting my share of the blame, I intend to fortify myself behind a table and say to the regular confessor of°young women, "Father, what about.you?" . You know your weekly peni-tents and afte~ a year or so you know their spiritual progress and desires, their temptations, in the world and their reaction. Some of these girls might be waiting for a suggestion from you that.would bring into being their first thought of a religious vocation for them-selves. 202 Mag, 1944 COMMUNICATIONS Perhaps in today's s.eminary you are instructed not to offer such. suggestions. .If that be the case then stop reading this immediately. I only know that it is because of my confessor I happen to be where I am, and I am extremely grateful for his suggestion of over twenty years ago. His Saturday line was a very long one so he didn't h;ive much time for each indiVidual. Outside of the confessional I didn't speak to him~more than a dozen times, and then only to bid him the time of day as we passedon the str.eet--so the influence came through the confessional. He first advised me to go each week to Confession and his advice was followed. Then one day he surprised me with: "Do you enjoy going out?" "Yes,. Father." "Do you have a good time in a social crowd?" "If I know the crowd." "Do you keep steady compa.ny?" "No, Father." "Will you say a prayer every, day for a special intention?" "Yes, Father.". A few months later he'qubstioned: "Do you know anything about the life of Sisters. "A little, Father." :'Do you think you would like to be one?" "No, Father." "Well, don't let this question, worry you. Say some praye.rs every day thi*t God ¯will let you know His will and that yot~ ~ill have the:strength to follow. I will remember this inten.fion in ~y Masses." ¯ Thus my confessor took 5he initiative and helped me to make: ~he ¯ first few steps toward my "vocation. This seems to me. to be. grand work--one that the regular, confessor can surely do better thhna retreat master or a teacher: In the future I'll .try harder to foster vocations that are so greatly needed but When it comes to bringing up the subject in conversation I think I'll turn to the regular confessor and say, "Father, what about you?" A Sister 203 Book Reviews THE MAN FROM ROCCA SIC;CA. By the Reverend Reginald M. Coffey, O~P. Pp. xi -I- 140. The Bruce Publishing Company, Mil- ¯ waukee, 1944. $1.75. " '~History probably offers no parallel case of a man being so com-pletely identified with wha~ he has Written. St. Thomas very early, poss.ibly even in his own lifetime, became an institution rather than a personality" (pp. 100, 10.1). In a well-conceived attempt to por-tray the human Thomas, the" author of this popularly-written little volume makes use of the legends and scattered data on the saint's life to reconstruct a fair picture of the man behind the Summae. Apart from a number of distra.cting author-to-reader asides and. an occa-sional expression not in the best of taste, the general reader who is l/o.oking for an 'introduction to this thoroughly human .personality will find The Man from Rocca Sicca satisfying fare. Several pages in .the chapters on the "dumb Ox," on Thomas the saint, the man, the preacher live up fully to the high promise of Father Farrell's preface. They stand out considerably above the level of the rest of the book in giving "a humanly touching intro-duction to Brother Thomas." In this day of excellently written biography and of exhaustive research into medieval sources, one looks forward to a definitivd life_ of St. ThomasAthe .religious, the statesman, the teacher and preacher, the champion of truth, the human dynamo, the dominant personality of his time. The'Man from Rocca Sicca suggests the human values that. will warrant special treatment.mL. THRO, S.J. SUBDEAC;ONSHIP: C;ONFERENC;ES ON THE RITE OF' ORDINATION. By the Revere'nd AIoyslus.Biskupek, S.V.D. Pp. xl -t- 301. B. Herder' B6ok Co., St. Louis, 19~44. $2.50. These medita~ion~ are the fruit of twenty years' experience in directing the Ordinandi Retreats at Techny. Father Biskupek quickly realized how rich in lessons for the young cleric was the ordination liturgy, suitable especially to the days preceding the cere, 'mony. Having found nothing in print along these lines, he mod-estly offers his own reflections as "something new in a field that stands in need of more cultivation."~ .204 BOOK R,EVIEWS The idea is splendid~ and worked out with a gentle persuasive-ness that bespeaks the fervor and maturity of its author. An outstanding merit o~ the book is its attractive simplicity. With no display of erudition or subtlety it proposes straightfor-wardly and effectively the clerical virtues which quite obviously link themselves to the sacred text. To some this obviousnes~might appear superficial. We might look for mort of penetration, grandeur, vitality. Two remedies suggest themselves: evidence of wider familiarity with historical and ascetical backgrounds, and a more humanly appealing richness of inspirational stories and actual experiences from the priestly minis-try. "Retreat masters might feel that a psychological analysis of the cleric's obligations is a more suitable framework for 'the daily medi-tations than the random sequence of the ceremonial. But for a daily hour of conference to link the retreat with the ritual looming so bright on the horizon, the comme.ntary is rich in suggestion. ~R. NORTH, S.J. MARYKNOLL MISSION LE'I'rERS: VOLUME II, 1943. Pp. viii ~-k 54. Field Afar Press, New York, 1943. $ .50. Falling bombs! In an instant a life;s work in utter ruins! Amid the terrors of war Maryknoll heroes are saving souls by bringing Christ not only to Chinese, but also to our American service men in China. The Letters give vivid persotial accounts of work ainong the Bhuddists, shopping tours in Kwelin, the strange life at Tibet, mis- "sion schools in war-torn villages. Thi~ second part of this booklet answers the question, "Why send missionaries to.South and Central America?" The descriptions of the sleepy life of the "barracas," the visit of Vice President Wal-lace to the mission in Villa Victoria, the tender devotion of the natives to Mary, the uniq
Issue 14.6 of the Review for Religious, 1955. ; A. M. D. G. Review for Religious NOVEMBER 15, 1955 Jnfecjration . Joseph P. Fisher Community Workshop . ¯ Sister Mary Joselyn Renovation and Adaptation . Joseph F. Gallen Book Reviews Questions and Answers Index to Volume XIV VOLUME XlV NUMBER RI:::VIF::W FOR RI:::LIGIOUS VOLUME XIV NOVEMBER, 1955 NUMBER 6 CONTENTS INTEGRATION--Joseph P. Fisher, S.J . 281 COMMUNITY WORKSHOP OF THE DULUTH BENEDICTINES-- Sister Mary Joselyn, O.S.B . 287 SPECIAL ANNOUNCEMENTS . 292 RENOVATION AND ADAPTATION---Joseph F. Gallen, S.J . 293 BOOK REVIEWS AND ANNOUNCEMENTS-- Editor: Bernard A. Hausmann, S.J. West Baden College West Baden Springs, Indiana . 319 OUR CONTRIBUTORS . . 328 QUESTIONS AND ANSWERS-- 29. Tax on Religious Houses for General Expenses . 329 30. Salaries of Religious to be Assigned to Province . 329 31. Indulgence in the Form of a 3ubilee' . . 330 32. Order 'of Procedure for Former Mothers General . 330 33. Matter for Questioning in Canonical Inquiry . 331 34. Modesty of Eyes . 332 35. Bowing to Superior's Chair . 333 36. Illegitimacy, When an Impediment . 333 INDEX TO VOLUME XIV, 1955 . 334 REVIEW FOR RELIGIOUS, November, 19550 Vol. XIV, No. 6. Published bi-monthly: January, March, May, July, September, and November at the College Press, 606 Harrison Street, Topeka, Kansas, .by St. Mary's College, St. Marys, Kansas, with ecclesiastical approbation. Entered as second class matter January 15. 1942, at the Post Office, Topeka, Kansas, under the act of March 3, 1879. Editorial Board: Augustine G. Ellard, S.J., Adam C. Ellis, $.J., Gerald Kelly, S.J., Francis N. Korth, S.J. Literary Editor: Edwin F. Falteisek, Copyright, 1955, by Adam C. Ellis, S.J. Permission is hereby granted for quota-tions of reasonable length, provided due credit be given this review and the author. Subscription price: 3 dollars a year; 50 cents a copy Printed in U. S. A. Before writing to us, please consult notice on inside back cover. Int:egrat:ion Joseph P. Fisher, S.J. ALL good Catholics cry out against secularism--the divorce of God from His world. They rightly insist that God must be made a part of a man's daily life, that God must be brough~t into education, business, government, entertainment--all the pursuits of human life. Men who insist on keeping God out of public life will make shipwreck of human life. If God is kept, so to speak, in church and not allowed to go out into the market place, the business world, the motion-picture halls, the places of government, then man will live most of his life without God and that is sure to be fatal. Although a religious is not likely to be tainted by secularism in the sense in which it is used above, there is a possibility of a some-what similar division in his life between the spiritual and ordinary life. How often a spiritual director finds that young religious going forth from the novitiate or from a period of some concentration.on the spiritual life into the active life feel very uncomfortable in their new surroundings and activities., Often enough they feel as if their spiritual life has evaporated almost overnight. At least it seems to them that they have suffered a great setback in their progress in the life of the soul; and that--naturally for good religious-~causes them concern. They then look upon their present way of life with some-thing like suspicion or even distrust, and they hanker, as it were, for the fleshpots of Egypt. It must be admitted that often, when such transfers are made, there actually is a loss of interest in spiritual things because of the, many distractions that duty and, perhaps, desire of relief bring into the lives of such religious. But much of the difficulty can be traced back to a wrong outlook on the spiritual life. In a sense it is alm0st inevitable that young, inexperienced minds develop a certain attitude on the spiritual life because of the way they approach it. Before they entered a seminary or convent, al-though they had been good Catholics, they had not worked sys-tematically on the spiritual life or used the various spir.itual exer-cises standard among religious. As a consequence, when they are. fa.ced .with a whole .new field of life, the spiritual life, and read. about it in books and hear about it in talks and retreats, they look. upon it as something different from what their lives have been, as 281' JOSEPH P. FISHER Ret~iew for Religious something superadded to ordinary life, as even opposed to ordinary life, as unable to be mixed with ordinary life. It seems a life apart, a sanctuaried life. It is 'lived in quiet, and solitude; it grows by prayer and penance; its natural habitat is the chapel or oratory; it is a plant easily wilted by exposure to the winds of the world. And so, when they do go forth from the warmth of novitiate fervor into the cool atmosphere of the classroom or hospital, they feel a chill. And to their minds there naturally seems a split between ~he spiritual life as they knew it and life as they are living it. But is not all this true? To a certain extent it is and has to.be. But frequently there is a ne'edless and harmful exaggeration, an over-emphasis on certain truths to the neglect of others. We can admit once and for all that the common insistence on silence and solitude and recollection is necessary especially for a beginner in the spiritual !ife. Before entering, religion he probably lived among many dis-tractions, engaging in sports, attending dances and parties, going to mdvies, and in general occupying himself with many such matters; and his life to a 'large extent was sustained by these things. Ob-viously, if they were continued, he would go on being supported by them and would never come to lean on the truths of the faith, the truths of the spiritual life. It is only when these false supports are removed and the noise of the world has faded away that he will be forced, so to speak, to lean on God and the things of God. He will either have to swim in the waters of the spirit or sink; or, of course, remove himself. With this admitted, let us turn to the question of how the harmful exaggeration can be handled. The main element in the exaggeration is that it sets up a di-vision in the life of man. Instead of life's being a whole, it becomes a thing of diverse and even antagonistic parts, parts which are held" together rather mechanically and awkwardly. On the one hand there is the spiritual life, needing its sl~ecial atmosphere, nourishment, and care. On the other hand there is ordinary, natural life with its entirely different needs and demands. Some hold them together rather forcefully; some give up the fight in favor of ordinary life; some, we hope, work out a satsifactory integration. The main error consists in thinking that a man is spiritual, is engaged in super-natural activity, only at certain restricted places and times--for example, at prayer, in chapel. If he is not in such places or doing such things, he is regarded as being away from the spiritual, super-natural life. He may be, but he need not be. So the ideal would be if the whole of life were spiritual, super- 282 November, 1955 INTEGRATION natural, if the whole of life were of a piece, if a man were~always about his Father's business. Is this possible? Can a man conceiv-ably be in such a posltxon that he regards a11 things, no matter what they are, as spiritual, supernatural? Whether he eats, plays, talks, suffers-~can it all, in a true sense, be the same? It seems 'that it was for the saints. St. Paul certainly lived out his exhortation: "Therefore, whether you eat or drink, or do anything else, do all for the glory of God" (I Cor. 10:31). ' The biographer of Brother Lawrence of the Resurrection, a discalced Carmelite lay brother, states: "Everything °was the same to him-~every place, every employment. The good Brother found God everywhere, as much while he was repairing shoes as while he was praying With the community. He was in no hurry to make his retreats, because he found in his ordinary work the same God to love and adore as in the depth of the desert" (Brother Lawrence, The Practice of the Presence of God, p. 53). And it has been told of Jerome Jaegen, whose process .of beatification has begun, that he combined attention to external things and to God in a wonderful way: "It is quite remarkable that just when he was campaigning for office and acquainting himself with his new duties, he was pass-ing through what he calls the first phase of the 'Mystical Marriage.' In this phase, to find her Groom, the soul need only turn to Him within her 'where the seat of consciousness is,' where He is always present. While he was a Deputy to the Diet his mystical life reached its full development. He attained to that condition in which one can simultaneously pay attention both to external things and to God manifesting His presence within the soul" (REVIEW FOR RE-LIGIOUS, II (1943), 359). Such, to a greater or less degree, must have been the outlook of all real saints. Life, theft, can be one, can all be spiritual, supernatural. A man does not have to pass arti-ficiall); from one part of his life to the next; does not have to leave for a time his warm spiritual world and run out, holding his breath, as it were, into the cold world of everyday life, then hasten back before his spiritual life has disappeared. It is true that we have been speaking of the saints, and saints could do what we cannot. Assuredly, but, if there is one thing in which ordinary men can well imitate the saints, it is, in this ideal of an integral life, where all is part of a whole. " . By what means, then, can a religious grow in this integrated way of life? The grace of God, of course, has much to do with it; but, as in most other matters concerning the spiritual life, we must 283 ~JOSEPH P. FISHER Revib~V for . Religiohs do our part. Various means can be suggested which are standard matter in books on the ascetical life. However, we shall endeavor to put them in a way that fits our purpose. The first and most obvious means of making the whole of life spiritual, supernatural, is to have what is called a "good intention." With the proper intention, a man in the state of grace can make all his good or indifferent voluntary acts a source of supernatural merit. Theologians dispute about the precise requisites of this in-tention; but all agree that the more explicit and actual the intention, the better. Fbr our purpose the thing to be insisted on is this:'a man should try to grow in the realization of this really very im-portant truth about the power of intention. He has to see it as an integrating factor in his life, as a unifying principle that assimilates whatever it touches into the supernatural life he leads. In this way a man is aware that all is supernatural, that no matter where he is; what he is doing, he has not left the spiritual world but is busy building it. It is clear that this ability to realize all things as super-natural through the means of a good intention requires a more" penetrating and active faith than is required to accept as spiritual such actions as prayer, visits to the Blessed Sacrament, and the like. The next means that suggests itself is the practice of the presence of God. This subject has been treated at length in several previous articles in the REVIEW 'FOR RELIGIOUS. Here I want to emphasize a certain point of view. For our purpose--a means of integration-- the practice of the presence of God remains a rather ineffective means if viewed in the following manner. (However, .there is a place even for it in the case of those who are learning the practice and know what is the further end they should have in mind.) A person is thought of as going along his ordinary life and then at the sound of a bell or at some stated interval as turning away for a moment from what he is doing and thinking of God. Then back to his ordinary life. A rather crude image may give a clearer idea of this method. It will be obvious how the image applies to our matter. A fish's normal element is water--it is at home in water.' But oc-casionally a fish jumps into the air, an entirely different element from water and one in which the fish is not perfectly at home. The forced leap into the higher and lighter element is for only a ~ery slight bit of time. Then the fish relapses into the medium congenial to it. Certainly such a manner of practicing the presence of God, if it goes no farther, would not help integration. On the.'other hand there is a way of practicing it which would be immensely helpful. 284 November, 1955 INTEGRATION As has been well said, we do not really put ourselves into the presence of God--we are actually there, always there. We cannot get away from God--He is closer and more pursuing than the air we breathe. But, of course, we have to know the facts, realize them, act on them. To this end it is suggested that we read matter on the presence of God and often make a meditation such as the Contem-plation for Obtaining Divine Love. It is only when God becomes, so to speak, the element in which we live our lives--in Him we live and move and bare our b.eing--tbat the presence of God will be an integrating force in our lives. It is important to point out that this practice is not only or even chiefly a matter of the mind; for, obviously, we cannot have God in the focus of our minds con-stantly. However, after much work on our part, He can be, as it were, aIways.on the fringe of our attention--but this must be with-out strain or violent effort. And best of all He can be at the end of all our loves; for in all things we can, if we so wish, love God. God, then, can be the unifying principle in our life, making all our living a whole, and enabling us to pass from prayer to play, from play to work, with the conviction and consequent peace that we are always about our Father's business and our soul's sanctifica-tion. It was no doubt with this ideal in mind that St. Ignatius "came to the following conclusion, stated in a letter he caused to be written to some young students and quoted by Father Lindworsky in The Ps~Icbolog~ of Asceticism: " 'Ou_r father holds it for better, ~hat in all things one should endeavor to find God, rather than that long continuous periods of time should be applied to prayer.' In-stead of devoting themselves to prolonged prayer, the students were exhorted to exercise themselves 'in finding God our Lord in all things, "in conversation, in walking, seeing, tasting, bearing, thinking, and in fact in all kinds of activity, for of a truth the majesty of God is in all things' " (p. 68). When a man has come to such a familiarity with God as St. Ignatius implies in this passage, it is hardly right to speak of the "practice" of the presence of God as if it were one practice more or less in the spiritual life. Really it is a man's spiritual life or at least has the function of a barometer in its regard. "Where thy treasure is there is thy heart also." There can be no doubt about it. Although in treating recollection we shall cover somewhat the same ground we did when treating the question of the presence of God, it seems worthwhile to examine the subject in its relation to integration. A rather common way of looking at recollection is in- 285 ~OSEPH P. FISHER dicated in some such expression, as, "He made an act of recollection." This suggests that the person in question is, for the most part, un-recollected, and then briefly recollects himself. This act of recollec-tion would consist of turning away from the distracting, perhaps absorbing, unspiritual business of the moment and turning to the thought of something pious unrelated to the matter at hand. As was said in connection, with the practice of the presence of God, there is a' place for this kind of thing, but it is not at all the ideal. There would seem to be something strange about the idea that a man i's recollected who recollects himself for brief, flashing moments; and for the rest of the time, most of the time, he is anything but recollected." Would it not be better to regard recollection as some-thing capable of being more pervasive, more continual? Perhaps at least at the beginning of one's endeavor to practice recollection it would be well to change the sense in which the word recollection is commonly used, that is, calling up a spiritual thought of some kind. Would it not get us closer to what we want if we would have it mean the gathering of our powers on what the will of God puts before us.?. My imagifiation, my mind, my will often tend away from what for me is expressly God's will. Holding them to what is God's will for me from the right motive--it is God's will and I wish to fulfill it--would seem to be a fine form of recollection. If I am supposed to pray, I call together my powers and bend them this way; if I am supposed to study, I marshal them on my books; if I am supposed to recreate, I turn them to this end--the motive always being to do God's will, to find God in all things. It is plain how this.again would make for integration. As one grow.s in the power of recollection, one would approach more and more the prac-tice of the presence of God as indicated above. Then God would come to be all in all. It would seem that the form of recollection proposed is espe- ¯ cially import~lnt for and adapted to active religious. If their activity is divorced from their spiritual life, sad, indeed, is their-lot. The harder they work, the farther they withdraw from spiritual progress. But they ought to sanctify themselves by their apostolate. This quires real effort, a real desire for spiritual progress. An integrated life will bring power and peace and spiritual ad-vancement. It is an ideal all religious should work for. It will. not come without effort and the grace of God. Life seems almost too short to mak~ a whole out of the many parts. But here, as in all things, there is a shortcut--the love of God.- 286 Communi .y orkshop ot: t:he .Dulu :h enedict:ines Sister M. Joselyn, O.S.B. i N the fall of 1954, Mother Martina Hqghes, Prioress of the Bene-dictine Sisters of Villa Sancta S~holastic~, Duluth, Minnesota, first projected .the plan ofa workshop for the sisters in which any problem of the community would receive a frank, orderly, and serious discussion under the leadership of an experienced priest. All the sisters were urged to give thought to matters they would like to consider or have ~onsidered. at the workshop; aJad ar.rangemenrs wi~re made to bring a large group--as it happened, about half the community, which numbers more thah four hundred members--to the mother house for a two-d~y institute during the Christmas holi-days. In due time, Father Louis Putz, C.S.C., of the Department of Religion of Notre Dame University, .was engaged as the workshop moderator; and a committee of eight sisters representing different age and occupation groups in the community was appointed to plan the sessions with Father Putz. From a considerable correspondence between Father Putz, Mother Martina, and the committee members prior to the arrival of Father Putz at the mother house, and from a half-day planning session of the committee and the leader after his arrival, evolved the subject matter of the discussions: "the spiritual and temporal good of the commu.nity, with emphasis on the relations between superibr and subjects." It was believed that the over-all subject for discussion should be definite but not too narrowly restricted, should represent some hierarchy of values, yet not be a mere string of non-debatable principles. All the workshop members attended the first general session, which was held in the auditorium. At this time, the ~hairman of the workshop committee sketched the procedure for the remainder of the day's sessions, and Father Putz presented his view of the value and method of.such a workshop, adapting in fact both the technique and the major emphasis of the Catholic Action cell movement :o this group. Father Putz stressed the necessity of rethinking certain practices of religious life in the light of prese.nt day temper but with relation to traditional and tried principles. He also urged that the observe-d.iscuss-act method of the cell movement be applied by the 287 SISTER M. JOSELYN Review ~or Religious sisters in a manner calculated to deepen and intensify the loving union of the community members functioning as a family or ecclesiola within the Mystical Body of Christ. At this time, the committee distributed to all members of the workshop an outline to guide the day's discusssion. The outline (which is appended) was to be regarded as a set of signposts, rather than as "material to be covered." The group was then divided into fourteen small sections by an" ingenious use of colored slips which had been handed out at the door. (Thus the divisions were abso-lutely random.) A meeting room was designated for each small group, most of which numbered about ten to fifteen. Within the groups, a leader and a recorder were informally appointed. The first discussion lasted about forty-five minutes, tending to begin rather timidly but to gain momentum through full participation as time went on. Throughout the session, Father Putz acted as "floating delegate," stopping in at various subgroup meetings. At the end of the morning session, each recorder presented to the entire group the findings of the subgroup to which she belonged. In this manner, conclusions or resolutions or questions were pooled; and it was possible to determine which problems were common to all subgroups as well as to ascertain the different views of a large num-ber of sisters on one general subject. At the conclusion of the first half-day session, certain questions arising from the morning's meet-ings were directed to Father Putz and to Mother Martina, both of whom aimed to focus attention on the general principle (rather than the specific practice) involved. The procedure for the afternoon session of the first day was the same as that for the morning session. At the end. of the first d~iy's discussions, Father Putz and the planning committee worked for several hours preparing permanent recommendations from the recorders' reports, evaluating the pro-cedures, and outlining the second day's program. It was decided that the large outline of the subject for the second day, "the temporal good of the community," instead of being given as a whole to each subgroup, would be divided into fourteen sections, each group re~ ceiving one segment of the topic, as designated on each sister's copy of the outline. (This outline is also appended.) On the second day, sisters engaged in hospital work held (at their own request) special sessions within the larger group, still following, however, the outline given to all. In every other respect, the second day's sessions were conducted" like the first day's. Since tb.e outlines of content are included in this article, it will Nooember, 1955 COMMUNITY WORKSHOP. not be necessary to describe iff detail the development of these topics in the small groups. Mother Martina did state at the closing session that "the discussion has pqinted up four areas which I have under consideration at present: delegation of authority, care of the aged, training of the young, and local and major superior relations." Effort was made by the~ planning committee to obtain an over-all picture of the participants' reaction to this first community work-shop; to this end the committee prepared and distributed at the last session a short questionnaire (appended) to be answered anony-mously by all who wished to do so and left in a designated place. The fact that many sisters had only a-few moments between the close of the workshop and their departure from the mother house may have a relation to the number of questionnaires turned in. Ac-cording to the committee's digest of the returned sheets, the seventy-nine respondents stated unanimously that they liked the workshop. Seventy said they would like another workshop (nine others did not answer- the question). More than thirty sisters suggested that they liked the workshop because it was an opportunity for each " sister to present her opinions and to hear the thinking of others on common problems, resulting in an intensified community spirit and a unity of effort for the common good. Others thought that "the earnest and high ideals so generally manifested among all the sisters gave a boost to one's courage and spiritual striving." Thus, the workshop "gave a real stimulus to live the ideal life of a religious, and it served as a fine personal examination. It stressed the idea that each individual sister, as a member of the Mystical Body, must help to make our Benedictine family a happy, ideal one." Others answer-ing the questionnaire noted that they liked the facts that "topics and discussion were handled objectively" and that "respect for the personality of each individual sister was stressed." Thirty-four sisters thought the qualifications of a superior had been adequately dis-cussed; forty-four= thought the relations between superior and sub-jects had been adequately discussed. In the appropriate sect!0n of .the questionnaire, many valuable, constructive suggesti~ons for improving future workshops were in-dicated by the participants. Adverse criticism~ of the workshop gen-d~ ally i~ciffd~d t~orelated t~oint.si in'light 6f th.e tjm'.e, available, too many topics were listed for. d!~.c~ssion,: .a.n.~do,. c.onsequently, some of the discussions were {6b general. A "desire whs manifested to con-tinue discussion of these subjects at a future date.~ It was also.sug-gested :.that,, the,, recommendations.,-of., the. ,-w. orksl-;£i~,] b~ ". ~:.m~riz4d 289 SISTER M. JOSELYN Reuiew for Religious and distributed to each sister and that'in the.coming year each mem-ber of the community take.note of "topics for future workshop dis, cussions. Among suggestions for future workshop subjects, the majority of sisters included the discussion of "the greater spiritual growth of our community through an interpretation of the Holy Rule and how to apply it to our daily life in modern times," "how we can better fulfill our end in religious life," and "how to balance the active and contemplative aspects of .our life." THE SPIRITUAL COMMON GOOD HOW TO PUT THE SPIRIT OF CHARITY INTO OUR RELIGIOUS FORMATION A, Prayer in general I, How to make the necessary ada.ptations to our community exercises a) Normal times b) Vacation time c) In sickness 2. .How to teach goqd prayer and help 'others to pray well. a) Piling up non-essential devotions which interfere with the true spirit of prayer 3. Penitential obligations at times of ember days and fast days a) How to keep in the spirit of the Church b) Charity iri fulfilling our obligation c) Humility to ask for dispensation0if we n~ed it 4. Obligation of silence and recollection in view of charity a) Maintaining silence outside of recreation time b) Charity toward those who must talk during silence time to relieve tension B. Spiritual formation in terms of.spiritual reading 1. H6w to translate the Gospels into life and action 2. How to make our life liturgical 3. \Vhat kind of spiritual reading makes the'liturgy richer and unifies our life as a community and as an, individual II. SACRAMENTS ¯ A. Eucharist 1. How do we prepare as a community to celebrate thoughtfully the Sacrifice? B. Penance 1. How to make an intelligent use of the sacrament of penance OUR RELA;FIONSHIP TO THE COMMUNITY A. How to promote in the community the unity of charity 1. Attitude toward one another 2. Toward superiors 3. Particularly to speak up where, it is necessary and calied for in Chapter and outside of Chapter TEMPORAL COMMON GOOD Groups 1, 2, 3, 4 I. THE SUPERIOR A. Do we look at the office of~superior as an honor and not a service? 29O November, 1955 COMMUNITY WORKSHOP Bo Is the superior submissive to her higher superior, or is she jealous of her own responsibility ? Is she choosey in observance o~ canon law? Distribution.of house duties, assignments, etc, 1. Prudence and fairness in distribution of house duties 2. Partiality or favoritism--allowing cliques to develop 3. Keeping peace by letting sisters do as they please 4. Playing up to flattery 5. Regarding sisters only as subjects who must obey 6. Suspicious of actions of sisters, judging interior sentiments 7. Overloading the willing Groups 5, 6, 7, 8 ' E. Does the "superior take the trouble to know all abou~ "each sister, her temperament, aptitudes, interests, in order to help her? 1. Does she try to develop the personalities of the sisters? 2. Does she have confidence in the sisters? 3. Does she lack discretion with the sisters? 4. Does she have objective rather than subjective attitude? F. Does the superior make herself inaccessible to the sisters? G. Is the superior w!lling to rethink the'function of the community? H. Are'subjects prepared technically and spiritually for their responsibilities? 1. Do you think obedience will cover inc'ompetence? 2. Do you act as though the office of superior gave universal competence? 3. Are young religious allowed to come to responsibilities for which they may be capable? 1. Spending" money for luxuries or extras and not buying the essentials for school or mission !. Confusing the spirit of economy with spirit o~f poverty 2. Being overconcerned about food, clothing, rooms Groups 9, 10, 11 II. CHOICE OF SUBJECTS A. ~ccepting postulants without sufficient health, intelligence, or social ap-titudes B. Accepting religious into profession who are not fitted for community life C. Minimizing obligations of religious life for sake of attracting vocations 1. Spirit of sacrifice, motive for entering 2. Appeal to generosity 3. Indiscretion in fostering vocations. Groups 12, 13, 14 III. IV. RELATIONSHIP WITH THE CLERGY A. B. C. Do Relationship between principal and pastor Relationship between subjects and priests ¯ Willingness to advise clergy of indiscreet giving of gifts as tokens of ap-preciation Pastors and subjects channel activities through superior or principal Money collecting in Catholic schools 1. Red Cross, Red Feather, Sales, contributions, etc., etc., etc. 2. Sisters going into business for themselves RELATIONS WITH EXTERNS A. Civil law 1. Expecting privileges because we are religious 291 SISTER M. ,JOSELYN 2. Untruthfulness---cheating in filling out blanks, etc. 3. Apathy toward voting or in political affairs Parishioners 1. Making our friends on basis of prestige and money 2. Asking them for favors--rides, etc. 3. Hanging on to them after you are removed from the mission a) Writing to them b) Visiting them, etc. Are you a Superior__ or Subject~ EVALUATION FORM 1. Did you like the workshop? Yes. No. Why? 2. Do you think the qualities of a superior were adequately discussed? List qualities unmentioned. 3. Was relationship between superior and subject adequately discussed? 4. Give suggestions how you think ideas gained from the workshop can be put into practice in the community. I. 2. 3. 5. List any topics on superior-subject relationship of interest to you which were not discussed at this workshop. 6. Would you like future workshops? If so, suggest topics. 7. How could future workshops be improved? 8. Would you be interested in starting a study group on your mission? SPECIAL ANNOUNCEMENTS t:ather Gerald Kelly, S.J., editor-in-ch~e~ of the REVIEW FOR RELIGIOUS suf-fered a severe heart attack on October 4. He is slowly recovering from it in St. Joseph's Hospital, Kansas City, Mo. Prayers for his successful recovery will be welcomed. In September, 1931~ a hurricane and the subsequent tidal wave destroyed St. John's College, Belize, British Honduras, and took the lives of eleven Jesuits and twenty-two.of the students. Considerable other damage was done in this mission of Missouri Province Jesuits. In October, 1955, the hurricane Janet brought fur-ther disaster to the mission. Kindly remember the Belize mission in your prayers. The Dominican Rural Missionaries, whose work in Louisiana was described in our July, 1954~, number, page 217, were victims of another kind of tragedy. On January 16, 1955, the entire' community of their convent at Grosse Tete, Louisiana (three sisters and an aspirant), were killed when their statio._n wag'on was struck by a freight train. The three sisters were killed instantly; the aspirant sur-vived one day. This congregation is interested not only in prayers a'nd in more vocations to their own institute but also in finding young women who would be inte'rested in" helping t~em as ~ay al~ostles. " If ~U hav~ "pertinent information' for them or wish further information ~igm th~'m~" ~vrite tS: Si~'ter Marie Elisabeth, O.P., Our L~dy of Father Titus Cranny S.A has prepar~ed a small volume entitled Father Paul, Apostle o~ !.Tn~t~l. Th,s paper-bound volume" would make good background read-ing for the Chair of Unity Octave, 2anuary 18-25. Graymooe Pre~, Peekskill, Renoval:ion and dapt:at:ion Joseph F. Gallen, S.J. THoEf imtphoer traenlicgeio oufs tlhifee mmoevr~eimtse anntd o rfe rqeuniroevsa rteiopnea atendd pardeasepntatatitoionn. The purpose of the present article is to give a synthesis.of the movement, to clarify its concepts, and to emphasize its principles, spirit, and more practical headings. The originality of the article, if any exists, will thus be in its arrangement, not in content. The article is directed more particularly, but not exclusively, to lay in-stitutes of brothers, sisters, and nuns. I. RENOVATION The concepts of renovation and adaptation, as usually expressed by authors, partially coincide. If we separate them, renovation is to be conceived as the intensification of the entire ~eligious life of every individual religious and of every institute. This implies a greater personal conviction, esteem, and practice of the life of re-ligious sanctity, a more universally active zeal, a deeper sense of re-sponsibility, and a greater consciousness of the necessity of progress in the works.of the institute. In a word, renovation is a universal renewal of fervor; the movement under this aspect is primarily inspirational to a more perfect realization of the ideals of the re-ligious life. Renovation is more important than adaptation. It is idle to expect that a mere change of laws and observances will make an institute holier or more effective in its apostolate. Renovation is a prerequisite to adaptation. It has been well said that only the fervent can adapt. Proper adaptation demands clear spiritual visiqn and the humility to admit that something may be better than what we have been doing in the past. A conspicuously universal renova-tion is also difficult of attainment. An anonymous Camaldulese monk may be guilty of the exaggeration of pessimism, but he is not completely lacking in realism when he writes: "From experience we know that the exhortations of superiors, circular letters, conferences, constant vigilance, rewards, and corrections are very infrequently effective. Older religious have habits that are too deeply rooted; with difficulty they return to the path of full observance, even when convinced of their mistakes. The young more readily follow the 293 JOSEPH F. GALLEN Review for Religious careless, the mediocre, who ordinarily are in t~e majority, while the fervent are everywhere pretty much a small minority.''1 II. ADAPTATION Adaptation is change. A law, regulation, custom, practice, ob-servance, or manner of thinking and acting should be changed when it has become harmful or useless for the end for which it was in-tended, when a certainly better means can now be found for~that end, or when another means is demanded by the sound progress, necessities, or problems of our age. The/fundamental necessity for adaptation is that the world in which we live and for which we work has changed greatly in practically every aspect. Hospitals of today are vastly diffe~erit from those of a hundred years ago. We have adapted in the care of the sick and in many other things; the goal now is to extend the principle of intelligent and prudent adap-tation to every aspect of the religious life. Adaptation is not reform, mitigation, or relakation. What it excludes is the principle of un-swerving material conformity to everything done in the past. It presumes that the old is good but does not refuse to abandon the old for something certainly better; it does not identify the modern with the good nor does it hold that the modern or new is necessarily evil it believes and emphasizes that there are immutables in religion but also that not all thing~ are immutable. Adaptation is life and recognizes that the la'w of life is gradual change and a mixture of the old and the new. The two evident errors in this matter have been expressed bY Plus XII as the childish and immoderate hankering after novelty and the solidifying of the Church in ~a sterile immutability.2 The errors are thus excessive conservatism and the desire of change for itself, a blind attachment to tradition and the scorn of tradition, no ~hange whatever and intemperate and imprudent .change. Authors describe the former as a scelerosis, a lack of life, incipient death, the latter as worldliness and naturalism. Adaptation is thee responsibility primarily of higher superiors. It should be accomplished according to the general norms g, iven by the Holy See, but it is not to be ex-pected that the Holy See will take upon itself and impose the hdapr tations necessary in each institute. Adaptation should be carried out prudently and in a spirit of calmness, peace, and unity. How- 1. Acta et Documenta Congressus Generalis de Statibus Perfectionis (Editiones. Paulinae), III, 603. 2. Ibid., I, 33. 294 Nooember, 1955 RENOVATION AND ADAPTATION ever, the good of the institute is to be the supreme norm of action; and it is a fact of experience ,that some religious will oppose the most evidently necessary changes. III. WHAT CANNOT BE CHANGED The following are of their very nature excluded from adap-tation : 292 1. 2. 3. 4. 5. 6. The general purpose of the religious life of complete evan-gelical perfection. The three religious vows and their essential objects, purpose, and spirit. The mortification and prayer necessary for the attainment of the purpose of the religious life. Anything commanded or forbidden by the law of the Church. The distinctive and solid spirit of the particular institute. Anything certainly essential or fundamental in, the pa.rticular institute. IV. MATTERS TO BE EXAMINED FOR POSSIBLE ADAPTATION It would be an evident exaggeration to say that eve.rything listed below should be matter for change in every instifute, All the mat-ters listed have been mentioned and more frequently emphasized in the discussions on adaptation. The list is a~range~ in the order of the concrete importance of the topics in the judgment of the writer. 1. Greater care in the admission of candidates arid more de-cisiveness in the early elimination of the unsuitable before perpetual profession. 2. The establishment ofa juniorate for sisters immediately after the noviceship, in which the young professed will com-plete their undergraduate education or training and continue their spiritual formation. 3. A sounder doctrinal formation in the postulancy, novice-ship, and juniorate. 4. The elimination of the prominent externalism and for-malism. 5. Proper concept of the founder or foundress. 6. Greater attention to the purpose and spirit of the vows rather than to their mere obligation. 7. A schedule of prayer that gives proper~ emphasis to mental 29,5 JOSEPH 1=. GALLON Reoieto for Religious prayer, is sufficiently liturgical, and not excessive in the quantity or in the importance placed on vocal pra~yer. 8. The direction of the works of the institute to the n~eds of our time, which in most institutes will consist of an emphasis on the works for the poor and the working class. 9. A horarium that is less contributory to tension and pro-vision for proper daily, weekly, and annual rest. 10. Greater care in the selection of and a previous training, if possible, of local superiors and novice masters and mistresses. 11. A government that is more spiritual, individual, paternal or maternal, and not lacking in the necessary firmness. 12. Establishment of a tertianship and, perhaps, 'of a period of recollection before perpetual profession. 13. Greater emphasis on maturity, a sense of responsibility, dependability, efficiency, and proper initiative in the train-ing of religious. 14. Simplification of the religious habit. 15. Higher intellectual standards in continued study and prepar-ation for classes. 16. Elimination of the continuous rotation of the same superiors. 17. Greater mutual knowledge, cooperation, and attention to the interests of other religious institutes. 18. Possible extension of the period of temporary vows to five years. 19. Pertinent canonical matters.' V. EXPLANATION OF MATTERS OF ADAPTATION 1. Greater care in admission. The principle of St. Plus X that there is no greater cause of the weakening of religious discipline than the careless admission of candidates ~s of universal validity.3 The fundamental defect here is the failure to grasp and act on the evident principle that anyone lacking the suitability for the life and works of the institute does not possess a vocation for that institute. The grace of the omniscient God is not moving anyone to a state of life for .which he is not fitted. Therefore, the need for religious is never a justification for the admission or retention in the pro-bationary states of those who do not possess the capabilities for the particular institute. The modern innovation proposed under this heading is that 3. Epistle, Inter Plura, May 31, 1905, to the.Abbot General of the Order of Re-formed Cistercians, Ench&idion de Statibus Perfectionis, n. 248. ~ 296 November, 1955 RENOVATION AND ADAPTATION of psychological testing. A principle of adaptation is that we should be wil.ling to accept all that is, good in modern progress. Such test-ing, when practicable, can be an aid; but it will never exclude the necessity of the considered and experien,,~ed judgment and proper ¯ firmness of a competent higher superior. To me it is also a certain fact of experience that the great majorityI at least of the outstand-ingly difficult cases were sufficiently evident to such a judgment either before admission or at the latest during the probationary states of the religious life. 2, 18. Establishment ot: a juniorate for sisters and extension ot: temporarg profession. The completion of the undergraduate studies of sisters immediately after the noviceship is necessary for their own spiritual, intellectual, psychological, and physical well-being, and for the maintaining and elevating of the standards of Catholic edu-. cation. Plus XII manifested to superiors his keen desire that the schools taught by sisters be the very best and also stated that the training of all sisters should put them on an equal footing with their secular colleagues: The Sacred Congregation of Religious af-firmed that it is rash to expect a subject immediately after the almost exclusively religious formation of the postulancy and noviceship to be a teacher and much less a serious educator, even for very young children. This demands suitable preparation, and the S. Congre-gation insisted that such training was to be given despite the im-mediate need for teachers. It is evident that the assignment of postu-lants and second-year novices as regular teachers is an even greater abuse. ~ This heading reveals another distinctive principle of the move-ment of adaptation, which is that of the elevation of the spiritual, intellectual, cultural, and professional equipment of religious. It is also a very apt illustration of an even more fundamental norm of the movement--we cannot reasonably continue to do everything in a particular way just because it was done that way in the past. Educational and professional demands are much greater today; they must be met with much better preparation. The entire matter of the juniorate in this country is 'being ad-mirably promoted by the Slster-Formatlon Conferences of the Na-tional Catholic Educational A~sociation. This also exemplifies a principle of the movement. Adaptation is vital action; it is life, action, and progress from within. The attention given to the intellectual and professional train-ing should n'ot obscure the even greater necessity of continued spit- 297 JOSEPH F. GALLEN Review ~or Religious itual formation in the juniorate. An equally urgent need of young professed is that of-competent and prudent guidance in the difficult adjustment of the first'years in" the acti~ce life. This will demand the continuation of the office of a mistress of junior professed for at least two years after the juniorate. The juniorate will consume all or most of the u~ual three-year period of temporary vows, and thus the question :can arise whether this period gives sufficient testing in the active life before perpetual profession. The ready solution is an extension of temporary pro-fession to five years. In such a system the Code of Canon Law per-mits a prolongation of only one year. This is a change in the con-stitutions and should be decided upon only after serious reflection. It demands the approval of'the Holy See in~ pontifical institutes and that of all ,the ordinaries in whose dioceses the congregation has houses in the case of diocesan.institutes; 3. Sounder doctrinal spiritual formation. Sufficiently common defects .in American novitiates are the application of' the postulants and second-year novices to the external works of the institute, the excessive employment of both classes in domestic duties, the small amount of instruction given in the religious life, an overemphasis of secular studies; and the prominent tendency to confine the religious life to mere externals and to external regularity and conformity. The modern generation is decidedly factual and can readily fall into disillusionment and even cynicism from such a postulancy or novice-ship. The master or mistress of novices should give an instruction of at least forty-five minutes on all days except holidays. These in-structions are not to be confined to the vows but should cover the entire field of ascetical theology during the postulancy and novice-ship. The concepts and principles are to be presented solidly, not sentimentally nor with, mere devotionalism, and not in mere prac-tical illustrations that are not reduced to principles. Solid presen-tation demands that the theological foundation of principles be given. The movement of renovation and adaptation contributes several valuable principles in this field. The first is that no spirituality is lasting unless based on personal conviction. The second is that we can no longer be content with a mere collective presentation; the emphasis must be on individual guidance. The third is that there must be an active participation by the postulants and novices in this work of their own instruction. They should be permitted freely to ask questions and to propose difficulties; they should be. aptly November,, 1955 RENOVATION AND ADAPTATION questioned on their grasp of spiritual principles; there should be discussions, brief papers on :some spiritual topic, on the ideas ac-quired from the reading of a spiritual book, or on some spiritual prob-lems or difficulties. Other techniques and methods will be found by a real teacher. The purpose, however, must always be to lead the will to action, notthe mere acquisition of knowledge.;~and there must never be any doubt that the master or mistress is in charge. We must abandon the unsound pedagogy that an idea once presented to a group is understood by all. This is true of no teaching and much less of spiritual teaching. ~Fhere must be an adequate spiritual li-brary, sufficient time °for spiritual reading, and proper guidance in this reading. One author l~as aptly expressed a .very practical truth by stating that the poverty of a spiritual life is very frequently the poverty of proper and constant spiritual reading. Proper instruction, individual and competent guidance, and patience will usually succeed in directing the tendencies and defects of the modern generation into good qualities. For example, their independence of judgmen.t and ac.tion, .demand for reasonableness and sincerity, and 'desire for personal initiative can be developed into a profound and lasting.conviction of spiritual values. Their realism, sincerity, and generosity will be ultimately docile to a spiritual for-mation that is interior, solid, individual, that makes legitimate al-lowance for different personalities, is not bent on crushing them, and is not dominated by a multitude of petty details.and formalities. 4. Externalism and [ormalism. This is the most.frequ~,ent topic in the discussions on adaptation. The problem is found principally in the ,customs, observances, and practices, written and unwritten, of 'religious institutes. A certain amount of ,regulation is obviously necessary for order and efficiency. Apart from this, external ob-servances have no place in the religious life merely for themselves; their purpose must be the cultivation of the interior virtues of the ~eligious life, for example, love of God, humility, chastity, mortifi-cation, obedience, prayer. Consequently they must be of such a. nature as to constitute apt means for the fostering of such virtues. The first principle of adaptation here is that the purpose 6f observances ,is not being realized. This defect is very universal, especially, but not solely, in institutes of women. Religious forma-tion has been too narrowly confined to externals, external disci-pline, external regularity and conformity; there has been too little; training in the interior life and interior ~'irtue. The moral value of an external act consists in the fact that it proceeds from an interior 299 JOSEPH F. GALLEN Review for Reliqiotts act of virtue of the will or that it leads to or intensifies such an act. Sincere interior virtue will produce the proper external act; the religious who is sincerely poor in heart will be poor in act. It is very possible to de-emphasize and even to ignore in fact this pur-pose both in formation and in our own personal lives. Instead of saintly religious, we may be tending to train spiritual robots. Modesty of the eyes is not a virtue because I never see the leaves of the trees unfold in spring or do not know the color of the ceiling; it is a virtue only if it proceeds from the consecration of my heart to God, protects that consecration, and lead~ me ultimately to greater love of God. The profit of silence is not precisely in the low score of the examen book but in the increase of my spirit of prayer. A similar defective tendency is the attitude towards "our h01y rule." The rule is really not holy in itself; its holiness is verified only insofar as, it contains and leads to a love of and assimilation to Jesus Christ. It is basically misguided formation to propose the rule independently of this assimilation and especially to extol it above such assimilation or the laws of God. The overemphasis on externals has led to their excessive multi-plication. They extend to all and to the.smallest details of life. We .may be wearing a tight harness of sanctity that will not allow us to move or to breathe; we are praising the observant religious and have forgotten the saintly religious. Excessive observances are a dry diet of spiritual shredded wheat. The soul lacks a richness of spirituality, is superficial, and dulled to the great truths and person of Jesus Christ. It is not a satisfying diet, and usually a few years suffice for the loss of spiritual appetite and the symptoms of a lowered and even critical spiritual vigor and tone. Another defect of very many observances is that they either were never apt or have lost their aptness for their purpose. Why should sisters be forbidden to eat in a dining car but be allowed to request a waiter to set up a table in another railroad car that will make them even "more conspicuous? I think it is reasonable to avoid the expensive dining car whenever possible, but I can see no reason for a prohibition of eating there when~ necessary. Why should sisters be forbidden to eat even with sisters of other communities? Why is it a violation of cioister to enter the home of your family but meritorious to sit in a car outside their home. and talk to them? Are such artificialities in keeping with the saneness of sanctity, with the majesty of the doctrines and person of Jesus Christ? Reverefice and politeness are to be fostered; but are all the profound bows of 300 November, 1955 RENOVATION AND ADAPTATION the head and Of the body, all the kissing of hands, and all the kneel-ing to superiors apt means today of expressing this reverence and politeness? Why in a life whose spirit is that of humility and of a family must there be precedence in the refectory and community room? These are only a very few examples of a very Widespread defect. Observances should be the external expression of the spirit of the institute and of the founder. In the thought of one author they should possess the perpetuity~ of real life transmitted from gen-eration to generation but not the perpetuity of fossilization. Obedience and submission are evidently due to prescribed ob-servances, but superiors should examine whether their number is excessive and their nature now apt for their purpose. There is also too much legalism, the material satisfaction of the mere wording of the law, in institutes of both men and women; and too little at-tention to the purpose of the law, its more perfect fulfillment, and to motivation. Legalism is clearly destructive of an interior life. Religious discipline is also frequently enforced with an unreasonable rigidity. Religious know that it is possible to be excused or dis-pensed from the laws of the Church, for example, from Sunday Mass or from fasting; but observances are often proposed as if they never admitted an excuse or dispensation. I am not encouraging laxity but discouraging rigorism; there must be a proportionate reason for an excuse or dispensation. Observances are the field of conduct that demands the most searching examination by superiors. It is the field of which Pius XII said: "In this crisis of vocations make sure that nothing in your customs, your manner of life, or the ascetical practices of your religious families is an obstacle or a cause of loss of vocations. We mean certain usages which, if ever suited to another cultural context, are out of place today, so that even a really good and courageous girl would find them only an obstacle to her voca-tion." 4 5. Concept of a founder. The concept of a founder or foundress has been too narrowly that of a lawgiver and ofimmutable laws. The Pope has stated .that founders frequently .conceived their in-stitutes to meet the needs of their own age and thus erected their institutes on the principle of adaptation. He concludes from this that lo.yalty to the founder requires constant observance of the prin- 'ciple of adaptation and the acceptance of all that is good in the be-liefs, convictions, and conduct of our contemporaries. This dem~inds 4. Acta Apostolicae Sedis~ XXXXIV ('1952), 825. ¯ '30.1 JOSEPH, F. GALLEN 'Reoiew for Religious that we distinguish the essential and immutable from the'_accidental and changeable in the words and works of the founder and that we do not follow as a rigid norm what the founder, did but rather the pliable norm of what he would do in any aspect of life if he were faced by our own age. Furthermore, the founder is not a mere giver of 'laws but also and primarily ~a giver of life to his "institute. ~ That life is his distinctive spirit, which consists in his approach to the spiritual life, his characteristic virtues, the principles he emphasized, his manner of approaching life and its problems, and the general types of works of zeal that he favored. Our fidelity to our founder is to be yerified in the repr, oduction of his life and spirit, not in the mere unwillingness to change even the slightest detail of his least law. 6, 13. The uows and training in maturity. The movement of renovation and adaptation finds in the vows one of the conspicuous fields of juridicism, that is, the overemphasis on laws to the detri-ment of the theological elements of the purposfi and spirit of the vows and their efficacy for the acquiring of many interior virtues. To secure permission is important; but it is more important to ad-vance by poverty in the love of God, to be detached from the love of material things for themselyes, to make progress in trust in divine providence, patiegce, meekness, humility, and the spirit, of mortifi-cation. The vow of chastity has not attained its purpose,unless it is increasing the .love of God, 'love of other human beings in and for God, devotion to prayer and the interior life with God, affection and intimacy with God in prayer, and .making life less materialistic. Obedience is a sterile vow unless it is intensifying especially love of God, faith, and humility,, and also docility to grace,~zeal, the spir~'t of self-denial, and generosity. In a word, obedience is effective to the degree that a theocentric has'supplanted an egoistic life. The obligation of the vow and of the laws of the Church on poverty is confined to external actions. It is, however, a "field of conduct that demands the constant vigilance of superiors. The coun-sels of Plus XII in this matter are that the life of religious ~hould b~ truly simple a~id poor, their houses should be simple, and their actions in poverty should not contradict nor ddstroy their profession of it in word. The buildings of religious, even those used for ex-ternal works, should be efficient, sanitary, not unattractive, but simple, and devoid of even the appeararice of luxury, "indulgence, extravagance, or needless expense. It is surprising holy. often this point has been emphasized by authors on adaptation. One of them has called the propensity~ to expensive buildings and .renovations ~302 Nooember, 1955. RENOVATION AND ADKPTATION "stone disease"; it could also be termed "Gothic poverty." Such bhild=. ings create the impression of hav!ng been erected to" attract the rith. and thus tend to the tragic tonsequence of alienating the pobr:~ Authors follow the Pope in' stressing the need of a truly simple and poor life in everything--buildings, lodging, furniture, fbod,' medical care, all personal accessories, amusements, vacations, journeys, and means of travel. Modern material developments are to be used insofar as they increase efficiency, preserve or promote health; bu( they are to be rejected" when their purpose is on.ly comfort, indul-gence, luxury. / Pius XII has reaffirmed the validity and supreme value of the traditional concept of the vow of obedience. He has also implied or stated that the modern apostolate requires one. who can face boldly the gigantic tasks of our age, one able to meet its d~ngers, overcome its spiritual destitution, competent to .think for himself, and formed to maturity of judgment. These are not the tasks nor th~ endow-" ments of a child. The modern evils of communism, atheism, and secularism are not trembling at the child_ishness of their foes. The purpose of obedience is to develop the good in man, to eliminate the" evil. The ability to think for oneself, to get a new idea at least oc.casionally, maturity of judgment and action, the power of de-cision, legitimate self-initiative, efficiency, dependability, and a sense of responsibility are not evils and are necessary for success in any state of life. Obedience should not be presented nor authority exer, cised in a way that destroys or fails to develop these necessary capa-bilities. Obedience is too often presented as the mere order of a superior and the submission of a subject. Ancient comparisons that illustrate the perfection of external obedience unfortunately have the defect of connoting a passive reaction on the part of the subject. Obedience is p.rimarily an instrument of personal sanctification, and no one except the infant is sanctified in passivity. Insistence on the purpose and spirit of the vow will bring out that this vow demands a truly tremendous vital reaction of love of God, faith, and humility. The subject gains the merit of the vow by having it as his motive, and such a motive is to be presumed in the actions of a religious. The superior should govern sufficiently but not excessively; a~ad it is certainly not necessary, profitable, prudent, or formative for him to step into or order every detail of an action or work. If you want the child to walk, you have to allow him to fall a few times. This mellow proverb is true in work, study, and also in the spiritual .life. The religious life is not a democracy; religious are subjects, n6t 303 JOSEPH F. GALLEN Review [or Religious associates, of the superio~ They are also human beings. They should be allowed and encouraged to get new ideas. The superior is the competent authority to accept or reject and also to,encourage such ideas; but he should not confine all ideas in the house, province, or institute to his own. A religious or novice may find a better way of doing an-assigned duty or work, or he may do it in his own in-dividual way.' In most cases this can be permitted. Everything does not have to be done always in the same way. The counsels of per-fection are not the freezing point of human endeavor and ingenuity. A religious or novice should be given the necessary instructions for an assigned duty or work; if he does it childishly, inefficiently, care-lessly, he should be firmly checked. The religious life must not be the cradle of ineptitude. The qualities described above should be formed continuously in all aspects of the religious life, spiritual, in-tellectual, and the life of work. The childishness of many religious is an actual problem and one that cannot be ignored. The Pope has praised the great things that obedience accomplishes by uniting the forces of the members of the institute. The efficacy of this union is in fact greatly diminished by the childishness that makes a member unable to handle his assignment or his proportionate amount of the effort. Instead of united effort, the union of. obedience is too often that of the few carrying the many. 7. Pra~ter. In a previous article in the REVIEW FOR RELIGIOUS, I tried to explain the principles of adaptation with regard to prayer~ A few added comments will s~uffice here. The spirit of prayer and habitual self-denial will always be the distinguishing marks of the sincere religious. Both have been emphasized by Plus XII. He has insisted on the necessity of an interior life, that it should main-tain a constant balance with external activity, and has reprobated as the heresy of activity the intense apostolate that is not constantly nourished by the use of the ordinary means of personal sanctification. These emphatic words of His Holiness evidently imply an equally emphatic obligation of superiors to insist on the use of these means by their subjects. The errors of men and women in this matter are not the same. The woman tends to the misdirected prayer of de-votionalism rather than to the prayer of sanctity; the danger of man is of infidelity to his religious exercises. The latter is certainly fre-quently caused by valuing work over prayer and even more fre-quently by the simple omission and neglect of prayer. Excessive activity is not the only cause of a feeble interior life. It must be 5. REVIEW FOR RELIGIOUS, XIII (1954), 125-37. 304 November, 1955 RENOVATION AND ADAPTATION remembered that the idle apostle is rarely the mystic of the monas-tery. The diagnosis of external idleness is most infrequently that of a local infection. It is an anemia of the person that extends to all activity. W'hy are so. many. superiors disturbed at violations of religious discipline and yet completely unconscious of so basic an evil as idleness? A fundamental principle of adaptation is the hier-archy of values. ~rriters on adaptation are quite insistent on the value of litur-gical prayer. There should be sufficient liturgical prayer, but the, choral recitation of the Office should not be urged to a degree or quantity thfit is !mpracticable in so many congregations of lay re-ligious. I also cannot see the all-sufficiency of the Office, for example, that it can supply for regular mental prayer in a life dedicated to sanctity. One or two authors bemoan the ignorance of Latin in lay religious, who thus do not understand so much of their prayer. The remedy suggested is a sufficient study of Latin. Is there any real hope that this remedy will be generally effective? It is not contrary to th~ present spirit of the Church to be more attentive to the use of the vernacular as the language of prayer. In some institutes the prayers are in a foreign language, usually that of the country of origin of the institute. When this is no longer a spoken language of the majority of those entering the part of the institute in question, isn't it time at least to begin to think of changing the language to that of the country? Plus XII stated that the missionary possesses no office of transplanting a specifically European culture to mission lands.6 Religious institutes likewise should not impose the nation-ality of the country of their origin on members of other nations. 8. Works of the institute. A study of the documents of Piu~ XII leads to the opinion that his basic motive in promoting the movement of renovation and adaptation is the apostolate. An under-lying thought can be sensed in his words that communism, atheism, secularism, paganism, and materialism would not be strong and belligerent today if religious had measured up to their exalted voca-tion in both prayer and an enlightened and laborious zeal. He urges a laborious zeal, since he has not only reprobated the heresy of ac-tivity but has also warned of the dangers of an idle and indolent life. He has emphasized the necessity of an enlightened zeal. This de-mands the i~se of all appropriate new forms and methods of the apostolate and of all modern developments for the spread of the 6.Acta Apostolicae 8edis, XXXVI (1944), .21'0, . 305 JOSEPH F. GALLEN Re~,iew "f~o~ Religiods Kingdom 6f Jesus¯ Christ. An enlightened zeal also directs its ef-forts primarily t6' combat' the great evils of the age and to prevent their'diffusion. Various documefits of Pius XII lead to the belief that he considers the dechristiafiization of the poor and the working class as the great danger of our age. Other classes' are not to be ignored, but the distinctive impression of the apostolate of r~lig_ious institutes in general should be that it is directed to the poor and the working class. This is also the spirit of the life and teaching of Jesus Christ. Most religious institutes were born of a love of the poor and unfortunate. The preservation Of such a solid spirit is one of the immutables of the religious life. A work such as the parish school is not only a glorious and niost necessary apostolate but also a pr6: tection of this spirit. Several authors have commented on the ten-dency'of some institutes founded for thd poor gradually to orientate themselves towards the higher classes and the rich. They draw-away from the poor, and the poor draw away from them. In speaking of the apostolate for the poor and the working class, the present Pope has instructed priests to become brothers to brothers and to mix their apostolic Sweat with that of the.working men.7 Religious also must exercise this apostolate in a spirit of understanding, com-panionship, closeness to the poor and their problems, and not in that of a generous and kind but aloof and superior caste of society. Religious poverty has the apostolic purpose "of enlightening and impelling mankind to.the proper evaluation and use of material things. We have to live, but this purpose demands that we exclude com-mercialism and the motive of gain from our apostolate. It is cer, tainly not against poverty to keep accurate accounts, but the spirit of 'poverty and its apostolic purpose require also that we examine ourselves frequently as individuals .on how much we are doing for nothing and as institutes on how much we are giving away. All institutes, especially of sisters, should refuse new works when their overworked members can scarcely carry out their present en-gagements. In taking new works, congregations of sisters should be more attentive to the missions. Pius XII stated: "The apostolate of the Church today is scarcely conceivable without the cooperation of religious women in works of c.harity, in the school, in assistance to the pries.tly ministry, in the missions,s " 9. Horariurn. The horarium should be in conformity .with the customs and de,m.ands of the age, the place, and the work. The 7. Ibid., XXXXI (1949), 65. ~8. Ibid., XXXXI (1949), 41). November, 1955 RENOVATION AND-ADAPTATION horarium is frequently a most evident proof of the excessive and tenacious attachment to tradition. It is not reasonable to insist that the meals be at the same hours as during the life of a founder who died several centuries ago or.to leave the horarium unchanged for more than a centu~ry. A religious house is not a fortified island of anachronism in a changing world. The test of a horarium is not its antiquity but its ~uitability and efficiency. Admittedly the life of religious should be one of laborious zeal, but the work can be excessive and can hinder or even exclude ade-quate prayer. One author has pointed out that the amount of work of some religious clearly excludes the nature of the mixed ,life, the proportionate union of the contemplative with the active life. S~- periors are to do everything possible to make a life of. praye~ ade-tqhuea toenllyy poobssstiabcllee ftoor parlal ytehre:i rit s iusb ajuegctms.e Tntheed tbeyn stihoen. toefn wsioonrk o ifs t h.neot horarium. There is a minimum of calm, quiet, and peace necessary for a prayerful life. The habitually excited religious cannot be a .prayerful religious. The daily life of too many lay religious is a scurrying, headlong, excited, and feverish rush from duty to duty. There are difficulties in adjusting, the horarium, but some adjust-ment is possible. It must be less minute, 'less oppressive, less insistent on e.verytbing in common; there must be more breaks, more free time, more attention to rest, and more easing of the tension. Re; ligious should be give.n adequate time for their meals, and 'the time immediately before and after meals should not be one of' compressed activity. The religious life is not a tight winding of the human mechanism. The prolonged day of many lay religious demands a physical strength and emotional stability that may be desirable but are rarely attainable. That "a sister nurse should not be given a weekly holiday is one of the inexplicable facts of the religious life, especially when we reflect that her immediate superior has a knowledge of medicine and may. even be meritoriously dabbling in psychoso-matic medicine. The same is true of sisters in institutional work. The week end should not be considered the natural depository for all 'spiritual and qther duties that cannot be squeezed into the week. Other contributing factors to the constant nervous strain are an exaggerated notion Of common life and an excessive, number' of permissions. Common life does not forbid private rooms nor that religious study in their roc~ms. It does not demand tl~at everythifig be done together nor that religious be always together. Life becomes too tense when religious may never go to their rooms, without: the- 307 JOSEPH F. GALLEN / Reoieto for Religio-s permission of the superior, except for the night's sleep. Express per-mission should be necessary for relatively important matters and to the degree that is necessary to .keep obedience reasonably active, but express and particular permission should not be required for the most ordinary and usual actions of everyday life. The number of permissions necessary in many institutes is unreasonable. Local superiors of houses that are not extraordinarily large have admi~tted that practically their whole day consists in sitting in their office and handing out permissions. Such a life is,not only tense; it is imma-ture and an immature exercise of authority. The overworked lives of lay religious demand a proportionate annual vacation. Each in-stitute should strive to have an appropriate vacation place for its members. This will also eliminate the individual vacations that are not conducive to the religious spirit and much less to religious poverty. 10. Selection of local superiors. In my opinion, nothing is more valuable and necessary to religious institute's than outstandingly capable higher superiors, general and provincial. However, the ef-forts of the most talented higher superiors can be frustrated by inept local superiors; and there are few higher superiors who do not re-alize the shortage of capable local superiors. I think we should ad-mit the actual scarcity of the talents required for this position. The sincere admission of this fact has led several authors to suggest a school or previous training for local superiors. I do not see the practicability of the suggestion of a school. It is not impractical to emphasize that one of the most important duties of a higher superior and his or her council is to make a thorough investigation and to give most careful and prolonged thought to the appointment of local superiors. Some previous instruction is possible, especially when all the local superiors in any one year go into office on the same day. They can be brought to the mother house a few weeks before they are to take office, can study the constitutions, and other laws of the institute, be given conferences on government and its problems by the higher superior, on points of the constitutions by the master or mistress of novices, on financial and material matters by the general or provincial treas.ure.r, and on the works of the institute by the various supervisors of these works. One of the real obstacle~ to proper local government is that the local superior is overworked. In some institutes all local government and administration is personally discharged hy the local superior. All government," discipline, "permisSions, finances, m~iterial n(cessiti~s, and" direction of ~he work of th~ h6us~'~re~un'der'him' alone. The 308 November, 1955 RENOVATION AND ADAPTATION superior would be relieved of overwork, the government could be more spiritual and efficient, and greater opportunity for training others in the exercise of authority would be realized by giving the local superior some help, for example, by having the local assistant take care of ordinary matters of discipline, ordinary permissions, and the material nee~ls of the house and its members. The same question of preparation arises with regard to masters and mistresses of novices. The suggestion of a school is not so im-practicable here, but the general necessity of a prolonged and con-tinuous course of preparation can also be exaggerated. The religious chosen for this position should be of solid spirituality, prudence, mature judgment, and of more than average intelligence and learn-ing. If the institute is clerical, I do not see why such personal qual-ities and his background of dogmatic and moral theology would not enable a priest to master and to present properly the principles of the spiritual life from his own private study. Brothers and sisters also are now more frequently being given theological train-ing. Such training is to be taken into account in making this appoint-ment. It is evident also that theological knowledge alone is not sufficient for the appointment. Brothers and sisters could also at-tend summer courses in ascetical theology or the various institutes on the religious life now being held during the summer. 11. Government. There are few sincere religious who do not sympathize with superiors in their difficult and burdensome duties. Everything in the religious life depends in some way on superiors, and thus the movement of renovation and adaptation will be in-efficacious without their comprehension, cooperation,, and personal participation. The aspect of renovation demands that the govern-ment of superiors be more universally spiritual. Their first duty is to direct their subjects to the essential and universal purpose of the religious state, sanctity of life. It is a certain fact of experience that they will fail in this duty if they themselves are mediocre, indiffer-ent~ or not striving at all for sanctity of life. Superiors who are mere executives, financiers, expert in public relations, good managers, skilled directprs of external works, and those who have lost famili-arity with spiritual principles or are spiritually illiterate have al-ready failed in their first essential duty. Their talents can be em-ployed in other posts; they should not be superiors of religious com-munities. The movement of adaptation strives to intensify, not to lower, the primacy of the essential purpose of the religious life. A not infrequent complaint of subjects is. that their superiors are in- JOSEPH, F. GALLEN ~: Review for? Religious competent or simply not interested in spiritual problems and ques~ tions. The field of religious government and that of conscience hav, e already been explained in the REVIEW FOR RELIGIOUS.9 In talking to subjects on matters within the field of go(~ernment, ,superiors are certain.ly not forbidden to speak of such things as the necessity and importance of the irlterior life or to suggest supernatural motives or practices. They may also speak freely on general spiritual~matters, for example, the necessity, value, methods, and difficulties of prayer. Canon law forbids that a manifestation of conscience be commanded .or induced; it does not forbid any religious superior, including those of lay institutes, to receive a voluntary manifestation of conscience. This law of the Church has been misunderstood. The superior is not to intrude himself into the field of conscience but he is not for-bidden to listen to and to. give advice 'on any such matter that is freely and spontaneously proposed to him. Such manifestations will not be realized unless the superior is sufficienly spiritual himself, spiritually competent with regard to others, and able to inspire their confidence. It is to be equally emphasized that subjects are always free in this matter. Superiors have two practical advantages in spir-itual directiofl that are of no small value in many cases, external knowledge and observation of the subject and the authority to take effective action to aid the subject. ~ Spiritual direction in general is a sufficiently frequent topic in the discussions on adaptation. It 'seems evident enough that habitual spiritual direction is necessary for young religious in the states of formation, adjustment to the active life, and that of the tertianship or period of renovation of spirit. There can be differences of opinion in this sufficiently delicate matter. My own opinion is that any spiritual formation should strive to produce within a reasonable period a formed religious. I conceive a formed religious as one who habitually, with the grace of God, can direct himself or herself. The necessity of spiritual direction for such a religious should be occa-sional, for ~xample, two to four times a year, not habitual., Such a necessity is often satisfied at the retreats or in some cases by the religious superior. Habitual direction is necessary for those who have peculiar problems, and here also the prudent director strives as soon as possible at least to diminish the problem. To me it is by -no means evident that greater sanctity of life necessarily, demands 9. REVIEW FOR RELIGIOUS, XII (1953), 30-31. ¯ '3~10 November, 1955 RENOVATION'AND ADAPTA~IION habitual special direction. M~ ~xperience of such religious is that they-have common sense and are merely doing the ordinary things in a more perfect and constant' manner. I am aware of the religious proverb that it is dangerous to,run along .witho'ut the advice of the elders. Most proverbs are only partial truths. Excessive dependence on others is also an evil. Religious are adults; they should live an adult life. No one can live another's life or shoulder another's re-sponsibility before God. Spiritual formation should prepare for life, and the irrefutable fact of the life of the soul is that it must be lived for the most part alone.Relatively very few decisions of the life of the soul can await consultation with a director. There should also be hope of reasonable and proportionate profit in spiritual di-rection. Does experience show any such profit from the habitual direction of chronic mediocre and indifferent religious? Isn't too much direction being "expended in their behalf? No one denies that there should be as much liberty of confession as is possible. This wisdom is evident in the laws and spirit of the Church, but spiritual direction and confession are not identical. The Pope has manifested the necessity of maternal government in instit~tes of women. The same thing has been emphasized by authors as also the need and value of paternal government in insti-tutes of men. This demands no small capabilities in the superior. He must put aside personal and natural indifferences, attractions, and repugnances, and have a supernatural love and interest in all his sub-jects. He has to put off th~ smallness of a vision confined to little things and of a mere prefect of religio~s discipline. He must possess the humility to realize that the office is not for himself; he is not to impose his will but to find the will of God 'for his subjects. Paternal government is a giving, not a receiving; it is selflessness, not self-interest or self-indulgence. The office of superior cannot be one of personal aggrandizement; the superior has no right to material concessions and indulgences or to freedom from religious discipline al~ove his subjects. The superior cannot be cold, harsh, or unfeeling; he must be outstanding in divine charity, mercy, gentle-ness, humility, calmness, politeness, and the capability of guiding a community not so much by ~the tables~of the law as by creating the spirit of a family, of confidence, and cooperation. Paternal gov-ernment is individual. The subject is not a numbered soldier; a community is not a¯mere total of subjects. The religious is to be treated as a son or daughter~. The superior, should know the sub-ject'} individual deficiencies and~ make appropriat& .allowance 311 JOSEPH F. GALLEN them. He~ should also know his individual abilities and strive to assign him to the work for which he is suited. There must be de-tachment in the religious life, but it is not sane government to con-ceive detachment as the nullification of all natural and acquired abilities. Pater~aal government can also be misunderstood by both su-perior and subject. It is certainly to be lavished especially on the aged and really sick. It is also to be extended to the odd, the trouble-some; the mediocre, the indifferent, the weak, the insincere, the lazy, and the childish, but it is not to be confined to them. I wish to break my frail lance in favor of the hard-working, the fervent, the normal. I suspect that many religious cannot meditate on the prodi-gal son without crushing a great sympathy for the elder son. These religious also are to be treated as sons and daughters of the house-hold, not as cousins twice removed from their weaker and childish brethren. Paternal government is not sentimentality, softness; nor is it weakness. It is not to be understood in the sense that the superior always yields to the will of the subject. It is not an exaggeration to sa.y that quite a few communities are ruled by the subjects, and in such circumstances it is not the exemplary subjects who grasp the dragging reins or ease them from the nerveless fingers of the superior. It will not be without profit or interest to study the pertinent com-ments of some eminent and experienced authorities. Father Alberione, superior general of the Society of St. Paul, writes: "In institutes of men superiors sense the need of more means for securing obedience and of a wider path of dismissal. In too many institutes there are religious, especially priests, who do their own will and secure their own indulgence in almost everything; they spend the entire day in idleness and indolence or devote their time to criticism . Greater means would be necessary for the effective attainment of observance and religious activity.''1° Father Suarez, the late master general of the Dominicans, stated: "There should be greater facility in dis-missing religious as on their part the freedom of leaving. The rest, freed of the bad example and of seriously disobedient religious, could devote themselves more peacefully to the religious life.''11 Father Janssens, father general of the Society of Jesus, makes his own the words of an octogenarian of forty years of laudable experience as a superior: "They [superiors] do not nowadays dare to give an 10. Acta et Documenta Congressus Generalis de Statibus Perfections, I, 267-68. .11. Ibid., I, 257. 312 November, 1955 RENOVATION AND ADAPTATION order; if they should, they do not dare to demand an account of its execution; if they do demand an account, they do not dare to sanc-tion negligence with. penances.''12 Finally, Father Creusen, S.J.: "In superiors of men it is not unusual to observe the lack of authority and government; in superiors of women, the contrary. The former~ should be impressed with the necessity of demanding observance of the rule, of fostering the virtues that correspond to the'vows, of not granting excessive liberty to subjects, "and so forth; to superiors of women one should rather emphasize the need of maternal govern-ment, of appealing to supernatural motives, not to their personal authority, and so forth.''13 A similar topic is that there should be more, though not ex-cessive, government by higher superiors. Too frequently these ap-pear to be insulated in their offices except for the annual appoint-ments and the canonical visitation. The latter can also readily de-generate into little more than a formality. One somewhat modern-means of accomplishing this necessary contact and government is by meetings, for example, with the superiors and appropriate offi-cials of the houses of formation, with all the local superiors or those ,of a particular territory, with those in charge of the external works in local houses, with the general or provincial supervisors of these works. Such meetings will further religious discipline, proper uni-formity, general progress, and help to prevent the perpetuating of the same problems. 12. Tertiansl~ip. In this matter clarity and distinction of con-cepts are desirable. Spiritual formation is begun in the postulancy and noviceship: it is continued in the juniorate. There should also be special guidance during the period of adjustment to the active life. When a juniorate is in existence, there seems to be little need of a prolonged period of spiritual formation before perpetual pro-fession. Most institutes have only three years of temporary vows, ¯ and thus perpetual professton will follow .shortly after the comple-tion of the juniorate. I can see the reasonableness of prescribing a relatively brief period of greater recollection before perpetual pro-fession. The tertianship is rather a period of renovation of spirit, the re-enkindling of the religious spirit and fervor that may hay( grown cold in the active lifeof the institute, a more profound ac-quisition of the genuine spirit of the institute, and a more mature and deeper spiritual formation. I personally think that the appro- 12. Ibid., I, 258. 13. Ibid., I, 254. 313 JO;EPH F. GALLEN Revieu) [or.'R6ligious priate time for the tertianship in lay .institutes is about ten years after the first profession, when the religious is about thirty to thirty-five years of age. Sufficient time has then been spent in the active life, and the age level does not preclude the required docility. Several congregations of sisters in the United States have al-ready instituted a tertianship, dr renovation, as they are more apt to call it, for about six weeks during the summer. This should be the minimum time. My own opinion is that it should not continue longer than six months in lay institutes. The tertianship has been highly praised by Pius XII, warmly recommended by several authors, and is favored but not imposed by the S. C~ngregation of Religious. This whole matter was previously explained in the REVIEW FOR RELIGIOUS.14 "14. Simplification of the religious habit. Plus XII recommended this simplification to religious women and praised institutes that had taken such action. He nowhere affirmed the fairiy common mis-apprehension that this was the only thing to be adapted, that it was the most important or urgent matter of adaptation, or that the 'l~abit should be fundamentally and completely changed. He stated ~bat the habit should express the consecration to Christ and should be appropriate, hygienic, not affected, simple, and religiously modest. Roman C9ngregations had previously manifested that the habit of religious women should be dignified, grave, in keeping with poverty, riot. likely to arouse adverse comment or ridicule, suited to the cli-. mate, and efficient. The question of the habit aptly illustrates one of the great ob-stacles to all adaptation, the excessive attachment to externals. The purpose of the religious habit is that it should be a symbol of, and should express the separation from, th~ world and the consecration to Christ and not that it should do this in any excessively individual or peculiar manner. Attachment 'to the symbol is more tenacious than to its purpose. It appears to be unfortunately true that ex-cesslve attachment to the present habit increases in direct proportion to its evident need of change. On the other hand, this change should be made slowly, prudently; t-be proposed habit should be worn in all the houses by a few religious for a sufficient time of trial; and there should be freedom of suggestion. The change should beoto something better and satisfactory¯ I have seen changes that were 'not improvements. It seems to me also that congregations with 14. REVIEW FOR RELIGIOUS, XII (1953), 267. 31~4 Nouember, 1955 RENOVATION AND ADAPTATION a common founder should strive, if at all possible, to retain their identity or at least similarity of habit. It is strange that women should not know how to dress" and their men should have to instruct them. The Pope has done it, the Roman Congregations, authors, and I now attempt it again.15 Ap-parently the only hope of success is to be very direct and explicit. The habit should be examined on the following points: peculiarities, imprisonment of the face, starch/ ruffles, pleats, quantity of-cloth, number of articles of clothi.n~, capability for the necessary change of clothing, time in laundering,i efficiency, and the existence of summer and winter. As is evident f.rom some simple habits, it .is possible toeliminate all the starch and the imprisonment of the face and ,still have a religious' habit, i The starch, ruffles, and pleats are not simple, unnecessary, and crehte a truly awesome laundry problem. Countlessnovices are being .grounded in spirituality in a 1.aundry. ¯ It must take hours merely tb iron some habits.The poor do not buy such articles of clothing.i Modesty must be preserved but it does not demand the number of a~rtlcles or the quantity of clgthing now worn by most religious women. To take the mildest of examples. If the ordinary sleeves reach [~ the hand, why does modesty demand the ever present wide outer tsleeves?. The Pope said that the habit ~hould be hygienic. This o~viously requires, and it is but one ex-ample, that the waist and sleeves' should be detachable, readlly~ " .change-able, readily laundered. Toiignore this is to prescind from elemen-tary hygiene. Anything that even appears to be odd or peculiar should be ruthlessly eliminated. Jesus Christ was not peculiar in His earthly life, and peculiarity is not an apt symbol of con~ecra-' tion to Him. The modesty iof the habit does not require that it be a mere blessed sack. If all the headings given above are properl~r considered, the resulting habit will be suitable for work and effi-cient. We must remember, ,finally, tl~at no religious institute is or Can be exempt from the cold of winter and the heat of summer. Secular men and women stil! bow to this fact of nature at least by wearing an overcoat during~the winter and, outside of a very few highly nervous lndlwduals, ,thFy do not wear the same coat duriilg the summer, 15. Higher intellectual standards". This topic has also been explained completely in the REVIEW FOR RELIGIOUS.15 All religious 15. Ibid., XII (1953), 256-57. i6. ~bid., X~I (1953), 268-69. ./ JOSEPH F. GALLEN Reuieto /:or Religious and particularly those engaged in teaching should beintellectual and cultured men and women. ~This certainly implies that they have in-tellectual tastes and are constantly reading and studying. Such ~ habit is to be inculcated and emphasized~ from the beginning. It is surprising how often a supposed education, also Catholic, fails to produce a habit of reading. There must also be something to read, and we can finish this topic by emphasizing again the .need of ade-quate libraries in all religious houses. Higher superiors should in-sist that a sufficient outlay for books be part of the annual budget of all houses and they should also 'inspect the libraries during their canonical visitation. 16. Rotation of the same superiors. This matter is both im-portant and practical, but it has been completely explained in the REVIEW FOR RELIGIOUS.17 17~ Mutual knowledge and cooperation with other institutes. All religious should have a sincere and deep reverence, love, and loyalty for their own institute. All are to be real sons and daughters of their institute. ~'They expect paternal government; they should give filial deportment. Modern generations can be justly accused of a greater deficiency in these precious qualities than the generations of the past. In casting off romanticism for realism they may also be putting off love and devotion for cynicism. It is more erroneous to act as if all that is good, holy, and zealous were confined to our own institute. This induces a very repulsive caste pride and is also an evident obstacle to renovation and adapta-tion. We cannot reasonably maintain that all human progress ceased at the death of our founder. The Italians have a good name for par-ticularism; they call it "'iI campanitismo.'" We may freely translate this as a vision narrowed to the village steeple and a life confined to its shadow. Narrowness is a discordant quality in a life supposedly dominated by the limitless truth and good that is God. Religious cannot be lacking in love and reverence for the Church, of which their institute is only a very small and very subordinate part, nor for the diocese, the parish, and other institutes. They should bare a sincere conviction of the good, the greatness, and the accomplishments of other institutes. This demands primarily that they do not harm other institutes, for example, by inaugurating works that are not'necessary in a locality and that can onl~ harm the established works of other institutes. The movement of ad.~ilSta- 17. Ibid., X (1951), 193-200. November, 1955 RENO~CATION AND ADAPTATION tion goes further than the mere avoidance of injury; it emphasizes and promotes cboperation. This has been a primary motive for the various congresses of religious, the permanent commission of mothers general established in Rome, the associations instituted in France and Italy for sisters engaged in the same activities, the con-federations or permanent conferences of higher superiors in France, Portugal, Spain, Brazil, and Canada. The Sacred Congregation of Religious has inspired, fostered, and approved sucl~ associations. It may be maintained that this purpose, is fulfilled in the United States by the National Catholic Educational Association and the Catholic Hospital Association. The Sister-F0rmation Conferences and the meetings of superiors and officials promoted by the Catholic Hospital Association are apt means of accomplishing renovation and adaptation. Seriou~ consideration at least should be given to the formation of a permanent association of higher superiors of religious women in the United States. Common discussion and effort would be very helpful to their common purpose, difficulties, and problems. The formation of all such associations should be a vital movement from within; and the sisters themselves must give practically all the talks, lead, and carry on the discussions. They alone are fully ac-quainted with their life and problems; they can and should solve their own problems and supply their own initiative. Or,hers can at times help or contribute some ideas, but in all such associations and meetings the principal part should be left to the sisters themselves. Adapta-tion is life, not passivity or forced movement; and passive partici-pation is rarely satisfactory or permanent. 19. Pertinent canonical matters. It seems incredible that a re-ligious institute would not have conformed its constitutions to the Code of Canon Law, but it is still possible to encounter such a situ-ation in congregations of sisters. _Quite a few of these congregations retain what is called the direct vote, i. e., all the professed, at least of perpetual vows, vote directly in the general elections. This is contrary to the practice of the Holy See, which demands the system of delegates. Many diocesan congregations are unaware of the fact that their diocesan state, according to canon law and the practice of the Holy See, is only. temporary and probationary and that they should become pontifical. Canon law and the practice of the Holy See also favor the extension of diocesan congregations to many dio-ceses and are opposed to their confinement to the diocese of origin. Some congregations have a structure of government that is intended for a monastery of nuns, not for a congregation of sisters. Several ¯ 317 authOrs have" advised° small and struggling institutes, especially of women, to unite with larger and flourishing institutes and preferably with one of the same origin. This suggestion is practical for a few institutes in the United States. Orders of nuns that certainly cannot observe even minor papal cloister should become congregations. Papal cloister.cannot be ob-seryed~ by institutes that are almost wholly occupied in such works as parish schools. Some congregations of sisters have a strictdr cloister by the law of their constitutions. This cloister should not be ob-structive of the special purpose of the institute. Monasteries of nuns should present any real problems or diffi-culties on papal cloister to the Holy See. If engaged in education, they are to be attentive to the fact that this demands their own proper education. These same monasteries should realize that the Holy See has for a lbng time promoted federations of monasteries of men. The same principle is now merely being extended to monasteries of women. The advantages of federations were authoritatively listed in Sloonsa Christi. Nuns have been isolated from practically all in-novations in" the religious life, and this has riot always been to their advantage. They are also included in the present moxiement of renovation and adaptation and should study especially the advan-tage~ of federations. Those engaged in the mote scientific teaching of religion and who read ~panish will no doubt like to know that the Salesiafis in Argentina publish a monthly magazine entitled Didascalia, devoted to the teaching of' religion. Agents in the United States: Don Bosco College, Newton, New Jersey; in Canada: Salesian of St. John'Bosco, Jacquet River, New Brunswick. In our November, 1954, number, p, 289, we described Volume III of th~ Canon Law Digest, by T. Lincoln Bouscaren, S.J., and on p. '306 of the sam~ number we announced that annual loose-leaf supplements to the Digest would be published. The Supplement of 1953 appeared shortly afterwards; and very recen[- ly the Supplement through 1954 has been published. In the valuable work of pre-paring these annual supplements, Father Bouscaren ¯is being aided by Jame~ I. O'Connor, S.J., professor of canon law at West Baden College. Like the Digest itself, the annual supplements are published by The Bruce Publishing Company, Milwaukee 1, Wisconsin. An important letter of the Sacred Congregation of Seminaries and Universities on the Proper Training of Clerics to an Appreciation of the Divine Ot~ce (Feb. 2, 1945) has been translated into English by T. Lincoln Bouscargn, S.J., and is now published in convenient pamphlet form. The pamphlet includes an excellent bibli-ography by Owen M. Cloran,,S.J. Price, ten cents. Grail Publications, St. Mein-rad, Indiana. 318 ook eviews [All material for this department should be sent to: Book Review Editor, REVIEW FOR RELIGIOUS, West Baden College, West Baden Springs, Indiana.] SEEDS OF THE DESERT. The Legacy of Charles de Foucauld. By R. Voilluame. Translated and adapfed by Willard Hill. Preface by John LaFarge, S.J. Pp. 368. Fides Publishers Assbciafion, Chicago, IIIinois. 1955. $4.50. Any priest or religious will read this book with a sense of ex-hilaration. Its spirit is aggressive and optimistic and so inexplicable on natural grounds that one cannot help but think that it brings him into direct contact with the life-stream of the Church. The English title~ while'more poetic, is less revealing than the original: Au Coeur des Masses: La Vie Religieuse des Petits Fr~res du P~re de Foucauld: The Little Brothers of Jesus area Congrega-tion founded by Father Refi~ Voillaume according to a plan sketched at the turn of the century by Father Charles de Foucauld. The Con-grega~ ion.was approved by the Church in 1936. The letters of Father Voillaume to the Little BrotHers, which comprise the bulk of the present work, reveal that the purpose of the congregation has been boldly conceived and is being wisely executed. The brothers, some ordained, some lay, intend to bring Christ in His Church to the poor: to the workers of France, the Moslem Arabs of North Africa, . the colored of the Cameroons, the nomads of Transjordan, the under-proletariat of Chile. The plan is de-signedly lacking in methods of apostolic efficiency. It is decidely not of this world in its "foolish" simplicity. In fraternities of from three to five men, the Little Brothers live the life of the poor whose souls they seek; factory wbrkers, fishermen, shepherds. They do not preach; they do not found social organizations; they do not try to change the living conditions of their fellow-workers. This they leave to others. Their eye is on Jesus at Nazareth and their hope is to bring the modern poor to the fullness of Christian life. Their method is to be a leaven of example anal self-immolation among the masses. The difficulties and dangers facing such .an enterprise are ob-vious; and the author is at pains, in his letters to the br0ther~, to point them out and to chart a safe course. Again and again he tells them that in their circumstances mere formal observance~ are not BOOK REvIEws Review [or Religious enough to guarantee the life of perfection to which they have vowed themselves. Only contact with the vivifying person of Christ is powerful enough to weather the fatigue, the discouragement, and the temptations they will encounter. Though much of the guidance Father Voillaume offers the Little Brothers is necessarily of a particular nature, his letters will never-theless have a widespread appeal, especially among religious. The author's love for the poor, his desire to bring God to them, his con-fidence in the power of Christ, and above all his enthusiasm for the little way of the Gospel in a world which thinks big, are plain on every page. His spirit is infectious and will be caught with profit by those whom it touches. The letters on the vows are par-ticularly good. Written on a familiar subject they have a freshness which reflects the vigor of the author's mind. They stress the psy-chological and po.sitive aspects of" the vows and are noticeably de-void of platitudes. Time alone can adequately test the courageous experiment of the Little Brothers of .Jesus. ]3ut if Father Voillaume can plant deeply in his followers the spirit he has left in his book, success seems assured.-~PAUL F. CONEN, S.d. THE EUCHARIST-SACRIFICE. By Reverend Francis J. Wengier. Pp. 286. The Bruce Publishing Co., Milwaukee I, Wisconsin. 1955. $5.00. Father Wengier has given us in this book a notable addition to the growing number of titles of theology in English. The Eucharist- Sacritice is a defense of the opinion of the Reverend M. de la Taille, S.3., on the essence of sacrifice in the Mass as found in the justly famous volume Mysterium Fidei. It also contains chapters dealing with other controversial aspects of eucharistic doctrine,, such as transubstantiation, the actual offerer of the Mass, the quantity of Mass fruits. The last chapter is devoted to a consideration of the Encyclical Letter of Pope Plus XII, Mediator Dei, and an epilogue is added on "The Blessed Virgin and the Mass." Father Wengier defines the Mass as "A true and proper though unbloody Sacrifice of the New Law, instituted by Christ when He said: 'Do this in commemoration of me,' in virtue of which com-mand the beloved Bride of Christ, the Church, doing through her ordained minister what Christ ~Himself did in the Cenacle, renews Christ's sublime Sacrifice by offering to the heavenly Father the very same formal Supper-Golgotha Victim while picturing the Lord's passion in the consecration of the separated :elements of bread and 320 Nouember, 1955 BOOK REVIEWS wine" (p. 102). This definition, which fairly represents the. opin-ion of De lh Taille, is defended particularly against the opinions, of Abbot Vonier (The Keg to the Doctrine of the ~.ucbarist) and Reverend M. D. Forrest (,The Clean Oblation), though others are not neglected. The book is somewhat marred by the undue acerbity with which the author treats the opinions of adversaries. This particular con-troversy, for some reason, always generates a great deal of heat'. Undoubtedly a partial reason at least is the fact that all sides of the controversy appeal to the very same texts of the fathers and the councils, each interpreting them in support of a particular opinion. The chapter which the author heads: "Various Ways to Swerve from the Genuine Idea of the Sacrifice of the Mass" is not calcu-lated to win friends or conciliate opinion. The opinion that a symbolical immolation cannot at the same time be a real immolation will be favored by few theologians. To assure us that there is a symbolical immolation in the Mass and ~hen say that it is not an immolation but an oblation' is liable to be slightly confusing. If immolation is a constituent element of sac-rifice, then it must be present in the sacrifice of the Mass or else that sacrifice is not true and proper as described and defined by the Coun-cil of Trent. The presence of the immolated victim may be a sign that a sacrifice has been completed in the past, but only immolation can be constituent of sacrifice in the present. Again, the adjectives "bloody" and "unbloody" in the Council of Trent can refer only to the immolation since the oblation, taken in the sense of one of the constituent parts of sacrifice, is always unbloody even in a bloody sacrifice. Consequently only a theory which places an unbloody immolation in the Mass together with the oblation would seem to be consonant with the doctrine of Trent. However opinions differ, this book is sure to find an honored place on the bookshelves of theological libraries. It deserves careful reading to appreciate its many fine qualities.--CARL FIRSTOS, S.J. GOD'S HERALDS, A GUIDE TO THE PROPHETS OF ISRAEL. By d. Chalne. Transla÷ed by Brendan McGra÷h, O.S.B. Pp. 236. Joseph Wagner, Inc., New York. 1954. $3.95. To one seriously, interested in reading in English a concise, or-thodox introduction to the canonical Hebrew prophets, God's Her-alds will be most welcome. Father McGrath's translation of the late J. Chaine's Introduction a Ia Lecture des Prophetes meets a real 321 BOOK REVIEWS Review for Religious need for seminarians, religious, and laymen who are interested in th~ prophets whether from an historical, do, ctrinal, or s,ociological v~iewpoint. After a short chaptbr on prophetism and the social milieu, the author considers pairs or groups of the prophets in a reasonably, accurate chronological order. This treatment is calculated to bring out the climax of divine revelation and the historical drama of God's relations with Israel. If the message of Isaias and deremias is diffi-cult to follow, the reason is to be found in the unavoidable "enfilad-ing that results from this chronological approach. '- The style of the book is quite direct; the content, informative and condensed. Passages are paraphrased rather than quoted. In spite of all this, the salient features of many of the prophets, espe-cially of Jeremias and Ezechiel, stand out cl'early in but a few pages. Although God's Heralds is intended to be a non-technical study, it i's, nevertheless, primarily intended as an introduction or pre-lection to private reading or study of the prophets. One feels that this purpose could be better implemented by the addition of a table or chart indicating the chronological order in which the different prophets and their various oracles should be read. Admittedly, this order is frequently problematic. The whole book, however, supposes a rather definite chronological arrangement; and so a tab-ulated abridgment of the prophets treated w6uld ,be of considerable help to private reading. Nevertheless, the index of texts, plus fre-quent cross-references, enables the student to refer back for the his-torical setting as outlined~in this work. As the translator notes in his preface: "The world of the pro-phets is a complicated one, and it takes serious study to become really familiar with it." Monsieur J. Chaine's small volume is not "affective reading." But sound, even if "non-technical" study of the prophets is required if their message is to ring clear. Father McGrath is to be commended for translatin~ a book on the prophets so apropds of the current needs of clerics and laymen alike in these days when we begin to realize that God will judge the nations. --CHARLES H. GIBLIN, S.,J. (:;)UAESTIONES CANONICAE DE JURE RELIGIOSORUM. By Servo ~,oyeneche, C.M.F. Volume I, pp. 536; Volume II, pp. 496. Insfifufum Jurldlcum Clarefianum, Yla Giulla, 131, Rome, Ifaly. 1954; For more than thirty years Claretian Father Servo Goyeneche has been solving canonical problems concerning religious proposed 322 November, '1955 BOOK ANNOUNCEMENTS under the heading of Consultationes in the Claretian review entitled Cpmmentarium pro Religi~sis. Now this renowned canonist and professor at the Pontifical Institute Utriusque duris in Rome has arranged all these answers in the order of the canons of the Code of Canon Law and has published them in two volumes under the title of Quaestiones Canonicae. The term religious is used in a wide sense; and, besides the canons contained in the second book of the code under the formal title De Religiosis; it includes most of the other° canons of the code touching religious at least indirectly. Hence the valuable:canon index to be found at the enff df Volume II runs from canon 4 to 2408. , Usually the text given is that which appeared originally in Com-mentarium pro Religiosis. However, the author has noted any change of opinion on the part of a writer quoted and. has included, the answers and interpretations given during the past thirty years both by the Commission for the Interpretation of the Code and those of the various Roman Congregations. This valuable compendium of practical questions and answers regarding religious should find a place in all the clerical communities of religious orders, congregations, and societies. Lay religious (broth-ers and sisters) will hardly find the volumes helpful because they are written in Latin.--ADAM C.' ELLIS, N.J. BOOK ANNOUNCEMENTS ACADEMY LIBRARY (3UILD, Fresno, California. One Hundred Years an Orphan. By John T. Dwyer. The book tells the story of Saint Vincent's, San Francisco's Home for Boys, at San Rafael, which completed the first century of its existence in 1955. It is a well-written book and profusely illustrated with many excellent photographs. Pp. 159. $3.00. THE BRUCE PUBLISHING COMPANY, Milwaukee 1, Wisconsin. The Glor~t of Christ. A Pageant of Two Hundred Missionar~j Lives from Apostolic Times to the Present. Age. By Mark L. Kent, LM.M., and Sister Mary Just of Maryknoll. An arresting, dramatic incident introduces each missionary. An appropriate reflection closes the account of his life. Not all the missionaries chosen for the book are canonized saints, though they would be if the Church would still recognize cahonization by popular acclaim as she once did. An inspiring bbok. If they could do so much for Christ, why can't I? Pp. 282. $3.75. 323 BOOK ANNOUNCEMENTS Retffeto.~ for Religious How to Meditate. By Reverend A. Desbuquoit, B~lrnabite. Translated and arranged by Reverend G. Protopap,as, O.M.I. Not only beginners in mental prayer but also those who have practiced it for many years will find the author's analysis of mental prayer enlightening. I/is chapter on "Tasks of Mental Prayer" is particu-larly ~uggestive and should prove very helpful. Pp. 75. Paper $1.00. Spurs to Meditation. By Reverend Bartholomew g. O'Brien. Just how much of a problem formal meditation can .be for a priest, Father O'Brien knows from personal experience in a very large and busy parish where he served for ten years. Spurs to Meditation is written specifically for those priests and seniinarians who still find meditation a problem. The author hopes with good reason that his book will help to solve that problem for many of his readers. Pp. 116. Paper $1.25. ~ CATHOLIC LIFE PUBLICATIONS, Bruce Press, Milwaukee I, Wisc. The Pierced Heart. The Life of Mother Mary Angela Trusz-kowska, Foundress of the Congregation of the Sisters of Saint Felix (Felician Sisters). By Francis A. Cegielka, S.A.C., S.T.D. The Congregation of the Sisters of Saint Felix now comprises ten prov-inces. Three are in Poland, where the congregation was born, and the other seven are in the United States. There are 4,3-37 sisters in the congregation as of 1955. Of these 3,505 are in the United States. Because the sisters are so numerous here, they are known for the many works in which they are engaged, but little is known about them. This is the first biography in English of the remark-able woman who founded this flourishing congregation. It helps us to get to know the Felician Sisters. It is regrettable that the book is so brief, only 76 pages. May the day come soon when we shall have a fullrlength biography. $2.50. THE CATHOLIC UNIVERSITY OF AMERICA PRESS, 620 Michigan Ave., N.E., Washington 17, D.C. The Catholic Elementary School Program for Christian Family Living. Edited by Sister Mary Ramon Langdon, O.P., M.A. This book embodies the proceedings of the Workshop on the Catholic Elementary School Program for Christian Family Living conducted at the Catholic University Of America, June 11 to June 22, 1954. It is of interest to pastors and sociologists. Pp. 209. Paper $2.25. The Local Superior in Non-Exempt Clerical Congregations. A Historical Conspectus and a Commentary. By Robe,rt Eamon Mc- 324 BOOK ANNOUNCEMENTS Grath, O.M.I. The book is a thesis submitted to the Catholic Uni-versity of America in partial fulfillment of the requirements for the degree of Doctor of Canon Law. Pp. 127. Paper $2.00. CLONMORE AND REYNOLDS, LTD., 29 Kildare St.; Dublin. The Origin of Political Autborit~ . By Gabriel Bowe, O.P. Certainly a very timely book now that so many false theories on political authority are rife. It is based on a thesis which merit.ed for the author the degree of Lector in Sacred Theology at the Angelicum in Rome. Pp. 102. Cloth 12/6. COLLEGE MISERICORDIA, Dallas, Pennsylvania. Lh;fng the Little Office. By Sister Marianna Gildea, R.S.M. A very effective way to make the recitation of vocal prayers of rule easier, more consoling, and more profitable is to take them as the subject of meditation. Sister Marianna has done just that with the Little Office of the Blessed Virgin Mary, and in this volume she shares the fruit of her labors with the reader. Do you wish to improve the effectiveness of your recitation of the Little Office? If you do, this book will help you. Pp. 167. Paper $2.75. COMITE DES HOSPITAUX DU QUEBEC, 325 Chemin Sainte- Catherine, Montreal~ Morale et M~d;,cine. By 3ules Paquin, S.d. Doctors and nurses are constantly in need of guidance in handling moral problems aris-ing from the practice of their profession. This need is provided for in Catholic medical and nursing schools by courses in medical ethics. Morale et M~dfcfne is intended as a textbook for such a course, though it would also serve as a handy reference book for doctors and nurses in actual practice. Besides giving a clear exposition of the moral principles connected with the many important problems of modern medicine, the book also contains a section dealing with the moral problems of psychiatry. It will be of interest particularly to re-ligious connected with hospital work. Pp. 489.- . DAUGHTER~ OF SAINT PAPAL, Old Lake Shore Road, Derby, N. Y. Jesus" Alp~'al~t for. R'elfgi~Us. Cbmpiled by the Daughters' 6f SaintPahll There"is ~'cldapt~r fore'ach'l~tter of the alphhbe~i" The first l~.l[f.io;f' each "~b~e~; c'onsi~tsof brief cifiot~ioh~ froh~'H61y Scripture oi~ the virtue dealt" ~'i~h ih"that "~l~'~i3~er: ~Tl~e ~c~'fid"hhif comprises brief quotations.:fr0m the~.writings .of.,t.he ~fa.thers of the Cht@ch- a'nd ,the:~sairits on, ~he,' sam~, virtue;., It 'is not a~boolc;to be "read; but ,a.th'e'sautus-of suggestions.for~:meditatibn. :',Pp~. 'l.24,.-Paper 3-25 BOOK ANNOUNCEMENTS Revieta for. Religious $1.00. Cloth $2.00. The Hero of Molokai. Father Damien, Apostle of the L, epers. By Omer Englebert. Translated by Benjamin T. Crawford. Robert Louis Stevenson, who so eloquently defended Father Damien in his open letter to Doctor Hyde, predicted that the Church would raise Father Damien to the honor of the altars within a century after his death. That prediction is. now in process of verification. His cause has been introduced at Rome, and some significant progre.ss has been reported. The present biography of the hero of M61okai is in a popular vein and should hasten the day of his beatification. Pp. 364. Paper $1.50. Cloth $3.00. FIDES PUBLISHERS, 21 West Superior St., Chicago 10, Illinois. The Psalms. Fides Translation. Introduction and notes by Mary Perkins Ryan. This may be called the laymar~'s own edition of the psalms since the introduction and notes by a lay woman were written with him and his difficulties in mind. Pp. 306. $3.95. FOLIA, 55 Beechwood Avenue, New Rochelle, New York. The Augustinian Concept of Authority/. By H. Hohensee. This volume puts "at the disposition of theologians,' philosophers and classical scholars, teachers and students alike, an abundant source-ma~ erlal for the interpretation of Augustinian thought" on the sub-ject of authority. Pp. 77. Paper $2.00. FREDERICK PUSTET COMPANY, INC., 14 Barclay St., N. Y. 8. In the Light of Christ. Through Meditation to Contemplati'on. Pp. 340. $4.50. Hearts Shall be Enlightened. ReHections [or the Examination o[ Conscience. Pp. 179. $2.50. Both volumes are by Mother Mary Aloysi, S.N.D. Religious, particularly religious women, will be pleased with these two volumes, the latest books from the prolific pen of ~he gifted author. Both volumes are intended to make the meditation and the examination of conscience of the monthly day of rec611ection more fruitful. The first consists of forty inspiring meditations; the second, of.an equal number of reflections. There can be no doubt that a religious who makes her own ahd lives according to th~ teaching so eloqtiently pro-pounded in th~se volumes is very dear to the Heart of Christ. GRAIL PUBLIEATIONS, St. Meinrad, Indiana. Blueprint :/or Holiness. "The Christian Mentalit, g. ,By Denis Mooney, O.F.M.This little bookl~t contrasts~ the. Christian men-. 326 . .: .: . November, 1955 BOOK ANNOUNCEMENTS tality, the effective desire of always, pleasing Go.d, with the natural mentality, the desire of always pleasing self. All our faults and sins have their root in the latter; our virtues spring from the former. The Christian mentality must be expande,.d until it extinguishes the natural mentality. The book is very simply written and~ illustrated with diagrams--something most unusual in aspiritual bool~. Pp. 64. Paper $0.50. ~ The Education of the Religious and Modern Trends. By Rev-erend Manuel Milagro, C.M.F: The author writes specifically for those who are educators of religious destined to become priests. Among [he topics treated are the following: vocation and disci-pline, anticipatory ministerial drills, the educator, the confessor, the superior, the educational formula ora et labora, the ministerial for-mula ora laborando, mental hygiene, rectification of distorted fea-tures. Pp. 97. $0.75. Dedicated Life in the World. Secular Institutes. Edited by Jo-seph E. Haley, C.S.C. The answers to many questions that we are asked about secular institutes are found in this" booklet. We find there their historical background, their canonical status in the light of papal documents, their nature, and finally their present and future status in America. It concludes with a useful bibliography. Pp. 48. $0.25. The Crown of Twelve Stars. Meditations on the Queen of the Universe. By a Ca~rmelite Nun, the Apostolic Carmel, Mangalore, lndia. If you baye been looking for appropriate meditations for the first Saturday of each month, The Crown of Twelve Stars should terminate your search. You may even find that though each indi-vidual meditation is short, it affords enough material for mind and heart for more than one hour of prayer. Pp. 54. $0.35. P. J. KENEDY AND SONS, 12 Barchiy St., New York 8. What the Church Gives Us. By Monsignor James P. Kelly and Mary T. Ellis. Those who have to instruct conveits will welcome this new book on the fundan~entals of the Faith. Though e~senti-ally a catechism, it is not writtefi in question and answer form." Even Catholics could profit by a careful reading of this well-writ-ten book. It deserves a place on the shelf of every lay retreatant's library. Pp. 152. $2.50, ~ The Salt of the Earth. By,Andre Frossard. Translated by Mar-jorie Villiers. Andre Fross,a}d has written a very readable book about the religious life as exemplified in six religiouS.orders, Bene-; BOOK ANNOUNCEMENTS dictines, Carmelites, Carthusians, Cistercians, Dominicans, Jesuits, and Franciscans. It was written for people in the world who know little or nothing about religious. It is profusely illustrated with humorous woodcuts. The author is not always accurate about de-tails: The Jesuit General is not appointed by the pope; St. Bernard entered Citeaux with thirty not twenty-five companions; the influx of hermits into theoEgyptian desert began during and not after tbe persecutions. Pp. 160. $2.95. NATIONAL SHRINE OF SAINT ODILIA, Onamia, Minnesota. Odilia, Maid of the Cross. By Bernard C. Miscbke, O.S.C. Would you like to know what life was like in England in those far off days when it was still pagan? What is the historical founda-tion for the legend of St. Ursula and the eleven thousand virgins? Why is St. Odilia the special patron of the Crozier Fathers? You will find the answer to all these questions in Father Mischke's fic-tionalized biography of St. Odilia. Pp. 163. $2.00. SHEED AND WARD, 840 Broadway, New York 3. A Rocking-Horse Catholic is the last book that Caryll House-lander wrote before her death on October 12th, 1954. In it she tells the story of her youth. She was baptized a Catholic when she was six, and so characterizes herself not as a "cradle" but a "rocking-horse" Catholic. She lost the. faith in her teens but found her way back to the Church to become a militant Catholic and the author of six books on religious topics. When you begin to read this book, be sure that you have several hours at your disposal, for you will find it difficult to put it down before you have reached the end. Pp. 148. $2.50. Soeur Angele and the Embarrassed Ladies. By Henri Catalan. Something new in detective fiction: a Sister of Charity appears in the role of detective and solves a murder mystery. Pp. 154. $2.50. TEMPLEGATE PUBLISHERS, Springfield, Illinois. The Our Father. By R. H. J. Steuart, S.J. The conferences of Father Steuart on the Lo~d
2012/2013 ; There is an increasingly widespread acknowledgement among all active actors in the development co-operation sector that the Public Private Partnership (PPP) can be a new important tool, not only to build important infrastructure (public works) but also to provide services to the citizens at central and local level as well as to have a strategic value in the Cross-Border Co-operation (CBC) in the next future. The European Commission defines PPPs in a rather broad and general way without giving a proper legal definition of this partnership. For the EU PPP is a form of cooperation between public authorities and economic operators concerning design, funding, execution, renovation or exploitation (operation and maintenance) of public infrastructure, or the provision of public utility service. However, there is not a uniform, common definition of this form of partnership. Considering the present global economic and financial crisis affecting almost all the regions of the world and bearing in mind that the public resources destined on development cooperation are decreasing more and more, building partnerships and synergies between these two ranges of actors is not only a great possibility but a compelling necessity in order to continue to sustain the development cooperation sector. This is also a good chance for both public and private sector, not only to mutually reinforce each other but also to learn lessons and best practices from one another. The PPPs, in fact, if applied correctly, enable a reduction in total costs, better distribution of risks, a more rapid execution of public services and activities, as well as a better quality of offered services and implemented activities. Not to mention the fact that the overcoming of the rigid distinction between public and private opens the possibility to find solutions and to respond to questions that the public administration itself is not able to answer independently. In international cooperation and in particular in the cross-border cooperation, more and more public administrations in beneficiary and donor countries are acknowledging the subsidiary role of civil society and private sector in the activities of general interest, and therefore, also in the delivery of public functions and services. Considering the extensive work experience in the international development cooperation sector with the Italian Ministry of Foreign Affairs and other International Organizations in different areas in the world, i.e. OSCE, believing on the utility and potentiality of this instrument and directly verified that it could be more utilized in the international cooperation, it was decided to analyse the use of PPPs in this sector with a special focus on IPA CBC Programme. In fact, the scope of the dissertation and of the implementation of its conclusions is steaming from the author interest and working ties. Indeed, the author is living and working in Albania and has a huge experience on it due to the fact that she was the Albania Desk Officer for the Italian Development Cooperation for several years. She is also studying the Albanian language and she is very fascinated from the history of this small country so close, not only geographically speaking, to Italy. The focus on Macedonia as neighbour country is due simply to the fact that to collect information on this IPA CBC Programme was easier than others similar financial instruments. Building on extensive field experience, this dissertation will try to answer the following question: 'Which is the winner strategy to increase the effectiveness of the CBC projects through the use of PPP?'. The thesis overall objective is to identify a set of strategies that can enhance the effectiveness of cross-border cooperation through the use of the PPP instrument, beyond specific cross-border project interventions that until now have mainly been carried out though institutional channels and implemented through European projects and programs. The strategies that the conclusion of the dissertation draws are based on the SWOT analysis of five projects funded by the EU through the IPA CBC Albania – Macedonia during the 2007-2013 programming period and the consequent elaboration of the results. These strategies would hence open up new possibilities for the development of CBC's activities applicable in the ambit of the EU's regional policy 2014-2020, without necessarily relying upon more EU financial means. This is also in line, with the EU auspices for the CBC not to be just another way to access funding but rather to become a model of cross-border cooperation sustainable on its own devise. The dissertation is based on collection and analysis of data available within the existing legal-institutional framework and will make use of the investigative qualitative method with the aim of verifying the hypothesis mentioned above. The thesis envisages a number of working phases chronologically distinct and mutually supportive and it is based on the utilisation of a number of diverse theoretic constructs and methodologies. The dissertation makes use of different sources such as for instance existing literature, statistics, on line documentation available and its content is conducted on the various official documents and projects documentation obtainable. The results are cross referenced and presented based on a SWOT analysis and process of data/results interpretation. As far as the structure of the work is concerned, the first Chapter, after an analysis of the theoretical tools supporting PPP, presents a background and an overview of the PPP in Europe, and the way it is applied in the context of international cooperation and cross-border cooperation; this is to understand how it was established and what its original objectives were, and to explain its evolution up to now. In particular, the chapter after shows that PPP was born in '30s mostly linked to the energetic and mining sectors, it presents that PPPs are growing and are seen as an important instrument of economic and social development also in the international and cross-border cooperation. It is seen that an instrument which opens the way to potential PPPs is the Inter-Municipal Cooperation Instrument (IMC) which permits to bridge the gaps in the municipalities and make them stronger also in applying to donor funds. Through this instrument established by the Council of Europe (CoE) the municipalities can also sub-contract a private company or creating an IMC entity constitutes a viable market attracting private investors. PPP is also encouraged by United Nations (UN) since 1999 through the 'Global Compact' project and different are the example of PPP around the world established by various UN Agencies. It can be affirmed that PPP is considered useful in the public sector also because can contribute in solving difficulties caused from public balance cuts as well as to overcome the bureaucratic and the scarcity of technical and management competencies of the public administration. The PPP is therefore an actual, innovative and complementary instrument to promote development, reforms as well as investments, policies and good practises in different sectors including the development cooperation also at trans-border level. Therefore, thanks to PPP it can be affirmed that the private sector also has become at all its effects a privileged actor of the international development cooperation. The second Chapter of the dissertation analyses the European Policies interconnecting PPP and their related instruments, as well as more in detail how these policies have applied PPPs in the cross-border cooperation as well as how CBC became more explicit in the EU context and in particular in the context of the stabilisation and association processes. In fact, starting from the 1950 Schuman Declaration, the chapter introduces the founding EEC Treaty, examines the Single European Act and analyses the European Cohesion Policy (or Regional Policy). In addition the chapter views the European Enlargement Policy (Pre-accession Policy) analysing the three membership criteria established during the Copenhagen European Council in 1993, the various stages of the membership process and the reasons for further enlargement taking into consideration the historic enlargement of 2004, the different strategic objectives involved in it and its new approach in view of the so-called Arab Spring. In addition, the chapter analyses the European Neighbourhood Policy (Proximity Policy) as well as its related instruments, with regard to both its partner countries and candidate states. Moreover the chapter identifies the possibilities of PPP within the EU's financial instruments that are currently being concluded. Even where those policies do not provide explicitly the adoption of PPP instrument, it is however not excluded. This means that the policies at issue give valuable support to the adoption and use of PPP. The dissertation is interested in to give evidence of the strong points of PPP application, and shows that, when there is a lack of applied PPP framework, as it is the case of the country cases (Albania and Macedonia) under analysed, the CBC component of IPA programme may be due not to give envisaged results to achieve the objectives. After having looked into the European policies intersecting PPPs and CBC, the third Chapter introduces a brief analysis of the concept of border, not only in the physical administrative sense, due to the fact that this concept is a key element to understand the cross-border co-operation processes existing in the EU and in general all over the world. With this aim in mind, after studying the main theoretical approaches on this domain, the analysis focuses on the cross-border co-operation not only in its theoretical dimension but also in its deriving pragmatic aspects. The analysis of the border concept and of the border and peripheral area, as well as the general theory of the system applied to the general theory of boundaries, is essential to anticipate the concept of the cross-border cooperation and its practical application. After this analysis, the chapter describes the legal institutional framework in order to analyse the effectiveness of the various legal instruments that have been put in place to encourage and facilitate forms of cooperative engagement across borders. Starting with the European Outline Convention of Transfrontier Co-operation between territorial communities or authorities (Madrid Convention 1980), a central instrument for the CBC that was born in the frame of CoE, the chapter introduces the three protocols of the Madrid Convention. The additional Protocol essentially gives the possibility to create an organism for cross-border cooperation; the second Protocol (no 2) provides above all a legal framework for the inter-territorial cooperation between the parties; and the third Protocol (no 3) concerns the possibility of forming the ECG by creating the legal status, the institution and the functioning of such Groups. In addition, in view of how cross-border cooperation has acquired more importance through time, the chapter explains the functioning of European Grouping of Territorial Cooperation (EGTC) institution, its modality of action and its fields of applications. The EGTC has come to be a new legal/financial instrument that integrates the Madrid Convention and the relevant Protocols. The chapter also touches upon the various aspects of cross-border co-operation and in particular some milestones from the EU experiences, and presents the European Macro-Regional Strategy and its related legislative framework as an example. In addition the chapter shows the Baltic, the Danube and the Adriatic – Ionian Macro-Region and describes the main differences between EGTs and Macro- Regions. In addition, the chapter considers appropriate to present the steps that have been taken from the EU with regard to the cross-border cooperation which, more particularly, have consisted of making available important financial instruments such as INTERREG that supports from the top to the bottom the Strategy of Macro-Regions. Following the fourth Chapter describes the 2014-2020 EU's Regional Policy as the context of application of the PPP and its change with respect to the 2007-2013 EU's Regional Policy. In particular after introducing the EU programming period 2007-2013 and the changes intervened in the following programming period also having a political/historical nature like the Arab spring and the interests to further develop economic interactions between the EU and the Middle Eastern partners, the chapter analyses the useful instruments for the realization of the cross-border cooperation; especially the European Regional Development Found (ERDF). In addition, this chapter, will identify the possibilities of PPP within the financial instruments that are about to be activated in the new European Programming Cycle. To this regard it is important to mention that, in general, all the EU policies must contribute to the implementation of the Europe 2020 Strategy that in order to fulfil its ambitious objectives identified as key instrument the instrument of partnership, among which that with the private sector. Here it is worth to emphasize that, generally, the overall objectives of the regional policy, both at national and European level, are all of an economic nature, i.e. increasing the national economy by attenuating and eliminating economic disparities between different development levels of the regions. In particular, the European Policies aim to improve the investment climate through public investment in the regions presenting some gaps and to manage the local regional resources in a more efficient way. The dissertation shows how in both cases, PPPs can help in the achievement of these important aims. In addition, the chapter observes that there are changes in various aspects and procedures of the implementation of the new regional policy as well as in the legal frame, and examines the IPA instrument and the ENPI instrument in the two seven-years programming periods because they are closely related to the European Territorial Cooperation (ETC). Between this two latter instruments IPA is a more relevant for this dissertation. For this reason, after on overview of the Albanian context considering some economic, demographic, social and political aspects, including the criteria Albania has to fulfil to receive the candidate status from the EU as well as a brief introduction to the Albanian Law on PPP, the fifth Chapter presents its relations in the region, especially with the Former Yugoslav Republic of Macedonia (FYROM) and stresses the IPA CBC Albania – FYROM related to 2007-2013 and 2014-2020 programming periods. In addition, the chapter presents the main differences between these two programming periods focussing mainly on the Albanian part. With the aim to focus on the Albanian opportunities in the new programming period, it will be stressed what will change in the next future and which are the positive effects on PPP considering also the concept of Social Corporate Responsibility and the UN Global Compact initiative already mentioned in the first Chapter. All this to introduce the last Chapter which, through the analysis of the methodologies used during the various phases of this work, and especially through the explanation of the SWOT analysis, aims to identify a set of winning strategies to increase the effectiveness of the Cross-border cooperation through the use of the PPP instrument. The first part of the dissertation made use of several documentary sources, most notably and especially in the early stage the work will carry out what it is commonly defined as a secondary analysis, in particular this was articulated through: collection and review of existing literature and of the official documentation and statistics available mainly on-line but also with the Albanian Ministries and national institutes, i.e. the Albanian National Institute of Statistics, as well as with the various donors and international organisation in the Country, and especially with the Delegation of the European Commission to Albania. Instead, the second part of the dissertation focuses on the analysis of the IPA CBC program in general, and IPA CBC Albania - Macedonia in particular. To this end it was decided to proceed with the analysis of specific projects activated in the context of this program to highlight the role of actual or potential PPP projects in developing virtuous CBC. Although the PPP is not explicitly defined among the tools used in the implementation of these projects, it was decided to identify the prodromal factors present in some PPP projects with the end purpose of assessing their potentials, especially in view of the next programming period of the EU (2014-2020). The detailed information on the projects carried out or that are in progress are not publicly available as they are under the 'ownership' of the Delegation of the European Commission in Albania and of the Managing Authority of the program. In order to collect the necessary materials to identify the most relevant projects and, subsequently, to proceed to their analysis, it has proved necessary to proceed through in-depth interviews with qualified actors. Given that, interviews have been conducted with interlocutors, mainly from the European Commission in Albania, the Albanian Ministry of Integration and of Austrian Cooperation. Through these interviews, specific information relating to five concluded projects, in which the instrument of the PPP was present at least in embryonic form, has been added to the data relating to the context and to the program. The information gathered has been structured so as to proceed to a qualitative analysis of the data through the development of a SWOT analysis of these five projects funded by the IPA CBC Albania - FYROM - First Call for Project Proposals. Finally, this work presents the results of this analysis through a process of data interpretation. After this presentation, and before starting the SWOT analysis, the chapter presents the Annual Work Programme for Grants 2009 of the DG Enlargement related to the first Call for Proposals and the Guidelines related to the CBC Programme Albania - FYROM which aims is to facilitate the cooperation between the two countries to improve living conditions in the target area. The Programme in fact, already mentioned in the fifth Chapter, it aims to fostering cross-border economic, environmental and social development and includes three different measures and for each measure a list of potential activities for projects. Furthermore, the chapter analyses - through the SWOT analysis above mentioned - five projects funded by the EU within the IPA I CBC Albania – FYROM first call. In particular, in this dissertation, the SWOT analysis is the tool to identify the strengths (S), weakness (W), opportunities (O) and threats (T) that characterize projects which are analysed in relation to PPPs. In other words, it seeks to identify the strengths and internal resources of projects capably to push the development of PPPs (strengths), as well as the internal project limitations and weaknesses that impede PPP development in the relevant area (weaknesses), the external project opportunities that can be developed to overcome identified weaknesses (opportunities) and external factors that may hamper the future development of PPPs (threats). Considering that there is no project where the applicant is a PPP, although an analysis of the guidelines of the Call for Proposals relative to IPA Albania - FYROM CBC Programme found an explicit reference to PPPs, it has been choose to make a screening of projects in which the instrument of the PPP was present at least in embryonic form, in other words having the private sector as a direct or indirect beneficiary. As already mentioned, Macedonia was chosen as an example because of the availability of information related to projects. So, on these terms, 5 projects were selected out of 15 under review. The projects are the following: • Cross-border shared integrated alternative tourism, • Business without borders, • Cross-border Civil Society Forum, • Promoting business women enterprises in the cross-border area, • Borders without boundaries. The dimensions chosen for the analysis are: • related to the internal context to identify strengths and weaknesses: objectives, actors and target, • related to the external context to identify opportunities and threats: actors, target and expected results. After the SWOT analysis, the chapter finally presents the key results of the dissertation proposing some possible actions that could improve the CBC through the use of the PPP emerged from the initiatives analysed. The conclusion reviews the major points of the dissertation showing the main results such as the strategies, which may result from the conclusions, thus potentially establishing an alternative approach aiming at opening up new possibilities for the development of better, more effective and sustainable CBC project/programs/activities, without necessarily relying upon more EU funds. For what above mentioned and to answer to the question 'Which are the winner strategies to increase the effectiveness of the CBC projects through the use of PPP?', it is possible to affirm that to present more successful projects in the future increasing the effectiveness of the CBC projects through the use of PPP, the development strategies are essentially the enhancement strategy and the overcoming strategy. In particular, to reinforce the internal and external positive aspects and factors in the cross border area and to mitigate and/or dissipate internal negatives as well as to attenuate the external ones, the recommended actions referred to the public and private sectors are: • to organize jointly regular meetings in which they can know each-other, exchange information and best practices in either of the neighbouring countries, so that there can be discussions on the potentials of development and the new economic undertakings and new instruments to be employed, such as the PPP. Tourism can serve as a pilot sector in which it can be started with the actualization of gender policies facilitating in some way the inclusion of women in business activities, • jointly organize awareness campaigns on PPPs and training courses, which could serve to overcome the lack of ability to establish efficient PPPs for both public and private sector, • to organize, for the numerous actors present in the territory, specific courses and/or informative events related to the revision processes of normative policies that could facilitate and reinforce both the cooperation between different stakeholders and the capacity of doing business and create PPPs, • to enhance the existing networks and creates new ones through continuous meetings between different stakeholders with the aim of overcoming the threats considering that the improved and expanded relations between the various actors could bring an improvement in raising needed funds. Finally, it is important to mention that there are also some actions recommended only to the public sector. These are: • (especially at local level) institutions such as the municipalities can organize meetings, inviting the traditional and non-traditional private actors, in order to facilitate communication. Through this communication there could be achieved the introduction between various stakeholders interested in the PPP instrument, by at the same time laying the basis for the foundation of a network. This would be useful for increasing the credibility of each other and also to contributing to the overcoming of the lack of cooperation problem. These meetings could be used for an exchange of best practices in the sectors that are present in the certain areas. By employing a participatory methodology, these meetings could also serve to the construction of a sort of roadmap (lines of action during a defined time) that could enable the definition of the obstacles to be overcome in order to effectively and efficiently realize this type of partnership, • the authorities should first change their national optics and then transform their national policies into regional ones, starting from the cross-border policies with neighbouring countries, in which PPP should be promoted as a development instrument. In addition, when necessary, they should review the legal framework in order to facilitate the establishment of PPP. After this, they should organize meetings between the different stakeholders, and more generally between citizens living in the border areas of the neighbouring countries, with the end objective of promoting the necessary knowledge for overcoming the prejudices and for opening way to partnerships and cooperation activities, • to implement policies for purposes of facilitating investments in diversified sectors, taking an advantage of the actors from different sectors and directing them to training courses to gain knowledge in areas of investment that are different from their traditional ones. ; Vi è un riconoscimento sempre più diffuso tra tutti gli attori attivi nel settore della cooperazione allo sviluppo che il partenariato pubblico privato (PPP) può essere un importante nuovo strumento, non solo per costruire grandi infrastrutture (quindi per il settore dei lavori pubblici), ma anche per offrire servizi ai cittadini sia a livello centrale, sia locale e avere, in un prossimo futuro, un valore strategico nella cooperazione transfrontaliera (CBC). E' stato visto come la Commissione Europea definisca il PPP in un modo piuttosto ampio e generico, senza dare una definizione giuridica adeguata di questo partenariato. Infatti, per l'Unione Europea il PPP è una forma di cooperazione tra le autorità pubbliche e gli operatori economici riguardante la progettazione, il finanziamento, la realizzazione, il rinnovamento o lo sfruttamento (funzionamento e manutenzione) delle infrastrutture pubbliche, così come la fornitura di un servizio di pubblica utilità (CIT). Tuttavia, non vi è un'uniforme, comune definizione di questa forma di partenariato. Considerando che l'attuale crisi economica e finanziaria globale ha colpito quasi tutte le regioni del mondo e tenendo presente che le risorse pubbliche stanno diminuendo sempre più, tra cui soprattutto quelle destinate alla cooperazione allo sviluppo, costruire partenariati e sinergie tra il settore pubblico e privato non è solo una grande possibilità ma una necessità che diventa impellente se si vuole continuare a sostenere gli interventi di cooperazione. Inoltre, questo tipo di partenariato è una buona occasione per entrambi i settori in quanto aiuta non solo a rafforzare i rapporti reciproci, ma anche a scambiare le reciproche esperienze e le migliori pratiche. Si è visto come se applicato correttamente, il PPP consenta una riduzione dei costi totali, una migliore distribuzione dei rischi, un'esecuzione più rapida dei servizi e delle attività pubbliche, nonché una migliore qualità dei servizi offerti e delle attività prodotte. Senza contare che il superamento della rigida distinzione tra pubblico e privato apre la possibilità di trovare soluzioni e di rispondere alle domande a cui la pubblica amministrazione non è in grado di rispondere autonomamente. Si sottolinea come nella cooperazione internazionale ed in particolare nella cooperazione transfrontaliera, sempre più spesso le amministrazioni locali dei paesi beneficiari e donatori stiano riconoscendo il ruolo sussidiario della società civile e del settore privato nelle attività d'interesse generale e quindi anche nell'erogazione di servizi e funzioni pubbliche. Considerando la vasta esperienza di lavoro nel settore della cooperazione allo sviluppo con il Ministero degli Affari Esteri italiano in diverse aree del mondo così come con altre organizzazioni internazionali, da ultimo con l'Organizzazione per la Sicurezza e Cooperazione in Europa (OSCE), credendo sull'utilità e le potenzialità dello strumento del PPP e verificato direttamente che potrebbe essere utilizzato maggiormente nella cooperazione internazionale, l'autore ha deciso di analizzare l'uso di tale partenariato in questo settore focalizzandosi in particolare sul programma IPA I CBC Albania - Macedonia. Infatti, lo scopo di questa tesi e della potenziale applicazione delle sue conclusioni deriva dall'interesse personale e dall'attività lavorativa dell'autore. Infatti, vive e lavora in Albania e ha una grande esperienza del paese perché è stato per diversi anni responsabile per la Cooperazione Italiana dei progetti che questa ha realizzato nello stesso. Inoltre, sta anche studiando la lingua albanese ed è molto affascinato dalla storia di questo piccolo paese così vicino all'Italia, non solo geograficamente parlando. L'attenzione per la Macedonia come paese confinante, invece, è dovuta semplicemente al fatto che è stato più facile reperire informazioni sul programma IPA I CBC Albania - Macedonia rispetto agli strumenti finanziari simili. Sulla base di una ricca esperienza sul campo, questa tesi cercherà di rispondere alla seguente domanda: "Quali sono le strategie vincenti per aumentare l'efficacia dei progetti di cooperazione transfrontaliera attraverso l'uso del PPP?". L'obiettivo generale della tesi è di individuare, infatti, le strategie che possono migliorare l'efficacia della cooperazione transfrontaliera attraverso l'uso di tale partenariato, al di là di specifici interventi che fino ad ora sono stati principalmente effettuati attraverso canali istituzionali e attuati attraverso progetti e programmi europei. Le strategie che la conclusione della tesi identifica si basano sull'analisi SWOT di cinque progetti e la conseguente elaborazione dei dati/risultati. Questi cinque progetti sono stati selezionati tra quelli finanziati dall'UE tramite l'IPA I CBC Albania/Macedonia durante il periodo di programmazione 2007 - 2013, in quanto presentanti il PPP almeno in fase embrionale. Tali strategie potrebbero aprire nuove possibilità per lo sviluppo di attività di CBC applicabili nell'ambito della politica regionale 2014 - 2020 dell'Unione Europea, senza necessariamente fare affidamento su ulteriori mezzi finanziari della stessa. Questo è anche in linea con gli auspici dell'UE che crede che la CBC non sia solo un altro modo per accedere ai finanziamenti, ma possa piuttosto diventare un modello di cooperazione sostenibile di per sé. La tesi si basa sulla raccolta e l'analisi dei dati disponibili nell'ambito del quadro giuridico-istituzionale esistente e fa uso del metodo qualitativo di ricerca con l'obiettivo di verificare l'ipotesi di cui sopra. La tesi prevede una serie di fasi di lavoro cronologicamente distinte e reciprocamente sostenibili e si basa sull'utilizzo di diversi costrutti teorici e varie metodologie avvalendosi di diverse fonti come ad esempio la letteratura esistente, le statistiche effettuate e più in generale la documentazione disponibile soprattutto in internet. Il suo contenuto deriva quindi dal reperimento e dall'analisi di varia documentazione ufficiale e di cinque documenti progettuali, così come verrà maggiormente esplicato qui di seguito. Seguendo la struttura della tesi, si può affermare che il primo capitolo presenta il quadro normativo e finanziario dei PPP in Europa, così come il modo in cui questo strumento viene utilizzato nel contesto della cooperazione internazionale e della cooperazione transfrontaliera, al fine di comprendere quando è nato questo tipo di partenariato e quali siano i suoi obiettivi e le evoluzioni che ha avuto fino ad oggi. Nello specifico, il capitolo mostra come il PPP sia nato negli anni '30 soprattutto collegato al settore energetico e minerario e come, pur non avendo ancora una comune definizione a livello europeo, oggi sia in crescita e venga visto come un importante strumento di sviluppo economico e sociale anche nel settore della cooperazione internazionale e transfrontaliera. Il capitolo, inoltre, presenta la cooperazione inter-municipale (IMC) come uno strumento che può aprire buone potenzialità all'applicazione del PPP in quanto permette di colmare le deficienze delle municipalità. Attraverso questo strumento, stabilito in seno al Consiglio d'Europa (CoE), le municipalità possono infatti anche sub-contrattare imprese private o creare un'entità nuova (IMC) per poter attrarre investitori e donatori. Il capitolo inoltre mostra come lo strumento del PPP venga incoraggiato anche dalle Nazioni Unite (UN) fin dal 1999 - anno in cui viene creato il progetto 'Global Compact' - e come vi siano diversi esempi di PPP nel mondo realizzati da Agenzie UN. E' importante sottolineare che il PPP è considerato utile dal settore pubblico anche perché può contribuire a risolvere difficoltà causate dai tagli di bilancio così come dalla burocrazia e dall'insufficiente capacità tecnica e manageriale che spesso caratterizza la pubblica amministrazione. Il PPP è quindi uno strumento attuale, innovativo e anche complementare capace di promuovere sviluppo, riforme ed investimenti oltre a promuovere politiche e buone pratiche in diversi settori tra cui quello della cooperazione allo sviluppo anche a livello transfrontaliero. Grazie al PPP si può quindi affermare che il settore privato è diventato a tutti gli effetti un attore privilegiato della cooperazione allo sviluppo internazionale. Il secondo capitolo della tesi analizza le politiche dell'Unione Europea e i relativi strumenti che presentano una connessione con i PPP. Più nel dettaglio, viene visto come attraverso queste politiche sia stato applicato il partenariato in parola nella cooperazione transfrontaliera e come la stessa sia divenuta più esplicita a livello europeo, soprattutto nel contesto del processo di stabilizzazione ed associazione. Infatti, partendo dalla Dichiarazione di Schumann del 1950, il capitolo introduce il Trattato istitutivo della CEE del 1957, esamina l'Atto Unico Europeo, per poi prendere in considerazione la politica di coesione o regionale. Proseguendo, il capitolo analizza la politica di allargamento o pre-accessione inclusi i tre criteri necessari per l'adesione stabiliti durante il Consiglio Europeo di Copenaghen nel 1993, i vari stadi del processo di adesione e le ragioni per cui l'Unione Europea promuove l'allargamento, considerando le diverse tappe di tale processo tra cui quella storica del 2004 e le sue prossime sfide. Dopo aver inoltre analizzato il quadro delle negoziazioni e gli strumenti previsti in ambito della strategia di pre-adesione, si è finito per affrontare la politica di vicinato o prossimità prendendo in analisi i suoi relativi strumenti, i suoi diversi obiettivi strategici e il suo nuovo approccio in seguito alla primavera araba. Dopo aver identificato come queste politiche presentino un'intersezione con la cooperazione transfrontaliera, è stata analizzata la loro intersezione con il PPP con il risultato di sottolineare che anche laddove tali politiche non prevedono esplicitamente il ricorso a questo tipo di partenariato, non lo escludono. Questo significa quindi che esse forniscono validi supporti all'uso di tale strumento, elemento importante per la tesi che è infatti volta a mettere in evidenza i punti di forza di tali politiche per l'applicazione dei PPP e a mostrare al contempo che vi è una mancanza applicazione degli stessi. Questo verrà evidenziato nel corso della tesi dal caso preso in esame di IPA I CBC Albania - Macedonia. Il terzo capitolo presenta come prima cosa il concetto di confine. E' importante sottolineare come questo concetto viene esplicitato non solo da un punto di vista fisico-amministrativo ma in un senso più ampio, tenendo conto di come il concetto di confine sia un elemento chiave per capire la cooperazione transfrontaliera. Infatti, è solo partendo dall'analisi di questo concetto e da questo a quello di frontiera e area periferica, passando anche alla teoria generale dei sistemi applicata alla teoria generale dei confini, che si può pervenire alla nascita del concetto di cooperazione transfrontaliera e della sua applicazione pratica. Per tale motivo si è ritenuto necessario esplicare i concetti sopra menzionati secondo le definizioni di vari studiosi di varie discipline, per poi presentare i principali strumenti legali che regolano e facilitano la cooperazione transfrontaliera a livello europeo così come i meccanismi ad hoc che la implementano. Si è partiti da quelli nati in seno al CoE e precisamente dalla Convenzione di Madrid del 1980, strumento quadro per il tipo di cooperazione oggetto di questa tesi in quanto introduce per la prima volta la possibilità di cooperare e concludere accordi ad enti di Paesi contigui geograficamente. Vengono poi presentati i suoi 3 Protocolli: il Protocollo aggiuntivo, che dà essenzialmente la possibilità di creare un organismo di cooperazione transfrontaliera ad essa preposto, il secondo Protocollo che fissa soprattutto un quadro giuridico della cooperazione interterritoriale tra le parti e il terzo Protocollo che concerne la possibilità di istituire i Gruppi Europei di Cooperazione (GEC) dotati di personalità giuridica. Inoltre, a dimostrazione di come la cooperazione transfrontaliera nel tempo abbia acquistato sempre più importanza, si è ritenuto opportuno illustrare l'istituzione dei Gruppi Europei di Cooperazione Territoriale (GECT), le loro modalità di azione e i loro ambiti di applicazione. Tali Gruppi, che si rivelano quindi essere un nuovo strumento giuridico/finanziario che integra la Convenzione di Madrid ed i relativi Protocolli, sono stati creati al fine di facilitare la cooperazione transfrontaliera e superare gli ostacoli incontrati fino ad allora. Il capitolo continua focalizzandosi sui passi compiuti dall'UE in relazione a questo tipo di cooperazione che in particolare consistono nella messa a disposizione di importanti strumenti finanziari quali per esempio INTERREG. Il terzo capitolo si conclude quindi affrontando anche la Strategia delle Macroregioni che, pur non avendo una loro definizione ufficiale in ambito europeo, forse anche a causa della loro recente istituzione e pratica, si dimostra essere veramente utile nel contribuire a realizzare la politica di coesione e più nello specifico il suo obiettivo n. 3 (Cooperazione Territoriale Europea). Considerando che all'interno di questa politica vi è una programmazione settennale, nel quarto capitolo vengono presentate sia quella appena terminata 2007-2013, sia la nuova 2014 - 2020 per verificarne i cambiamenti nel contesto di applicazione dei PPP. Viene infatti introdotta la programmazione dell'UE 2007-2013 per comprendere maggiormente cosa sarebbe cambiato nel settennio successivo, anche a causa di avvenimenti storico/politici avvenuti durante gli ultimi anni come la cosiddetta primavera araba e l'interesse a sviluppare maggiormente l'integrazione economica tra l'Unione Europea e i partner orientali. Si prosegue con l'analisi più dettagliata degli strumenti utili per la realizzazione della cooperazione transfrontaliera (CBC) nel nuovo settennato e le possibilità di applicazione del PPP all'interno di questi. A tale riguardo è importante sottolineare come in generale tutte le politiche europee, tra cui quella regionale ha un ruolo centrale, dovrebbero contribuire al raggiungimento degli obiettivi della Strategia Europa 2020. Si sottolinea come questa strategia, che ha portato alla definizione della nuova programmazione 2014-2020, sia molto ambiziosa e abbia individuato come uno degli strumenti chiave per la sua realizzazione quello del partenariato, tra cui anche il partenariato con il settore privato. Qui è importante evidenziare che gli obiettivi generali della politica regionale, sia a livello europeo, sia a livello nazionale, sono principalmente di natura socio-economica per es. orientati ad attenuare le disparità esistenti tra regioni aventi diverso livello di sviluppo. In particolare, le politiche europee hanno l'obiettivo di migliorare l'ambiente/contesto per attrarre investimenti al fine di incrementare investimenti in lavori pubblici nelle regioni che presentano maggiori necessità e migliorare la gestione delle risorse regionali locali in maniera più efficiente ed efficace. La tesi mostra come in entrambi i casi, lo strumento del PPP può essere di aiuto nel raggiungere questi importanti obiettivi. Inoltre, il capitolo in parola, dopo aver osservato che nella nuova programmazione settennale vi sono diversi cambiamenti dovuti al nuovo quadro legislativo e alle nuove modalità di attuazione della nuova politica regionale, esamina i due strumenti collegati alla CTE, IPA ed ENPI, nei due settenni di programmazione sopra menzionati. Il quinto capitolo invece, dopo una presentazione generale del contesto Albanese che prende in considerazione alcuni aspetti economici, demografici, sociali e politici del paese, includendo anche i criteri che questo deve soddisfare per poter ricevere lo status di candidato dall'Unione Europea, presenta brevemente la legge albanese sui PPP. In seguito, descrive le relazioni tra l'Albania e la Macedonia e il relativo Programma IPA CBC in relazione ai due periodi di programmazione suddetti 2007 - 2013 e 2014 - 2020 per presentarne le principali differenze. Concentrandosi sulle opportunità che l'Albania potrà avere nel prossimo futuro, viene sottolineato cosa cambia nel nuovo periodo di programmazione e con quali effetti positivi sul PPP, tenendo in considerazione anche il concetto di Responsabilità Sociale e l'iniziativa 'Global Compact' delle Nazioni Unite già menzionata precedentemente. Tutto questo per introdurre l'ultimo capitolo che, attraverso un'analisi della metodologia usata nelle varie fasi di preparazione della presente tesi, tra cui la SWOT analisi, identifica le strategie considerate vincenti per accrescere e migliorare l'efficacia della cooperazione transfrontaliera attraverso l'uso dello strumento di PPP. Nello specifico, la prima parte della tesi si è avvalsa di diverse fonti documentarie. Specialmente nella sua fase di inizio, il lavoro è stato definito attraverso ciò che è comunemente chiamata 'analisi secondaria'. E' stata effettuata infatti la ricerca e analisi della letteratura esistente e della documentazione ufficiale disponibile on-line e nei Ministeri albanesi così come nell'Istituto Nazionale di Statistica albanese. E' stata inoltre reperita e analizzata la documentazione in possesso di diversi donatori e organismi internazionali presenti nel paese e in particolare della Delegazione della Commissione Europea in Albania. La seconda parte della tesi si è concentrata sull'analisi del programma IPA CBC in generale ed IPA CBC Albania - Macedonia in particolare. A tal fine si è voluto procedere con l'analisi di progetti specifici attivati e conclusi nel contesto di tale programma per evidenziare il ruolo effettivo o potenziale del PPP nello sviluppo virtuoso di progetti di CBC. Sebbene il PPP non venga esplicitamente definito tra gli strumenti utilizzati nell'attuazione di queste iniziative, si è scelto di individuare i fattori prodromici del PPP presenti in alcuni progetti al fine di valutarne le potenzialità soprattutto nell'ottica del prossimo periodo di programmazione europea (2014-2020). Le informazioni dettagliate relative ai progetti realizzati o in fieri non sono pubblicamente disponibili essendo 'proprietà' della Delegazione della Commissione Europea in Albania e dell'Autorità di Gestione del programma. Per raccogliere dunque il materiale necessario ad identificare i progetti più rilevanti e, successivamente, a procedere alla loro analisi si è dimostrato necessario procedere attraverso interviste in profondità con attori qualificati. Sono state così condotte interviste con interlocutori principalmente della Delegazione della Commissione Europea in Albania, del Ministero dell'Integrazione albanese e della Cooperazione Austriaca. Attraverso queste interviste, ai dati relativi al contesto ed al programma si sono quindi aggiunte informazioni specifiche relative a cinque progetti in cui lo strumento del PPP fosse presente almeno in forma embrionale. Le informazioni raccolte sono state strutturate in modo da procedere ad un'analisi qualitativa e ad un incrocio dei dati attraverso lo sviluppo di una SWOT analisi dei suddetti cinque progetti finanziati da IPA I CBC Albania - Macedonia al fine di presentare i risultati di tale analisi attraverso un processo di interpretazione dei dati. Prima di iniziare la SWOT analisi, il capitolo presenta anche il programma annuale per i fondi 2009 della Direzione Generale Allargamento dell'Unione Europea che specifica anche gli obiettivi della CBC tra i due paesi presi in esame che consistono essenzialmente nella promozione dell'economia transfrontaliera e dello sviluppo sociale e ambientale. Il quinto capitolo, così come sopra detto, analizza quindi attraverso una SWOT analisi, cinque progetti finanziati dall'UE all'interno del programma IPA I CBC Albania - Macedonia primo bando. In particolare, in questa tesi, la SWOT analisi, è lo strumento che permette di identificare i punti di forza (S), di debolezza (W), di opportunità (O) e di minacce (T) che caratterizzano i progetti che verranno analizzati in relazione al PPP. In altre parole quali sono i punti forza/risorse interne ai progetti che possono favorire lo sviluppo di tale partenariato e quali le loro limitazioni/punti di debolezza che lo possono ostacolare, così come le opportunità/fattori positivi esterni al progetto che possono, del caso, essere sviluppati per superare i punti di debolezza individuati e quali le minacce/fattori negativi esterni che derivano dal contesto locale e che impediscono lo sviluppo del PPP nell'area di interesse. Basandosi sulle informazioni ottenute non essendoci progetti in cui i candidati sono formati da un PPP, anche se da un'analisi delle linee guida del bando ('Call for Proposal') relative al Programma IPA I CBC Albania - Macedonia primo bando, è stato rilevato che non vi è un riferimento esplicito a questi, è stato scelto di fare uno screening dei progetti verificando quelli che nel loro interno presentavano almeno come beneficiari diretti e/o indiretti il settore privato. Così come sopra illustrato, tra i paesi confinanti l'Albania è stata scelta la Macedonia a titolo esemplificativo. Tra i 15 progetti presi in considerazione, i 5 progetti selezionati sono: 1. 'Cross-border shared integrated alternative tourism' (Turismo transfrontaliero alternativo integrato e condiviso), 2. 'Business without borders' (Impresa senza confini), 3. 'Cross-border Civil Society Forum' (Forum transfrontaliero della società civile), 4. 'Promoting business women enterprises in the cross border area' (Promozione dell'impresa femminile nell'area transfrontaliera), 5. 'Borders without boundaries' (Confini senza limiti). Queste le dimensioni scelte e di volta in volta da verificare per ogni progetto selezionato: • relativamente al contesto interno, al fine di identificare i punti di forza e di debolezza, sono obiettivi, attori e beneficiari, • relativamente al contesto esterno, al fine di identificare le opportunità e le minacce, sono attori, beneficiari e risultati attesi. Dopo la SWOT analisi, il capitolo da ultimo presenta i risultati chiave della tesi proponendo le strategie che potrebbero migliorare la cooperazione transfrontaliera attraverso l'uso del PPP. Le considerazioni conclusive della tesi riprenderanno tali strategie ripercorrendo inoltre i punti principali del lavoro svolto. Per rispondere alla domanda che sottende questa tesi, le strategie identificate come approcci alternativi che si possono applicare al fine di consentire ai programmi/progetti di cooperazione transfrontaliera di essere sviluppati in misura maggiore e in maniera più sostenibile, efficace ed efficiente utilizzando lo strumento del PPP e senza usare necessariamente ulteriori strumenti finanziari europei sono quelle cosiddette del 'rafforzamento' e del 'superamento'. In particolare, per rafforzare gli aspetti e i fattori positivi nell'area transfrontaliera e per mitigare e/o dissipare quelli negativi emersi dall'analisi effettuata, le azioni raccomandate sia al settore pubblico, sia al settore privato, possono essere così riassunte: • organizzare congiuntamente degli incontri regolari nei quali i diversi attori possano conoscersi meglio reciprocamente così come scambiare informazioni e migliori pratiche relativamente ai paesi vicini in modo che la discussione possa vertere man mano sul potenziale sviluppo in particolare dell'economia attraverso l'impiego di nuovi strumenti come il PPP, iniziando magari da un settore pilota quale il turismo, • organizzare congiuntamente campagne di informazione sul PPP e corsi di formazione che potrebbero servire al superamento della comune mancanza di capacità di istituire efficienti PPP, • organizzare per i numerosi attori presenti sul territorio dei corsi o eventi finalizzati ad informare sui processi di revisione normativa utile a facilitare e rafforzare la cooperazione tra i diversi attori, la capacità di fare impresa e creare PPP, • rafforzare congiuntamente le reti esistenti e crearne delle nuove attraverso continui incontri capaci di mettere assieme i diversi attori aventi l'obiettivo di superare gli ostacoli/minacce e consideranti il rafforzamento delle relazioni un valore aggiunto atto a migliorare anche la capacità di reperire i fondi necessari. Le azioni invece che si raccomandano solo al settore pubblico sono: • (specialmente a livello locale) gli attori istituzionali quali le municipalità potrebbero organizzare delle riunioni invitando il settore privato, tradizionale e non, al fine di facilitare la comunicazione tra i partecipanti introducendo al contempo il PPP e facilitando l'istituzione di partenariati, • le autorità istituzionali dovrebbero cambiare la loro ottica trasformando le loro politiche nazionali, a partire da quelle transfrontaliere relative ai paesi confinanti, in modo da promuovere il PPP quale strumento di sviluppo agevolandone l'istituzione attraverso le modifiche del quadro normativo laddove necessarie, • realizzare delle politiche aventi l'obiettivo di facilitare gli investimenti diversificando i settori degli stessi e organizzando al contempo dei corsi di formazione professionale per dare l'opportunità alla popolazione in età attiva di diversificare le loro conoscenze e capacità. ; XXIV Ciclo ; 1970
Issue 10.5 of the Review for Religious, 1951. ; A.M.D.G. . Renew for Religious SEPTEMBER 15, 1951. Christian Heroes . J. Pu~z Joy in Heaven . Richard L. Rooney ¯ PassionisHc SpirH'uallty . Fidells Rice Modesty ¯ ¯ ~ . ,~ .~ . C- A. Herbs÷ Grace o~ Our Vocation . P. De Leffer Communion for O~hers . . Clerence McAuliffe A Vocational Newspaper Questions and Answers Book Reviews ,VOLUME X i' =, NUMBER 5' RI:::VI W FOR RELIGIOUS VOLUME X SEPTEMBER, 1951 NUMBER GONTENTS CHRISTIAN HEROES-~3. Putzo S.J . 225 Heroism of Everyday Life . 225 The New Saints ¯ " . ZZ9 The New Beati . 235 JOY IN HEAVEN--Richard L. Rooney, S.3 .2.3.9 PASSIONISTIC SPIRITUALITY--Fidelis Rice, C.P .2.4.1 OUR CONTRIBUTORS . 246 MODESTY--C. A. Herbst, S.J . 247 ETUDE SUR LA PAUVRETE. RELIGIEUSE .2.5.2. THE GRACE OF OUR VOCATION---P. De Letter, S.J .2.5.3 COMMUNICATIONS--A VOCATIONAL NEWSPAPER . 260 OFFERING COMMUNION' FOR OTHERS-~Clarence McAuliffe, S.J. 261 MEDICO-MORAL PROBLEMS . 265 QUESTIONS AND ANSWERS-- 20. Alienation of Property for $100,000 . 266 21. Alienation of Sacred Objects: Relics, Images, Vessels . . . . 266 22. Extreme Unction before Major Operation .268 23. Letters of Golden Jubilarians . 268 24. Novice Master at Coun~i~ Meeting . ¯ " . 268 25. Communion to Ambulatory Sick . 269 26. Hail Mary's on Feast of Annunciation . 270 I'~EW MEDITATION BOOKS . 270 BOOK REVIEWSw Pastor's History of the Popes; The Love of God and the Cross of Jesus; The Gifts of the Holy Ghost . 273 BOOK ANNOUNCEMENTS . 276 BOOK NOTICES . 278 TEN YEAR INDEX OF REVIEW--MAYBE . 280 REVIEW FOR RELIGIOUS, September. 1951. Vol. X, No. 5. Published bi-monthly: January, March, May, July, September, and November at the College Press, 606 Harrison Street, Topeka, Kansas, by St. Mary's College, St. Marys, Kansas, with ecclesiastical approbation, Entered as second class matter January 15, 1942, at the Post Office, Topeka. Kansas, under the act of March 3, 1879. Editorial Board: Adam C. Ellis, S.J., G. Augustine Ellard, S.J., Gerald Kelly, S.J. Editorial Secretary: Jerome Breunig, S~ J. Copyright, 1951, by Adam C. Ellis, S,J. Permission is hereby granted for quota-tions of reasonable length, provided due credit be given this review and the author. Subscription price]! 3 dollars a year: 50 cents a copy. Printed in U. S. A. Befoie writing to us, please consult notice on inside back cover. Christ:ian bleroe It~UR DAYS call for heroic living. The greatness.and diffi: ~ culties of our time are su.cb that no disciple ofo "~hrist.is allowed to remain satisfied with mediocrity." This, saying of Plus XI has often been quoted. The Holy Year was" meant-to stir up Christendom to greater fervor, that it might be an:active, l'eaven for'the much-needed renovation of the world. The numerous beati-fications and canonizations of this last year put beforeus outstandi'ng Christian heroes whose example is meant to stimulate our mediocgity~ Heroism is the test applied by the Church to candidates for .beati-- fication--not a human, stoic heroism, but a heroism inspired by personal love, by charity, and sustained by the Holy Ghost dwellin~ in the soul. At the beginning the typical saint was the ma'rtyr, th.e Christian who had been a witness to Christ by. dying for Him. ,But soon it was realized that, in the absence of persecution.s, there can be an "unbloody martyrdom" by heroic fidelity in liv'ing for Christ, Thus, by the side of martyrs, the names o,~f. outstanding "confes~ors~j came to be added in the martyrology. Heroism always remained the test of genuine sanctity, and the Congregation of Rites, .When studying the cause of'a confessor, has chiefly to discuss the hiroism his virtue. Is there evidence that he possessed in a herbic degree.the theolggical virtues of faith, hope, charity and the cardinal.~ri~tues :of prudence, justice, temperance, fortitude, with the virtues connected with them'? , .' ~ :: " , But what is required for heroic virtue? It is not easy tO dete~ mine thi's notion. Benedict XIV, in his treatise on'the beatification of the servants of God, has given all the elements, but he has:not made the synthesis, and one may say that the notion remained some:~ what indeterminate. This gave rise, 'within the ,Congregatigrl of Rites, to different conceptions of heroic, virtue. This. difference' de-layed the cause of the servant of God, A. Gianelli. The same reason may explain why until this year no child or ado.lescent ever passed the test, for the classical conception insisted 'on "extraordinary,~.' manifestatidns of heroism. There was room for progress 'tow~i'r'ds greater precision and, accor~ding to a recent articl'e by.~a consultor:of 22'5 J. PU~Z Reoieto for Religious the Congregation of Rites, the well-known Carmelite, Father Gabriel of St. Mary Magdalen, a distinct progress has been made during recent years. (Cf. Etudes Carmelitaines, 1949, pp. 175-88.~ This progress has not only a juridical importance for the process of beatification; it interest~ ascetical theology as well, since all Chris-tians are called to sanctity, and the type of holiness required by the Church for canonization determines the ideal of Christian perfection after which all must strive. T.he true Christian is the saint, and the saints are the standard by which we must guide and judge ourselves. Our imitation of.them must be based on a precise notion of what sanctity-~heroic virtue--consists in. Aqcording to Father Gabriel, the work of elaboration and deter-mination took place chiefly between 1916 and 1922, under the direct inspiration of Benedict XV. It can be followed in the decrees of the Congregation of Rites published on the occasion of the declara-tion of heroic virtue especially in the decrees concerning A. M. Gianelli (AAS, 1920, pp. 170-4)'and 3. N. Neumann (AAS, 1922, pp. 23-6). As a result, we are told, the Church is now in possession of a concept of heroic virtue more synthetic, less complicated and less abstract, more definite and easier to apply. This notion was clearly expressed in 1916 by Benedict XV, when he declared that "sanctity consists merely in conformity with the divine will, expressed in the constant and exact fulfillment of the duties of one's state." Sanctity, as the decree of April 11, 1920, explains, cannot be judged by an abstract standard. The saints cannot be reduced to one type. Heroism will vary according to each one's temperament, state of life, and other circumstances. It will not always show itself by extraordinary or stupendous deeds. For, as the decree' states, "these require a suitable occasion. But such occasions are rare and do not depend on the will of man; persecutions, for instance, plagues, or earthquakes cannot be produced at will. Hence, if holi-ness consisted in such deeds, it would follow that holiness itself does not depend on the will of man--which is absurd." The heroism to which all Christians can aspire is the exact and constant fulfillment of their concrete daily duties. "Comrounia sed non communiter,'" according to the motto of St. John Berchmans, doing common things but uncommonly well. What makes the saint is not the nature of his actions, whether extraordinary or common, important or insig-nificant; what counts is the intensity of his love that rules and in-spires all his actions. 226 September, 195 ! (]HRISTIAN HEROES Such fidelity implies real heroism, for nothing is more difficult to human nature than constancy. To be moved in everything by the will of God only, without being influenced by the ever-active sensi-bility, the sudden movements of the passions, the sense of fatigue, the ups and downs of one's n~oods.---such constancy supposes that the soul is under the perfect domination of the Holy Ghost and totally oriented towards its last end. Father Gabriel wrote in the same article, "If it were not so, if it were not perfectly purified, if other motives distinct from the love of God were still active (they can all be reduced to self-love, the root of all inordinate love of creatures), .then it would inevitably act more than once under the impulse of these motives and thus deviate from the pure fulfillment of the divine~ will." In such a soul "we admire a human nature tbat has reached a singular harmony and perfection--its spiritual forces keeping the sensible fac~lties in docile submission or completely conquering their resistance, so as to realize to perfection the task prescribed to it by the Lord: the perfect fulfillment of His holy will by a total, constant, ~nd generous fidelity to the daily duty." "Such sublime conduct, kept up over a long period, and without failure, is completely above the powers of human .nature left to itself . It alone suffices for evangelical heroism, for it makes man perfect in the way the heavenly ~Father is perfect." (Quoted by Benedict XIV in his treatise on beatification, III, c. 21, n. 10.) ! "'The heroism of the ordinary life has officially received a place by the side of the classical extraordinary heroism," wrote D. Pietro Brocardo. (Cf. Satesianum, 1950, p. 197.) Benedict XV's suc-cessor, the Pope who stressed the universal call of Christians to sanc-i. ,t~ty, often expounded this conception. Sanctity, according to Plus ~KI, is not something "exceptional," it is but the Christian life lived fully and intensely according to each one's vocation. Sanctity is but ~he fullest and richest expression of Christian life. It is the divine perfection proposed to all, from the humblest believer to the gigantic ~gures of hagiography. If not all are called to the same height of ~anctity, yet all are called to sanctity. His most famous pronounce-ment on this topic is his allocution published in Osservatore Romano, ~Jan. 6, 1928, on "the terrible everyday duty," given after the reading bf the decree of the heroic virtue of Brother Benildus, a humble leacher who had spent his whole life in elementary schoo.ls: "A humble servant of God, whose whole life was all modesty hnd silence, all very commonplace and very 'everyday.' But in such 227 Reoiew for Religious an. everyday- life how much there is that is not common! This everyday, always the same, with the same occupations, the same ~;eakness~s, the same miseries, has rightly been called 'the terrible ev'e'ryda3f:' How much strength is required to stand up to this ter-rible, this crushing, this monotonous, this asphyxiating everyday! An. un'c6mmon irirtue is very necessary to perform--not with an all too'° frequent negligence and superficiality but with attention and inner fe'rvbr of spirit--that series of common actions which fill our e'4ceryday life'. 0' "Holy Church is never a more equitable judge and a wi~er teacher of bdlinesk than when she honors these humble lights, so often unnoticed even by those who had the good fortun~ tosee them shine finder their i'er~, eyes. Extraordinary things, great events, magnifi-cei~ t enterprises arouse the noblest instincts: in the commonplace, on the:contrary, that is, in the flat and obscure everyday task, there is nothing exciting or fascin.ating. Yet this is the stuff the life of most men' is made of. How often do extraordinary circumstances present therfiselves in a lifetime? They are very rare, and woe to us if sanc-tity were reserved to extraordinary circumstances! What would the greater part of'~nankind do? For it is certain that all without dis-tinction are called to sanctity." " B'roth~r B~nil~tus was beatified twenty years later, on April 4, 1948. On that occasion Plus XII, too, spoke of the heroism of the ordinary life. Benildus was neither a founder, nor a mystic, nor a miracle-worker; h~.was a,~simple schoolmaster. His only claim to the honors' of the YChurch was his fidelity to duty--to his rules and the daily grind of the school. But such constant fidelity to the details of his di~ty, his radiant charity, his serenity in difficulties could only flow. frorrl a'ddep[and vigorous interior life and habitual union with Goal. ' :. ¯ During th~ Holy Year a variety of saints have been' beatified or e~rmn~zed." Maria Goretti w~s only eleven when she died, but she Was canonized as a martyr. Yet, even this extraordinary form of htroisrd;, the Pope pointed out, presupposes the "ordinary" heroism of the'daily life. Among the new beati is the first adolescent ever t'gised to the altars, Dominic Savio. So far, the youngest confessor ~fioni~ed is S~."Stanislaus; but he was a young man of eighteen ~nd, besides bein~ a religious, his life was out of the ordina.ry, Dominic died before he was fifteen, and his life was the very ordinary s~hool-b'oy life. The criterion of heroic virtue exposed by Father Gabriel 228 September, 1951 CHRISTIAN HEROES ,seems to havi~ made it possible for children and adolescerits to pass the test required for tl~e supreme honors of the Church. The eight saints canonized during the Holy Year of 1950 brought "the total number canonized by Plus XII tO twenty-two. Saints Emily de Rodat and Maria Goretti were also beatified by the present Holy Father. Among the canonized we find seven confessors and one martyr; one bishop, one priest-founder of a religious insti-tute, three foundresses of religious congregations, and three who attained sanctity "in the world": a middle-aged woman, a young woman, and a girl. Four are Italian, two French, one Spanish, and one from Latin America. Five belong to the nineteenth century, while the fifteenth, seventeenth, and eighteenth centuries each claim one. St. Jeanne de Valois (1464-1504) Jeanne de Valois, daughter, sister, and wife of kings, seemed to be so high-placed only to be the more cruelly humiliated and cast away. Her birth was a bitter disappointment for King Louis XI who already had a daughter and wanted a son who could succeed him. Misshapen by nature, she was sent away from the court and brought up by strangers. When still a child, she was bound by a political marriage to the young Duke of Orleans who detested her and who, when twenty years later he l~ecame King Louis XII, had his marriage annulled, makin,g of the rejected queen an object of public ridicule. But the greater her disgrace in the eyes of the world, the more clearly stands out her moral nobility and spiritual greatness. The "royal Cinderella," as she has been called, showed no bitterness, no morbid self-pity; she accepted everything with sincere humility, deep love for God and for men (including her husband for whom she never ceased praying and who became one of the best-loved kings of France), and whole-hearted application to the work God had given her. The king, on sending her away, made over to her the duchy of Berry, and during the six remaining years of her life she resided at Bourges, her capital, administering the duchy with such success that she earned from her pebple the title of "the Good Duchess."A'mid 229 J. PUTZ Review [or Religious the splendor of her court she secretly practiced" the most rigorous penances. In 1500 she realized a long-cherished project, the founda-tion of an order'of the Blessed Virgin, the Annqnciade. Its members were to take as their means of sanctification the imitation, the repro-duction of M~ry, by practicing, her "Ten Virtues" as found in the Gospel. She herself, though continuing to rule the duchy, made her religious profession and wore the habit under her worldly d~ess. She completed her work by founding a Third Order, the "Order of Peace,': whpse members, living in the world, were to work for peace and reconciliation. The Order of the Annonciade flourished for centuries, but was almost destroyed by the French Revolution. At ' present it has a half dozen bouses in Belgium, France, and England. When Joan died in her fortieth year she was immediately venerated as a saint. Her cult grew, miracles multiplied, but she was not formally beatified until 1742. Pius XII solemnlY proclaimed her a saint on May 28. In his homily the Holy Father stressed the saint's work for the promotion of peace; in heaven, he said, she continues to pray for the extinction of hate and for fraternal concord, so that the nations may form one great family, striving with united for~es to ensure prosperity and peace for all. On the following day, in an address to the numer-ous French pilgrims, he described the spirituM characteristics of the saint--spirit of faith, devotion to the Mother of Jesus ("an infallible test of the true. Christian"), union with Jesus in suffering--and gave her as an example tO French Catholics, particularly to the women of France "on'whom in the present crisis devolves a mission 9f supreme importance." SI. Mary Ann of Jesus (1618-1645) Born in Quito, Ecuador, of Spanish parents, this Saint of Latin America--"the Lily of Quito"--showed a precocious attraction for the things of the spirit. She took the three vows at ten and lived the live of a solitary in a room of her sister's wealthy home,.leaving it only to go to church and to visit the poor and sick. She practiced heroic austerities and was favored with sublime prayer. In 16~}5, when Quito was visited by earthquakes and a deadly plague, she publicly offered herself as a victim for the sins of the people. The skourge abated, but she was seized with a malady-which put an end to her short but intense life. She was only twenty-six. 230 September, 1~51 CHRISTIAN HEROES She was beatified by Plus IX in 1853. In 1946 "the Parliament of Ecuador declared her a "national heroine." Her canonizatiorl, the last of the Holy Year, took place on July 9.In his homily the Holy Father stressed three aspects, of her life: (1) immaculate purity; (2) ardent charity, which she practiced towards every misery, spir-itual and material: when she was powerless to help, she tried to obtain help from God by prayer, expiation, the offering of her life; (3) extraordinary austerity, inspired by the desire to expiate the sins of men. She offered herself as a~victim for the salvation of others. This question of mortification needs special stres.sing in the mod-ern world, the Pope said. "Not all, especially nowadays, understand this kind of penance; not all esteem it as they should. Many of our contemporaries despise it or neglect it. Yet we should know that for our fallen nature penance is absolutely necessa.ry. Unless y.ou do pena.nce you will all perish. Indeed, nothing heli3s more efficaciously to conquer our passions and to subject our natural instincts to the control of reason. And when we have won a victory over ourselves it is sweet to exp'erience a divine joy which surpasses' al'l earthly pleasures." In his allocution to pilgrims the following day, the Pope re-marked that we "who. live in the full light of the deyotion of the Sacred Heart may well admire the holy intuitions of this innocent victim who, at the beginning of .the seventeenth century, was led to make of reparation the centre of her spirituality." St. Vincent Strambi (1745-1824) St. Vincent Strambi was one of the great bishops and upholders of the Church's independence in the face of totalitfirian rulers. After being ordained a priest in 1767 he was received into the Passionist Congregation by St. Paul of the Cross himself. He was a great preacher of missions and director of souls (among his penitents was the Blessed Anna Maria Taigi) and filled high offices of authority in his order. In 1801 he was, much against his will, appointed bishop of Macerata and Tolentino by Plus VII. He administered his dio-cese with the zeal of another Charles Borromeo. Preoccupied chiefly with the formation of the clergy and the diffusion of religious in-struction, he brought about a religious renewal among priests and laity. When he refused to take the oath of. allegiance to the ustirping regime established by Napoleon he was expelled from his diocese in 231 J. PUTZ Review for Religious 1808 until the fall of the Emperor in 1813. In 1823 he resigned his see and died soon after in Rome, where Pope Leo XII had made him his confidential adviser." In the midst of his intense activity and the vicissitudes "of his life he never relaxed anything in the austerity of his private life. He was beatified, in 1925 and canonized on June 11, 1950. In his homily the Holy Father made an application to the countries where the Church is being oppress, ed by the secular power: "The Church can be attacked, she cannot be conquered . If under the present difficulties--which in some countries seem graver than those referred to above--some souls are disconcerted, wavering, or anxious, they should remember the promises of Jesu~ Christ and try to imitate the invincible fortitude of this saint as well as. his other virtues." St. Anthony Claret (1807-1870) St. Anthony Claret was another great priestly figure of the nine-teenth century. Born at Salient in the north of Spain, he practiced for a tired his father's trade of cloth-weaving, but eventually was able to follow his heart's desire and join the seminary of Vicb. After his ordination in 1835 and a few years of pa.rish work, he conse-crate'd himself with extraordiriary success to ~he preaching of missions and retreats throughout Catalonia. His zeal inspired other priests, and in 1849 he founded the Congregation of MissioriarySons of the Immaculate Heart of Mary, commonly kno.wn.as the Claretians. The same year he was sent to Cuba as Archbishop of Santiago, to b~ing about there a much-needed reform: In this post of exceptional diffi-culty he achieved considerable results, though several attempts were made on his life. After seven years he was recalled to Spain to become the confessor of Queen Isabella II. In the revolution of 1868 he was banished from his country. He attended the Vatican Council where he spoke eloquently for the definition of papal infalli-bility. Soon after, .on Oct. 24, 1870, he died in France. Besides preaching some 10,000 sermons, h~ was an ardent apostle of the press. He wrote 120 books and pamphlets (144 volumes), founded religious libraries, and promoted the diffusion of good literature. He was beatified in 1934 and canonized on May 7, 1950. The work of this powerful apostle is carried on by the Cl~iretians who in 1949 celebrated their first centenary. They count at present Over 4,000 members in 24I establishments all over "the world. Their chief work is education, missions and retreats, and the aposfolate of 232 September, 1951 CHRISTIAN HEROES the press. In Rome they ~un the Poliglotta Press and edit the Corn-mentarium pro religiosis et missionariis. St. Emily de Radar (1787-1852) .' At the beginning of the nineteenth century, the French Revolu-tion and the long wars that followed it bad accumulated in France and Europe immense miseries, spiritual and material. Then Provi-dence raised up numerous saints who, impressed by the needs of their time, devoted themselves to remedy them. Rarely in the history of the Church do we find so many religious institutes springing up every-where, dedicated to the prac.tice of various v~orks of corporal and spiritual mercy. In this providential reconstruction women had a prominent share, and this explains why among the saints beatified or canonized by Pius XII there ale so many religious foundresses of this period. Emily de Radar was beatified by Plus XII in 1940 and canon-ized by the same on April 23, 1950. Born of an aristocratic family, she was brought up by pious parents but passed through a period of worldly frivolity and religious indifference. Converted during the Holy Year of 1804, she decided to consecrate'her life to the service of God. After trying several religious institutes, her visits to the poor made .her realize the great need for Catholic schools: She immedi-ately set to work: she had found her vocation. With three other young women she opened a school, and thus the Congregation of the Holy Family was started. Today it has over 200 houses in Europe and South America--schools, orphanages, hospitals. The H01y Father, in his homily, stressed the precious services rendered by reli-gious institutes of women: "When we consider the admirable enterprises of this saint, when we remember what her congregation and the other religious institutes --almost innumerable--have accomplished, we cannot but proclaim that the Church and civil society as well owe very much to all these religious women. If we did not have them, if God by His heavenly inspiration did not continually and in every century raise them up, if He did not sustain them by His help, who could fill their place? Let all, then, learn to praise them as they deserve, to help them as they can . And may the religious zealously and strenuously strive to live up to their lofty vocation." Saints Bartolomea Capltanio and Catherine Gerosa (1807-1833) (1784-1847) , Bartolomea Capitanio and Catherine Gerosa founded together 233 the Italian Sisters of Charity, after the model of St. Vincent de Paul's Sisters of Charity. Bartolomea began her apostolate at fourteen, teaching, little children. Soon her simple and strong personality drew to her, as to their mother, the young, the poor and afflicted of her little town of Lovere. Seeing the need to organize the ever-increaging work she joined forces with another saintly worker of the same town, Catherine, who was twenty years her senior and had already opened a hospital for the sick poor. Bartolomea died a few years later, at the early age of twenty-six. Her spiritual notes and instructions, as well as a considerable number of her letters, have been published. She left the young institute to the care of Catherine (who had ~dopted the name of Vincenza), an extremely bumble woman, yet an efficierit worker and able organizer. During the fourteen years she had still to live, the congregation continued to expand 'rapidly Today it counts nearly 9,000 religious in some 500 houses. Barto-lomea' was beatified in 1926; Vincenza in 1933T.hey w~re canon-ized together on May 18, 1950. St. Maria Gorettl (1890-1902) No canonization war received with greater enthusiasm than that of the humble village girl who died for the preservation of her purity The ~tory of her martyrdom is. known to all our readers. Her popu-larity and the speed of her promotion to the highest honors of the Church ha~e been equalled or surpassed in modern times only by the Little Flower of Lisieux. Her cause was introduced in 1938 and concluded in 1945. The solemn beatification took place on April 27, 1947, and she was canonized three years later, on June.-24, 1950, forty-eight years after her death. " (Teresa of Lisieux died on Sept. 30, 1897, was beatified on April 29, 1923, and canonized on May 17, 1925. Aloysius Gonzaga was beatified fourteen years after his death, bu~ another' centu.ry passed before be was canonized.) In spite of her youth, Maria was capable of heroism, and this heroism showed itself also in the pardon accorded to her miarderer on her' deathbed and in. the superhum~t'n patience during the extremely painful operation by which,the doctors tried to save her, withou~ putting her to .sleep,. D.ur!ng those tWO. long., hours Mary never complained but kept invoking the help of the" BlEssed Virgin. For .sush :heroism, the Holy F,a.ther point.e~d 6ut.in his allocution, the 23~, September, 195 I. CHRISTIAN HEROES courageous child had prepared herself by the daiIy practice of the virtues of her state: "It is true that it is above all purity that sho~e in Maria Goretti's martyrdom, but with it. and in it the other Christian virtues tri-umphed as well. In that purity there was the most evident and sig-nificant affirmation of the perfect control of the soul over matter. In that supreme heroism, which cannot be improoised, there was the tender, obedient," and active love for the parents, self-sacrifice in the hard work~of every day, poverty accepted in an evangelical spirit and sustained by trust in Providence, religion embraced tenaciously, deepened ever more, ~ssimilated as a treasure of life and nourished by the flame of prayer; the fervent desire of ~lesus in the Eucharist, and finally--the crown of charity--the heroic pardgn accorded to the murderer. All this forms a rustic garland, so dear to God, of country flowers which adorned the white veil of her First Com-munion and, shortly after, her martyrdom." The beatifications of the Holy Year, like the canonizations were eight in number. The total of those beatified by Pope Plus XII at the end of 19~0 is now'fifty-two; this includes the twenty-nine Chinese martyrs. Among those beatified during the Holy Year we find one priest, one boy, and six foundresses of religious institutes: two Spanish, two Italian, and two French. All except one belong to the nineteenth century. Blessed Vincen~ Pallo~f~ (1795-f850). Vincent Pallotti was the apostle of Rome at a difficult period of histo~-y.-After his ordination and a double doctorate at the Sapienza, he started his apostolate among students and it soon became clear that Rome possessed a holy priest. He was made confessor of Propaganda College, the English College, the Roman Seminary. On all of them his influence was deep. But his preferences were for the poor and the workers; he opened professional and agricultural schools and pro-moted t?ade unions. His zeal embraced the whole world and every" need, spiritual and material. For this "universal" object he founded the Society of the Catholic Apostolate (a society :of" priests and Brothers living in common without public vows, commonly known ,235 J. PUTZ Reoieu~ for Religious as the Pallottines) and the Sisters of the Catholic Apostolate. He took a special interest in the conversion of England and sent to that country some of his best men. He realized, more than a century ago, the immense possibilities and the necessity of the lay apostolate, and Pius XI called him a "pioneer and precursor of Catholic Action." This bold and far-sighted planner was a man of incredible humility, considering himself an obstacle to the progress of the Church and accepting without a word the most cruel humiliations. He always kept his predilection f.0r the poor, giving them even his own clothes. He died of a pleurisy contracted as a consequence of giving his mantle to a destitute man. Today 3,550 Pallottines and 2,900 Sisters of the Catholic Apos-tolate continue the saint's w.ork in many countries. Vincent's beati-fication was the first of the Holy Year; it took place on Jan. 22, exactly 100 years after hi~ death. A few days later the Pope pointed out "this great sacerdotal figure" as an example to parish priests and preachers. His sermons, he said, were always directed to the ur~uro nec.essarium; his confessional was eagerly sought after and surrounded with extraordinary effects of grace, "May his spirit be renewed in every one of you and infuse into your apostolate that .irresistible glow of love which the doubting, uncertain, and suffering men of today need so much." Blessed Marla-Soledad Torres y Acosta (1826-1887) Maria started her apostolate of charity in a squalid quarter of Madrid. With her h'elp the parish priest opened a hospital for. the ¯ poor. Eventually she had to take charge of the whole work, which she stabilized and perpetuated by founding a religious congregation, the Servants of Mary. Her institute during her lifetime spread from Spain to South America. At present it counts some 1,600 members. She was beatified on Feb. 5, 1930. Blessed Vincenta-Maria Lopez y Vicuna (1847-1890) Vincenta was born of an aristocratic Spanish family. Sent to Madrid for her higher education, she became interested there in the charitable Work of her aunt who, shocked by the difficulties and dangers of the lives of domestic servants, had opened a home for them. Vincenta refused a brilliant match arranged by her father and 236 Se'ptembe¢, 19:51 CHRISTIAN HEROES took the vow of chastity. After her father's death she used her con-siderable fortune.to develop her work of social assistance. To further extend it she founded the Daughters of Mary Immaculate for the protection of young women. At'present they number, nearly 2,000 members in various countries. Their hostels for domestic servants, working-girls or students provide for the material and spiritual wel-fare of well over 30,000 young women. She was beatified on Feb. 19, 1950. Blessed Paola-Elizabeth Cerloli. (1816-1865) Like Vinc~nta she was bor~ of a noble family in Northern Italy. But at nineteen, not feeling called to the religious life, she followed the wish of her parents and married an old widower,Count Buzecchi, forty years her senior. After the death of her husband and three children she was then tl~irty-eight--she consecrated her time and income tO assisting the poor peasants and farmhands of the sur-rounding country. In 1857 she started a religious community, the Sisters of the Holy Family of Bergamo, for the care of orphans and morally abandoned children. In 1950 this institute counted some 300 members. The saint was also instrumental in founding a simi-lar institute for men, the Priests of' the Holy Family. The brief of canonization compares her with St. Joan de Chantal, an angel in four states of life, girl, wife, widow, and religious. She was beatified on March .19, 1950. Blessed Maria ~e Mattias (1805-1866) Maria was born in the diocese of Gaeta. When she was seven-teen, she attended a mission preached by the Blessed Gaspar del Bufalo, a friend of Blessed Vincent Pallotti and founder of the Mis-sionaries of the Most,Precious Blood. The holy preacher to whom she opened'her soul recognized her great gifts and entouraged her to take up the apostolate of Christian education. She began by gath-ering the little children in her parental home, and in 1834 she founded.a convent and a school. This was the beginning of the in-stitute of the "Adoratrici" of the Most Precious Blood, which today has 215 houses in Italy and 172 in other parts of the world, with some 2,000 members. She was beatified on Oct. 15, 1950. Blessed Anne-Marie Javouhey (1779-1851) The child of a farmer of Burgundy, she grew up amid the horrors 237 J., PUTZ Reaie~a [or Religious of the French Revolution, sometimes risking her life. in order to hide and assist priests. At nineteen she vowed perpetual Chastity and re-solved to dedicate her life to the education of children and the care of the sick. As other girls joined her in the work she c~nceived the plan of her new congregation, the Sisters of St. Joseph, called "of Cluny" from the place of the mother house. Soon she made founda-tions in mission countries, Africa, Pondicherry, French Guiana, and others. A woman of remarkable energy and intrepid enterprise' (King Louis Philippe said admiringly, "Madame Javouhey, that's a great man"), she frequently visited her missions, worked for the abo-lition of slavery and for the organization of public services in the colonies. From the start she realized the necessity of forming an indigenous clergy, and in order to accelerate the work she brought to France the first Negro candidates for the priesthood. Today the Sisters of St. Joseph are found in every part 'of the world, working in schools, hospitals, leper asylums, and other institutions. She was beatified on Oct. 15, 1950. Blessed Marguerite Bourgeo~ys (1620-1700) This blessed takes us back to the seventeenth century and to the great period of ~he Canadian missions. John de Brebeuf was mar-tyred in 1649. The Ursuline missionary-contemplative Marie de l'Incarnation died in Quebec in 1672. Margaret, who had first tried the contemplative life with the Carmelites and the Poor Clares in her native France, found bet vocation when .the Governor of Montreal came to France and tried to find a teacher for the children of the French garrison of Ville-Marie. She offered her services and in 1653 reached Montreal, where she .began bet apostolate by teaching the catechism and visiting the sick in their huts. In 1658, with some companions whom she bad brought out from France the previous year, she founded the congregation of Notre Dame of Montreal, which became an important educational factor for the whole of Canada and. since 1860, for the United States (at present 5,680 members). Margaret, "schoolmistress and itinerant mis~iorlary,;' opened mission schools ff;r Indian girls, many of whom became zealous Sisters in the institute. Thus, as the Pope remarked in his address to Canadian pilgrims, she realized among the "savage" Huron girls what St. Francis de Sales had dreamt of for France, a congrega-tion of non-cloistered "secular daughters." She was beatified on November 12, 1950. 238 September, 1951 JOY IN HEAVEN Blessed Dominic Savlo (1842-1857) Blessed Dominic, beatified on March 5, is the Benjamin of the confessors raised to the altars, since he was not quite fifteen when he died, The son of a modest but deeply Christian family, he very early showed a special earnestness and resoluteness in his piety. His First Communion, which he made at seven, .definitely set his will towards the goal of sanctity. In 1854 be was received by Don Bosco into the oratorio of Turin. Here~ under the saint's direction, and fos-tered by special graces, his spiritual life developed rapidly; but after two ~,ears a sickness obliged him to return to his home, where he died a few months later. His life was written by Don Bosco him-self. The decree declaring the heroism of his virtues was published in 1933. The beatification of this youthful masterpiece of divine grace--grace to which he corresponded heroically--will no doubt encourage new studies on the nature of sanctity and .especially of children's sancti~j'. [EDITORS' NOTE: The foregoing article is reprinted with permissi'on from The Clergy Montfily, a magazine published in India.] Joy in I-le ven Richard L. Roone}', S.J. "I,"HE Archangel in charge of the recording angels had called a | meeting of the guardians of religious. They were met in his skyey office high above the battlements of heaven. "Quite frankly, Angels, my aide~ are alarmed about this whole business," he was telling them. "The number of 'kicks,' complaints, criticisms and 'crabs' that l)hey have to record for religious is prepos-terous. They're even wondering if these human creatures will be satisfied and happy and content even here in heaven! They have found one hope, however. They feel sure that Purgatory will take all the 'kick' out of these kickers. You Gufirdian Angels do a grand job keeping your charges living up to their vows and observing the larger phases of religious life. It is time, nevertheless, that you went to work on this complaining business. It may relieve their human ,239 RICHARD L. ROO~EY feelings to 'crab' 6r to criticize. It doesn't add to God's glory or to their own merit however. So please, now, to business." The guardians, your own among them, filed out of' .the office and winged earthward. They came, each of them equipped with ques-tionnaires like the following. How would you answer them if your Angel Guardian put one before you during your next examen? 1. Do you find yourself complaining quite often? 2. What (or who!) is your p, et peeve? 3. Do you "kick" about the weather, the c~ll or the room you have, the house you are'in, the food you are. served, the work you have been assigned? 4. Do you ever "crab" about superiors or their directions? 5. Have you a few kindred souls with whom you get together to talk over the way things would be done if you were in charge of them ? 6. Do you firm., and vocalize about it. that the community is a pretty dull, or annoying lot? 7. Are you heaping up a pretty severe judgment for yourself by judging others . . . and that right severely? 81 There is a lot of sense in the little poem: Two men looked through prison bars; One saw mud, the other sad2 stars. Well, what do you see in the rest of us most of the time? 9. Do you accept the ordinary pin-pricks of daily religious life without grumbling? (Remember you are an especially selected member of a thorn-crowned Head.) i0. Can you put all of ydur words and remarks, both within the community and to externs, on the paten of tomorrow's Mass and know that they will be acceptable to God? After scanning the above you may find that it will be a good thing to take your particular examen off such undisturbingly im-practical generalities as humility or charity at large and particularize it at least on keeping a strict guard over your "kicking" tongue. If so, go to it! The best of success to you! Know that you will be a delight not only tO your. fellow religious but to the saints and angels and God Himself as well! 240" Passionist:ic Spiri!:uali!:y' Fidelis Rice, C.P. IN THE INFINITE 'reaches of eternity, within the secret council of the Godhead, the Wisdom and Love of God decreed that all of creation should reflect in.a unique way the ineffable perfections of God. Because God is absolutely infinite--that is, without any limits whatever--no creature could ever exhaust the divine imitabil-ity. Since the Second Person of the Blessed Trinity, the Word, is the Exemplar of all that is, iherefore each creature is called upon in its own distinct way to teA1 us a little more. about the vastness, the goodness, and the perfection of the Word. "All things were madd by Him, and without Him was made nothing that was made." In the realm 6f souls our reflection of the divine holiness is to be accomplished by a participation in the Christ-Life. For each soul is predestined from all eternity to manifest in time the eternal Holiness which is God. There is a uniqueness, then, in the destiny of each soul. "Blessed be the God and Father of our Lord Jesus Christ, Who" has blessed us with spirftual blessings in heavenly places, in Christ. As He chose us in Him, before the foundation of the world, that we should be holy and unspotted in His sight, in charity." (Ephesians, 1:3, 4.) Here the great Apostle reveals to us that our holiness is planned and designed in eternity, but according to the pattern of Christ. We are all called to mirror the holiness of the Word, but each soul in a different way. There is, then, a wondrous blending of unity and multiplicity in the pattern of holiness. Christ is one, the unique model of all holiness. But because of the limitations of our nature, because of our very creaturehood, each one of us will reflect the holiness of Our Lord in a so.mewhat different way, just as various artists in painting the same subject will use a varying contrast, a difference of light and shadow, greater or less use of chiaroscuro, until the completed can-vases, while basically the same, will manifest vast differences. ¯ So it is that in the various religious orders and societies, approved by the Church, there is a difference of pattern in the design for holi-ness, although, all are dedicated to the one supreme objective--the perfect imitation of Christ. The essential spirit of each religious order is imparted, first of 241 FIDELIS RICE Retaieto for Religious all, by the founder of the institute. Plus XI clearly states that the various founders of religious institute~ were guided in a special way by the Holy Spirit, who seeks alway,s to communicate to the Mysti-cal Body.of Christ the graces purchased by His precious death upon the cross. "For what else did these most illustrious men do in founding their institutes, but obey the inspirations of God? There-fore, let their followers show forth in themselves those characteristic traits which the Founders imprinted upon their several Institutes. Let them not fail in this." ("Unigenitus"; A.A.S., Vol. XVI, p. 133.) The key, therefore, to essential Passionistic spirituality is to ,be found in the life and work of Saint Paul of the Cross, and Passion-ists can be called "Passionists" only insofar as they adhere to his teachings and to his spirit. ° It was the unique genius of Paul of the Cross to combine in one Rule the best features of two apparently contradictory or opposing states of life. For he willed that his religious should cherish and foster the contemplative observance of choir monks, centering all in the liturgical, prayer of the Office, while at the same time fulfilling the sublime vocation of a missionary apostolate. In the mind of Paul of the Cross, missionary activity should flow spontaneously, from the life of prayer, thus verifying the teaching of St. Thomas Aquinas that the function of the apostolate is "tradere contemplata aliis"--"to'give to others the fruits of contemplation." Because the consuming passion of the life of St." Paul of the Cross was love for the sufferings of 2esus Christ, he wanted his religious to share, in a special way, in the redemptive sacrifice of Christ. That is, the Passionist vocation is in a special way a vocation to a life of reparation. The inmost spirit of the Passionist Rule is the spirit of solitude, penanee, poverty, and prayer. In unforgettable language Saint Paul of the Cross described the spirit of his institute in a cir-cular letter which he sent to his religious for the Feast of Pentecost, May 2nd., 1750. "Most beloved Sons, you are dead, and your life is hidden with Christ in God. Therefore, as dead to all that is not °God, r~main in the most perfect detachment from all created things, in true poverty of spirit, and in detachment from sensible consola-tions. Assisted by the most holy grace of ,lesus, direct all your zeal to this end--to be recollected in interior solitude; then you will become true adorers of the Sovereign Good in spirit and in truth . Never withdraw from the holy Wounds of Christ, but ever strive 242 September, 1951 PASSIONISTIC SPIRITUALITY more and more that your souls become hidden in and entirely pene-trated by them." (Letters: Vol. IV, p. 226.) Saint Paul of the Cross was one of the most privileged of mys-tical souls with which God has endowed the Church, but his very mysticism bore the unique character of his vocation. For although he received the grace of the "transforming union" or "mystical mar-riage"-- the highest grace of mystical prayer--at a very early age, yet for over fifty years thereafter he continued in the profound suf-ferings of the Dark Night of the Soul, a fact which Father Garrigou7 Lagrange, O.P., calls almost unique in the lives of the saints. Because Paul of the Cross was a master of prayer, it is not to be wondered at that he should insist upon a spirit of constant prayer. for his followers. In his Rule .he states in the very first chapter that "Prayer is one of the chief objects of our Congregation." The Passionist Rule, as it is observed in our monasteries in the United States today, prescribes, beside the Divine Office, two hours of mental prayer each day--an hour in the morning, and an hour in the eve-ning. Including the time that is devoted to the Divine Office; the Passionist, in the daily routine of his monastic day, spends close' to five hours in prgyer. One of the features of Passionistic prayer is the observance of the night office, for Passionists rise ea, ch morning at two o'clock to chant Matins and Lauds before the Blessed Sacrament. This observ-ance lasts one hour, and the religious retire again at three, to rise once more at dawn for Prime and Tierce. This nocturnal observance is one of the cherished ~xercises of the penitential spirit bequeathed by Saint Paul of the Cross to his sons. In order that the spirit of prayer might always be preserved in the Congregation, Saint Paul prescribed most riggrously that Pas-sionist monasteries be built always in places of solitude, and with every safeguard that the spirit of solitude be not violated nor intruded upon. Hence, even when built in the heart of large cities, there must always be sufficient acreage for gardens and privacy for the solitary walks prescribed by rule. Many of our 'American "monasteries are now surrounded by teeming residential sections, but when they were built they stood alone, in the midst of solitude. The cities have come to the monasteries, but because of the wise prescriptions of the Rtile the spirit of solitude is still safeguarded. However, the spirit Of the Passionist Congregation is also a spirit of apostolic activity. As the present Superior General, Most Rev- 243 FIDELIS RICE Review for Religious erend Albert Deane, C.P., wrote in a recent circular letter to the Con-gregatio, n: "On the day it would cultivate the contemplative life ex-clusively, the Congregation would cease to be what 'our Holy Founder instituted. Nor could he be said to be a good Passionist, who without legitimate cause would'omit to do what he could to attain the apostolic end of our Congregation, although under the p.retext of better caring for his own salvation. His religious profes-sion demands otherwise of him." In this ~ame document, our Most Reverend Father General has beautifully epitomized the heart of the Passionistic spirituality: "For our spirit, dearest Sons, can be likened to a'pyramid, made of the spirit of prayer, penance, and the apostolate, but held together by the fire of devotion to Christ suffering, having no other apex to which the ~exalted Passionist life converges than our configuration to Christ Crucified, whom we must preach by word and by example: 'We preach Christ and Him Crucified.' This is what the words say which we carry engraven over our hearts; this reminds us, if perhaps we sometimes forget, of our very name itself, for we are popularly called 'Passionists'.',' . The primary work of the Passionist Congregation, then, is a reflection of its inner'spirituality--the preaching of popular mis-sions, and retreats to the clergy and religious, as well as to the laity. Passionists conduct no schools, except for the education i~f their own subjects. They engage in parish work only as an exception, and for clearly defined needs in a particular locality. They are above all, preachers of the Passion of 3esus Christ. To this end they take a special vow to promote in the hearts of others, devotion to the Pas-sion of oresus Christ. They do, however, engage in foreign mission work, and they are likewise working among the colored in the South. Saint Paul of the Cross was a staunch advocate of enclosed re-treats for the laity. Cherishing, as he did, the wonderful advan-tages of holy solitude, it is not surprising that he would wish to share these advantages and blessings with the laity. And so he wrote into his Rule the prescription that in each monastery rooms should be provided for lay retreatants. In most of our American monasteries we have special retreat houses for men, and a flourishing retreat movement is an integral part of our Passionist family life. Because Paul of the Cross was consumed by the love of Jesus Christ Crucified, he burned with the desire to bring the riches of His death to the souls of men. He was profoundly aware of the 244 September, 1951~ . PASSIONISTIC SPIRITUALITY meaning of the priestly vocation, and realized fully that a p~iest must always communicate to the Mystical Body 6f Christ the life purchased by the sufferings of Ouk Lord. But he knew, too, that the most fruitful apostolate is that which is the overflow of prayer, rather than a substitute for it. Hence it was that no matter how gifted a missionary might be, no matter how eloquent on the mission-platform, and no matter how great the demand for his services, Saint Paul of the Cross rig- . orously required that each missionary spend a suitable portion of.the year in the solitude and quiet of the monastery. Although far wise to reduce this to a mathematical formula, the founder of the Passionists imposed upon superiors and missionaries alike the obli-gation to. preserve always in the Congregation this time of with-drawal each year from the exhausting round of activity. The demands for our services have grown with the years, and no fixed calend,a'r tan be drawn up which governs the exact details, but our superiors still strive faithfully and sincere!y to arrange the schedule for-each mis-sionary, so that he may spend a sufficient amount of time.withih the mona.stery each year. Saint Paul of the Cross was profoundly con-vinced that "one Religious who is a. man of prayer and lover of solitude will bring forth more spiritual fruit from the ministry than a thousand others who are not such." (Letters, Vol. III, 418.) .,. The Passlonlst family circle is made up of three groups: tl~e priests, the students or clerics, "and the lay brothers. ¯ In most of our American monasteries all three groups are found, for most of our monasteries are also houses of study, or seminaries in which young men are preparing for the priesthood. Our lay brothers, a shitable time after the profession of their perpetual vows, are admitted to }ecreation with the priests; and the recreation is common ~f(;r these two groups. The students remain always in a separate r~creation. The day's horarium.is divided bet.ween prayer and study. The day is spent in silence, except for the two brief recreation periods each day. Three days of fast and abstinence are .observed each week-- Wednesday, Friday, and Saturday. During the entire time of Ad-vent and Lent, Sundays included, abstinence from meat is the rule within the monastery. Paul 6f the Cross does not want his sons to forget that t,hey must bd men of penance. For this reason, too, san-dals are worn on the bare feet, and a ro.ugh woolen h.abit is worn the year round. The Passionistic ideal;" then, is to share as intimately as possible 245 FIDELIS RICE. o in the sublime virtues which shone, forth so re~splendently on Cal-vary. It is the vocation proclaimed so sublimely by Saint Paul the Apostle in his Epistle to the Colossians: "Who now rejoice in my sufferings foF you, and fill up those things that are wanting of the sufferings of Christ in my flesh, for His body, which is the Church." (Colossians, 1:25.) So it was that that other P~ul, Paul of the Cross, sought to instill into his followers a burning love for the Crucified, a love which would make them conform their own lives by penance, solitude, prayer, and poverty, to the ideals of Calvary, that they might go forth to preach the glories and the ignominies of the Cross of Jesus Christ. The r~assionist spirit might be summed up in one word, "Stau-rosophy," for "stauros" is the Greek word for the Cross.; ,The sons of Paul o'f the Cross must remain ever absorbed by the wisdom or the "philc~sophy" of the Cross. Wisely has the Church selected the Introit for the Mass on the Feast of St. Paul of the Cross: "Christ0 confixus sum cruci." . "With Christ I am nailed to the cross." (Ga-latians, 2:19.) No other words of Sacred Scripture could epitomize more simply the ess.dntial spirit of this great lover of the Crucified, and of the form of life which he has bequeathed to his sons, who wear that habit of mourning first shown to Paul of the Cross in vision, by the Mother of God, when she told him to founc~ an order whose members would devote their lives to mourning for the sor-rows of Her Son. OUR CONTRIBUTORS F1DELIS RICE, writer and missionary, is on the mission band at St. Joseph's Passionist Monastery, Baltimore, Maryland. J. PUTZ, the editor Of Clergg Month-lg and author of Mg Mass, and P.DE LETTER, a recent contributor to American ecclesiastical journals, teach at St. Mary's theologate, Kurseong, India¯ RICHARD L. ROONEY is on the Queen's Work staff and editor of Action Now. C.A. HERBST and CLARENCE MCAULIFFE are o£ the faculty of St. Mary's College, St. Marys, Kansas, . , : PLEASE NOTE CAREFULLY The sul~scripfion pHce of REVIEW FOR RELIGIOUS is now: $3.00"per year for" Domestlc.end ,Canadian subscriptions; $3.35 per yeer for all for~icjn subscrip-fio'ns. For further de~'ails please see inside back cover. 246 Modesty C. A. Herbst, S.J. ~4 ~t man's looks betray him: a man of good sense will make him-self known to thee at the first meeting; the clothes he wears, . the smile on his lips, his gait~ will all make thee acquainted with a man's character" (Ecclus. 19:26, 27. Knox version). This' is the Holy Spirit's description of modesty. Following His directive, St. Thomas teIIs us that this virtue is concerned with "the movement and actions of the body; that all of them, those gone through in fun as well as the serious ones, may be decent and proper." (Summa Theologica, 2-2, q. 160, a. 2.) Dress is also included. The cardinal virtue of temperance controls pleasure coming from food, drink, and ' sex, the most difficult things. Modesty, a part of temperance, takes care of the lesser. A subordinate in the hierarchy of authority takes ~in hand the little things. Modesty is therefore not at all the s~me thing' as chastity or purity, as many quite commonly presume, though it may be more or less connected with it. Not one's interior only but one's exti~rior, too, must be con-formed to the .norm of right reason. The easy and evident way for u_s to strive to achieve this is "to imitate Christ. "We must look with the eyes of the soul on that wonderful leader 'beautiful above the sons of men' in the ordinary dress He wore at home . Erect of body and with perfect composure His gait was neither too hurried nor too slow. There was nothing soft or effeminate, not.hiog childish or lackadaisical about Him. Neither could anything gloomy or exasperating be seen in Him, nor was there any assumed gravity. He was not singular nor finicky. His Whole being breathed sweetness, joy, kindness, majesty." (Le Gaudier, De Perfectione Vitae Spirit-ualis, Pars IV, caput xviii.). "Jesus began to do and to teach," first to tellus by His exampl~ how tb act, only later by His words. Our exterior modesty should be, as His, for the glory of God. "So let your light shine before men, that they may see your good works, and glorify your Father who is in heaven." It should make us more like God. "God cre~ ~ted man to his 6wn image: to the "image of God he created him." Man's likeness to God is, of course, in the soul, in his interior sanc-tity, but that interior dignity and perfection should shine forth, so 247 ¯ C. A. HERBST Reoeiw [or Religiou~ to speak, in the ,modesty of his exterior as through a beautiful and translucent garment, or as the rays of the sun make a cloud all silver and gold. That "image of God" ou.ght somehow to be mani-fested in the body. "Because man's body alone of all the animals on earth is not bowed down to the ground but so made that it can better contemplate the heavens, it can justly be said' that it is made more t6 the image and likeness of God than the bodies of other animals, as Augustine says. But this must not be understood to mean that the image of God is in man's body but that the very form of. the human body represent.s the likeness of God in the soul like a trace." (S. Th., 1, ,q. 93, a. 6.) The importance of modesty in the life of a religious can hardly be overestimated. One is forced to this conclusion from reading the masters of the spiritual life and by noting the Christian tradition through the centuries. The statement made by St. Ambrose in this matter is a classic. "Modesty must be preserved in our very move-ment, carriage, and gait. Our habit of mind is reflected in our body. "Thence the real man hidden away in the heart, the light-headed 6r careless or turbulent man or, on the contrary, the more serious or steady or more upright or more mature man can be ascertained. The motion of the body, therefore, can be called the voice of ~he soul." (De Of Kciis, I, 18.) St. Bernard says: "Modesty is the greatest of orn~ments in reli-gious, especially in the young. This is so true that if they do not cherish it there is little hope of their becoming good or virtuous . Lack of external composure in the body is a sign of an indevout mind." (Ad Quid Venisti?, xvii.) Knowing how very closely bod~r and soul are united we are not surprised to hear Hugh of St. Victor say: "As of a wandering mind are born disordered move-ments of the body, so when the body is brought under discipline the soul is made strong. Little'by little the mind within is brought to rest when under the watchful eye of dis.cipline its disorderly move- "ments are not allowed to flow to the exterior." (Delnstttuttone' " " Novitiorum, X.) So exterior modesty m.akes even a greater contri-bution to the soul than it does to the body. St. Vincent Ferrer'thought that a warrior of Christ could never free his soul from disorder if he did not first endeavor to rid his body of what was unseemly. From all of which it would seem to be clear why modesty is so much emph.asized in the beginning of the re!igious life: modesty of action and, incidentally, "modesty of words," which 248 Septernber~ 195 l MODESTY is silence. Even a beginner.can superimpose upon himself external order in the blessed hope that from it will come to him an array of spiritual goods. For it is easier to bring one's exterior under subjec-tion than one's interior. Mqdesty has a great apostolic value. St. Basil says that a virgin should "be seen by those who n~eet her to be such in habit and gait and every movement as to reflect the likeness of God. The eyes of those who behoId her should be incited to modesty and their mind instructed in virtue. They.should hold that sight in honor and, as I have said, show deference to and revere that image of God. As pictures of' satyrs make one laugh and as sad pictures fill the mind , with sorrow . so a virgin, since she is the picture--nay, the very reproduction--of purity, should even if merely seen raise the thoughts of those who behold her up to God . Avirgin, therefore, should be very careful to reproduce in herself the divine image in all t.hings." (Patrologia Graeca, 30, 714-715.) St. Francis of Assisi was most eloquent by his modesty. "It is told ofthe blessed St. Francis that he said one day to his companion, ~'Let us go to preach,' and so went out, took a turn in the city, and returned home. His companion said to him: 'BUt father, are v~e not preaching?' 'We have already preached,' he answered. That sedate-ness and modesty with which they, went through the streets was a very good sermon; it moved people to devotion and to contempt of the world, to compunction for their sins, .and to the raising of their hearts, and desires to the.things of the next world. This is a sermon in action, more effectual than one in w6rd.". (Rodriguez, Practice of Perfection and Christian Virtues, II, x, 1.) The very sight of the young Saints Aloysius, Stanislaus, John Berchmans, and Gabriel of the Sorrowful Mother raised men's hearts to God. The gr.eat in-fluence for good of the pr.ayerfuI, recollected, and modest bearing of those who love God is but another striking instance of "actions speaking louder than words." That is why St. Ignatius said: "And hence it will follow that, considering one another, they will increase in devotion and praise our Lord God, whom every one must strive to acknowledge in another as in His image." (Constit. S.d., P. III, c. i, n, 4.) .The beginner must practice modesty, and by doing so he exer- Cises himself in many virtues. But modesty is also the mark of the perfect. A well-ordered exterior shows great interior'perfectlon. The man who has achieved this has already made great'prggr.ess. One 249 C. A. HER,BST Reveiu~ for Relig:ous who habitually and gracefully has his exterior under control has gone far in the direction of self-mastery. If one has to be mortified to be decent, as our novice master used to say, what constant mortifi-cation and vigilance must be necessary .to put on the modesty of Christ. For this, persevering and almost heroic self-conquest is neces-sary. In this connection it might be well to remark that if we put ourselves through the discipline and took all the pains from a super-natural motive to put on modesty, which is the etiquette of God's ch.ildren, that the children of .the world do to don good manners in public and social life, our merit would i~deed be surpassing great and our spirit of sacrifice supreme. "And they indeed that they may receive a corruptible crown; but we an incorruibtible one" .(I Cor. 9:25). But then, "the children of this world are wiser in their generation than the children of light" (Luke 16:8). Founders of religious orders have given special directives, "rules of modesty," for regulating external deportment. As those given by St. Ignatius of Loyola even now influence many thousands of reli-gious, it might be well to give some of them here. "All must be exactly careful to guard the gates of their senses (especially their eyes, their ears, and their tongue) from all disorder, and preserve themselves in peace and true internal humility, showing it in silence when it is to be kept, and when they have to speak, in the circum-spection. and, edification of their words, in the modesty of tbelr coun-tenance, gravity of their gait and whole carriage, without any sign of impatience or prided' (Constit. S.d., P. III, c. 1, n. 4.) "In all out-ward actions there should appear modesty and humility, joined with religious gravity. The bead should not be turned this way and that way lightly, but with gravity, when need shall require; and, if there be no need, it must be held straight, with a little inclination forward, without leaning on either side. For the most part, they should keep their eyes dowfi, neither immoderately lifting them up, nor casting them now one way., now another. Wrinkles on the forehead, and still more on the nose, are to be avoided, that there may appear out-wardly a serenity which may be a token of that which is interior. The whole countenance should show cheerfulness rather than sadness or any less moderate affection. The lips must neither be too much. shut nor too much open. The pace should be moderate, without any notable has,.te, unless necessity should require it; in which case, however, a care of decorum should be had. In fine, every gesture and movement should be such as to give edification to all men." (Rule~ 250 September, .MODESTY or: Modesty.). St. Paul says in another connection: "When I was a child,. I °spoke as a child, I understood as a child, I thought as a child. But, when I became a man, I put away the tlSings of a child" (I Cor. 13: 11).'A child must hear and see and taste and smell and touch every-thing. But when he grows up he is willing to put away the things of a child--nay, is eager to. We can hardly imagine a grown-up going on playing with his toys. A man loses taste for such things. So is one as he becomes spiritually mature gradually weaned away, as he attains to th~ full stature of Christ, from the surface pleasure of the senses and the allurements of sense satisfaction. This is the more true the more he grows to relish the things of God. Then the curious ears and roving eyes and anything unbecoming in the countenance. carriage, and gait of childhood give place to that maturity and serenity proper to men and women at horhe with their Father the King. The practice of modesty is not only for religious propriety, or edification, or mortification, or to foster recollection, or to make pos-sible and encourage spiritual development and high interior activity. It is also to keep, our soul from becoming sick or maimed by venial sin or perhaps even killed by mortal sin. "Death is come .up through our windows" said the prophet (Jer.°9:21). St. Bernard comment~: "Death enters our windows when, with prying eyes and itching ears. we insist upon administering to ourselves the deadly cup of distrac-tion." (Sermo 24 in Cantic.) And St. Ambrose: "Who, midst so many bodily passions, midst so many snares of this world, can go along safe and undefiled? The eye sees: the mind is perverted. The ear bears: our attention is drawn away. We sm~ll something: our thoughts are 9bstructed. The lips drink: sin enters in. We touch" something, and we are inflamed with desire." (De Fuqa Saeculi, cap. 1.) That is why Christ, so mindful of human, weakness, instituted for the very end of life a special sacrament for the removal of the re-mains of sin contracted through seiase experience. At the last anointing the priest places the~holy oil "'on the eyes because of sight, on the ears because of hearing, on the nostrils because of smell, on the mouth bedauseof taste and speech, on the hands because of touch, on the feet because of Walking" (Council of Flore~nce, Decretum pro .Arrnenis) saying: "By this holy anointing and.by His most tender mercy may the Lord forgive you whatever guilt you have con- 251 C. A. HERBST tracted." St. Thomas explains: "This sacrament was instituted to" heal us. For a bodily cure we do not take medicine that will restore the whole body but those parts in which the root of the disease lies~ So the sacramental anointings should be made only on those parts where is found the root of the spiritual sickness." (S. Th., Suppl. q. 32, a. 5.) In conclusion, let us listen.again to a few words from that great master of the spiritual Jife, St. Bernard. "With the brethren be re-served, gracious, modest, affable, gentle, and on your guard. Be .strict with yourself but not in such a way as to be a nuisance to others . Every gesture and word, your way of acting, look, gait should be characterized by modesty and reserve. Let there appear nothing con-ceited or stilted in you, no boldness or anything overbea.ring . As the fear of the Lord puts order into a man's lif~ and prepares his whole interior for blessedness, so modesty brings his exterior under subjection. You should not become so familiar with anyone as to be completely forgetful of propriety in his presence." (Ad Quid Venisti?, xvii.) After all, "we are made a spectacle to the world, and to angels, and to men'~ (I.Cor. 4:9). And His Divine Majesty is always pres-ent, too. "In him we live, and move, and are" (Acts 17:28); ETUDE SUR LA PAUVRETE RELIGIEUSI: The Sisters of Providence (Les Soetirs de la Providence) in Montreal have "trans-lated into French six articles on poverty which appeared in the REVIEW FOR RELI-GIOUS and published them in a booklet. The articles are: "M~y Religious Buy and Sell" (V, 50) and the "Gifts to Religious" series by Adam C. Ellis, S.J.; and 'The Spirit of Poverty" (VIII, 35) by" Joseph F. Gallen, S.J. The "Gifts" se-ries includes: "The Simple Vow of Poverty" (VI, 65), "Common Life and Pe-culium" (VII, 33), "Personal versus Community Property" (VII, 79, and "Some Practical Cases" (VII, 195). Copies of the booklet, called Etude sur la Pauvret3 2eliqleuse, may be obtained from P~ovidence Mother House, 2311, rue Ste-Cath-erine Est, Montreal 24, P.Q., Canada. Cost: 40 cents per single copy; 35 cents in dozen lots or more. ¯PLEASE NOTE C~AREFULLY The subscription price of REVIEW FOR RELIGIOUS is now: $3.00 per veer for Domestic end Cenedian subscriptions: $3.35 per year for ell foreign subscrip-tions. For further deteils pleese see inside beck cover. 252 The race ot: Our Vocal:ion P. De Letter, S.J. [EDITORS' NOTE: In the March number of this year the author of "Why Do They Leave?" concluded the article with an inspiring section headed "Why Do We Stay?" In the present article Father De Letter's analysis of the grace of our voca-tion forms something of a theological counterpart and complement to the latter question. He points out the different graces included in the grace of vocation, namely, the grace of state, the grace of perseverance, the grace of progress, the grace of keeping the rules, and the grace of supererogation. He next gives the solid theological basis for trust in the grace of vocation and concludes by describing God's part, the actual graces of light" and strength, and ours, the conditions for our 'trust. "I will put great trust in the grace of my vocation," wrote St. John Berch-roans among the first of his watchwords. It is of this gr~ice of vocation that Father De Letter writes.] ~i~/JE 'OFTEN HEAR or read about the grace of our religious W" vocation. No doubt we often thank Our Lord for this most precious 6f His gifts. Wi~at exactly is it? Spiritual au-thors use the phrase in a twofold sense, first as the free divine gift by which God calls to the religious life, and secondly as the special helps of grace which enable religious, who have followed the divine call, to meet the demands of their state and to persevere in it till death. 'The second meaning, that of the special helps, of the grace of our vocation will be used. This grace is a reality of our everyday life.,If we allow it to play its part to the full, it may and does make a difference for our own pe£sonal interests and for the souls for whom we labor. For this reason it is well worth studying more closely what the grace of vocation implies and what is the basis of our trust in it. Then it' will be self-evident how we should exploit this God-sent treasure. Grace of State All religiogs, we are told, are offered and receive the grace proper to their vocation. As any other Christians, those who are called to a definite state of life with its definite purpose are offered by the Lord the graces necessary to pursue ,effectively the end of their vocation. This is true both of the general l~urpose of every religious life, which is to seek after Christian perfectioia.or holiness, and of the specific end of each particular order or congregation. Grdce of" Perseuerance in God's Friendship ¯ First'of all, religious are offered and, unless they'wilfully refuse, ~.ctual!y recei~re the actual graces needed to remain permanently on the path thatleads to perfection, "that is, to persevere in sanctifying grace. 253 P. DE LETTER Review for Religious These graces are needed. Theologians commonly teach that without the help of God's grace no one can maintain himself in His friend-ship, because fallen human nature is weak and inclined to evil. But these graces are always offered, theologians reassure us, to all who sincerely endeavour to 'please God and to preserve His love and friendship. And why? Because God's love is faithful: He does not allow to be sr~atched from His hands those who sinqerely desire to be His. If that is the case for all Christians in the state of grace, then it is more true for those whom a special divine call ~lestines for an ever growing perfection of grace. Religious, therefore, m~y count in a special way, by virtue of their very state in life, on the fidelity of the Giver of all graces. He enables them day after day and hour after hour throughout their religious life to avoid every grievous fault. Grace of Progress There is more than that. It is the fundamental duty of state for religious to advance continually in grace and perfection. That again is not possible without the help of God's grace. Our faith teaches us,. infallibly, that no good work for heaven can be performed with-out God;s gracious help. If that is so, and if religious grow in grace precisely by the works of virtue ' (and the reception of the sa.crame,nts, which grace enables them to do properly), then we must say that their Fathe~ in heaven, who is Love, cannot expect them to do thes~ works and not give them the needed help which He alone can give. That is why religious have and receive the graces necessary for the good works that are to lead them on to perfection, the goal of their vocation. ' Grace of Keeping the Rules and Obeying What are these good works? They are, naturally, commanded by the specific end of each religious institute. Concretely, they are laid down in the rules and constitutions: these outline the particular manner in which a religious vocation is to work out its ideal of Christian perfection, These laws and ways, therefore, differ for different institutes.' Hospital sisters, teaching religious, and contem-platives, are not expected to labour for perfection by exactly the same good works. Their respective rules point out to them "by which paths they are'to draw nearer to God. To follow these pathh ~nd no other, each one in the particular.office that is assigned him by the inst.itu, te and. in the community where obedience placed him, .is pnmista.kably the du.ty of state of. every re, ligious. And so all.~e.li- 254 September, 1~ 1 THE GRACE OF OUR VOCATION gious are offered each day the necessary grace to keep the rules and-fulfil their office: because fidelity to these duties is the concrete way for them to advance towards perfection and fidelity is not possible without these graces. Not every Christian, theologians teach, is at all times offered the grace needed for good works which are not of precept but are supererogatory, because, there is no clear indication that God's will demands these works from them. Only for such good works as are certainly willed by the Lord may we expect His grace to be guaran-teed. But the case of religious is a special one. Though the good ~works demanded by their rules are not, genera'lly speaking, strictly of precept (not at any rate when the religious laws do not bind under pain of sin) and are therefore in a true sense supererogatory, yet the very nature of religious rule implies that God clearly wills those works. His good pleasure and desire is expressed in the rules. By that very fact He also guarantees to ~eligious the necessary graces, ;¢¢ithout which they would be unable to comply with His good pleasure. , This conclusion applies equally to the acts of virtue which obedi-ence to superiors imposes on religious. Commands of religious supe-riors generally (exception being made for orders given in virtue of holy obedience, in whicJ~ the vows are involved) bring to their sub-jects the same kind of obligatiofi as the rules impose. As such, therefore, they do not bind under sin; yet they express to us unmis-takabl~ y the divine wishes. Religious receive the necessary actual graces for obeying the orders of their superiors as they do for keeping the rules. Though these acts of virtue, because not imposed under sin, are supererogatory in the strict sense of the word, yet they are, for religious, guaranteed as possible by the grace of their vocation. "Grace for Supererogatory Acts of Virtue There are additional virtuous actions which are not demanded of religious by rule nor by orders of superiors, but to which, they believe, a special inspiration of the Hgly Ghost invites them. Such good works, for example, extra .acts of mortification, or prayer, or humility, or kindness, are altogether free in the sense that no rule nor direction of obedience imposes them. These are not immediately covered by the grace of the religious vocation. To them will apply the teaching of theologians about supererogatory good works: not unless the invitation of God's grace be sufficiently proved genuine and ?eliablecan they count on His special help to follow up these inspira- 255 P. DE LETTER Review for Religtous tions. It should be added, however, that religious are, from their very state of. life, more opeh to these special invitations of grace. Why?" Because their fundamental duty of state is to aspire after perfection, and not all particulars that appertain to the practice of perfection are or can be determined by the rules or by obedience. Accordingly, religious need these special inspirations. Other things being equal, there is a greater probability that in the case of religious these inspirations of grace are genuine and reliable. To that extent and in that 'indirect way they also belong to the grace of the voca-tion. At this juncture the task of the spiritual director comes in to provide rehglous with sufficient guarantee that allows them safely to follow up these interior invitations. Without this sanction the danger of self-delusion would be real. That danger is excluded from all that falls within clearly known duty. Herein religious may and must depend on it that grace will not be wanting them, if only they themselves are not wanting to grace. Why is it so? Whai: is the dogmatic and theological basis of our trust in the grace of o.u.r vocation? Doctrinal Basis of Our Trust We have already hinted at the intrinsic reason why the grace of our vocation includes all the particular graces needed to fulfill our duties according to the rules and constitutions and the commands of the superiors. It is the following. God cannot command the impos-sible, because of His infinite wisdom and lo,;,e. Of religious He asks a constant strivin~g after perfection: that is the meaning of the reli-gious vocation. They find the concrete way to strive for perfection detailed in the laws of their institutes and the directions of their supe-riors. But to do all that is involved in keeping the rules and in obeying, many good works are needed which no man, religious not excepted, is able to do without the help of grace.: For two reasonsi both because these virtuous actions require a faithful effort which after original sin is not possible for long without grace; and because these acts are supernatural and of their very nature suppose the super-natural help of grace. If then God expected religious to live up to the demands of their vocation and did not at the s~me time give them ~he necessary graces, He would be demanding the impossible. Dogmatic Foundation The. ultimate foundation of this conclusive proof is nothing less than the highest possible authority on revealed truth: ,the infallible 256' ,September, 1~51 THE GRACE OF O~JR VOCATION teaching of the Church. The Council of Trent defined that it is not impossible for men to keep God's commandments; it condemned the contrary assertion of the Lutherans as heretical doctrine (DB 828). In St. Augustine's words the Council explained how men can, in spite of fallen nature's weakness, have the moral strength to do what God commands: "When He commands, He admonishes you to do what you can and to ask for help to do what you cannot, and He helps so that you can" (DB 804). Later. the Church condemned another heretical proposition of dansenistic pessimism which stated that "just men cannot keep some precepts of God even though they wish and try to do so, with the strength they now have; and the graze which would enable them to keep those commandments is also lacking" (DB I092). An infallible teaching, therefore, guarantee, s that we have the necessary graces to keep the commandments. That teaching aimed directly at those divine precepts which oblige under pain of sin, particularly of mortal sin. It may also be extended, though this conclusion is no longer infallible, to divine commands in a less strict serise of the word: to those expressions of the divine will which, though not binding under sin, .yet certainly manifest His desire ind. good pleasure. The Church's Authorit~I This latter is the case, as we well know, of the ordinary religious rules. We have a guarantee for it in the Church's approval both of religious life in general and of the particular religious institutes. The ¯ Church's sanction of the state oflife lived accordin'g to the three evangelical counsels is found in her age:old practice, which dates back td the early Cbristlan centuries, of approving and encouraging tbe monastic institute and the ascetical life. At the time of the Refor-mation it led to an infallible pronouncement, again at the Tridentine Council, by which she declared that the state of viriginity or celibacy is preferable to the state of Matrimony (DB 980). As to the appro-bation of particular institutes, theologians today are agreed in saying that in the solemn approval of religious orders the doctrinai judg-ment that the religious orders,, are apt means to reach Christian per-fection is covered by the Church's infallibility. In the less solemn .confirmation of other religious institutes, the Church's authority in-' volved is not the big.best; yet. that.approval also shares, according.to .the. degree, of the authority" that gives it, in the same fundamental guar.ant~.e:.of truth which is divine. Accordi,ngly? Catholic theology ¯' 257 P. DE LETTER Review for Religious is unanimous, in declaring that the obligation for religious to work for perfection according to the pattern designed in their respective laws is, because of the Church's approbation, the'clear expression of God's will for them. "On this doctrinal foundation rests the teaching of theologians who, like Suar~z, hold that the grace of a religious vocation includes the spe.cial supernatural aids required to live up to the ideal which is proposed to the religious by their institute. He wrote: "Since all ap-proved religious orders are deservedly regarded as founded by the special Providence of God, there is no doubt that each enjoys a'spe-cial divine assistance proportionate to its vocation, and hence greater in proportion as its institute is more exalted and difficult and organ-ized for the greater service of God and the more far-reaching good of the Church" (Rel. S.J., I, 6, 9). What holds good for reli-gious orders as a whole, also applies to the members. The graces of their vocation which effectively enable them to pursue the end of their institute are the concrete expression of the divine assistance that flows from God's special Providence over them. Religious, therefore, are building .their trust on the safe rock of Peter when they firmly believe in the grace of their vocation. More-over, does not the experience of the religioh~ life come to teach them that the Lord does not disappoint that trust? When and in the measure that they are faithful to their calling, they find out what these graces of our vocation mean in practice. Graces of Light and Strength As actual graces in general, so the graces of our vocation are of two kinds which, more often perhaps, are found together rather than isolated. First there is light for the mind, generally more affective and practical" than purely sp~e~uiative and cold (for they are meant to lead to action), by which the meaning and reality of the religious ideal, duties, privileges, favors, appear more clearly, more appealingly, and more exaltedly worthwhile. These' actual graces of light, on occa-sion standing out very markedly, at other times more dim yet really present, give a deeper and new understanding of the rules, of the ideal of poverty; chastity, obedience, of the community life and of our daily tasks of education, missionary work, medical charity, sacred "ministry so that the good works by which religious strive after sand-tity. take on their deep, often hidden, meaning. Together with that light goes a grace of strength and courage for'the will and heart, 25'8 September, 1951 THE GRACE OF OUR VOCATION tempering and steeling one"s whole moral an~ spiritual structure, actually enabling religious to live according to their light. These graces of fortitude, patience, and ability, make Jrpossible to keep up ¯ the effort for progress, and bravely and gladly to accept and take up the small and on occasion bigger crosses involved in the faithful ful-filment of their daily duties. These graces of strength, at times ex-perienced more forcibly, at other times, perhaps more commonly, perceived in humble and dim faith, smoothen the path towards per-fection which often is rough and always uphiIl. The remembrance of these graces received in the past is a precious confirmation" of Our faith and trust in the grace of our vocation. Condition of Our Trust That faith and trust is rightly ours on one condition: that we do, sincerely and hum.bly, what in us lies to answer the graces we receive. There is little need to insist on the first and foremost part in this cooperation with grace which we may take for granted, namely, that we live in the state of sanctifying grace. Progress in grace supposes the st'ate of grace. Unless the substance of the spiritual life be there, we cannot expect further grace~ for progress. These graces, according to the ordinary rule of Divine Providence, are usually given in proportion to oui" fidelity in accepting and answering them. One way of showing this desire of receiving and exploiting those graces is our faithful and insisting prayer for them. According to the hint of the Council of Trent we quoted above, our asking for graces may well be the condition for receiving them. We may even count on the abundant divine aids guaranteed by the grace of our vocation if we sincerely and generously trade for spiritual profit with those we receive. No doubt even then no one can vouch for it that he will never fail God's grace, even though grace does not fail him. We know it too well, human frailty remains in religious as well. And we need not be surprised at our daily faults of weakness which, we may confi-dently hope, involve but little guilty negligence. Provided. only we know how to exploit those very failings to deepen humility and a sense of our need of prayer and trust in the Lord, they do not seri-ously impair our fidelity to grace. Our desires and deeds continue then to express our sincere gratitude for God's great gift, our call to the religious life. Then we may and must always count on the grace of our vocation. 259' A Vocational Newspaper [Contact, a bright, four-page, two-year-old vocational newspaper from the arch-diocese of Boston, may be of interest to readers of the REVIEW who are not ac-quainted with it. The following description was written by a staff member of the publication. For further information write to: Director of Vocations, Room 622, 185 Devonshire St., Boston, M~,ss. ED.] Maintaining that "Personal contact between an interested priest or religious and a good potential candidate becomes the only real vocation program," Father Francis A. Barry, director of vocations in the Boston archdiocese, thought that a vocational newspaper might provide a natural occasion for conversation or 'even extended talks on religious vocations. The paper was given the significant name: Contact. Experience has shown the idea was a 'good one. Contact, a monthly during the school year, began publicati.o.n in October, 1949. His Excellency, the Most Reverend Richard J. Cushing, Archbishop of Boston, the founder of the special vocational program, is the adv.isory editor. The editor is Father Barry. He is assisted by eight associate, a makeup, and ten contributing editors. The latter include diocesan and religious priests, Brothers, and Sisters who write columns, features, reviews, and editorials. His Excellency financed the project during its initial year. The religious orders and congregations having houses in the archdiocese shared the major ex-pense since then. , Distributed gratis" to pupils of parochial or other Catholic schools, from the seventh grade through the senior year in school as well as to Sunday schools, rectories, and seminaries, the circulation now tops 50,000." Increased solely by ~ear-say advertising, the mailing li~t now re'aches out to thirty-one s.tates, the Philippine's, Cuba, Italy; France and Canada. The italicized, three-column, colored logotype carries the triple message: Information, Inspiration, and Action. To attract the young people's attention, each issue is printed with bright color spots, ac.cording to the season or month. Adjacent to some of the standing heads appears a small portrait of the editor of the column, showing his religio.us habit ahd giving his name and address. Feature pictures and action shots of'the apostolate of teaching or social service highlight each issue. Provocative headlines dot the pages: It Seems to Me . Horizons, Meet. some religious com- 260 September, 1951 COMMUNION FOR OTHERS ~nunity, Looking Out . thought from the seminary or the novi-tiate, Do You KnoW?, Parents" Column, and Around tile Diocese. Parochial high school reporters keep copy flowing to the desk of the editor of the last-mention~ed column. Contact reiterates the words of His Holiness, Pope Pius XII: "This vcJcation, thisloving call makes itself heard in manydifferent ways, as many as the infinite variety of accents in which the Divine Voice may speak: irresistible invitations, affectionate and repeated promptings,gentle impulses."--SISTER MARY REGINA, S.S.,J. Offering Communion t:or.Ot:hers Clarence McAuliffe, S.3. SISTER LOUISA sat placidly at her desk filling out the spiritual bouquet. It was the community's gift to Sistdr Mercedes who was to make her p~ofession next day. Sister Louisa was adding her contribution to the various specified good works-- rosaries, s{ations, visits, penances,, aspirations, Masses, Communions. It was an easy and congenial task and she contributed generously. But when she had finished, she found a question e.ngaging her mind,. a question she had never asked herself before. She had added five to the total of Commuriions to be offered for Sister Mercedes. 3ust what did it mean to offer Communion for somebody else? She ~had been doing it for many years. Her relatives and friends were always pleased when she told them that she would offer her Communion for them. Yet she had to confess now that she really did not know what she meant wh'en she told them that'she would offer her Communion for their intention. Many religious besides Sister Louisa have been puzzled by the same question. Nor is its answer easy to find. The purpose of this article is to clarify what we mean when we tell others that we are going to offer our Communion for them. It is important to remember that Communion produces certain effects that are inalienable. For instance, Communion automatically increases sanctifyin~ grace and most probably has the power,to con-fer more of this grade than any other sacrament. We do not transfer 261 - CLARENCE MCAULIFFE Ret~ieto for R'eligious any of this to others when we offer our Communion for them. Again, the increase of active love for Go~t and our neighbor which is the .special effect of the Eucharist and which depends on the fervor of our thanksgiving, is not surrendered by offering Communion for somebo~ly else. So too, the strength to resist temptations, the cooling of disordered feelings, since these are special though secondary effects of Communion and depend also on the fervor of one's thanksgiving, are incommunicable. The same is t6 be said of the additional right to a glorious bodily resurrection which is acquired by the worthy reception of Communion. Finally, the remission of venial sins which results automatically from Communion, if the recipient has sincerely revoked all wilful attachment to them, cannot be transferred to any other person. From all this it is ~lear that the principal benefits accruing from the Lord's Table remain with the communicant. In fact it might appear that no spiritual gifts remain which can lend real meaning to our promise to offer Communion for somebody else. But there are. When we ~o to Holy Communion we ordinarily do extra praying and a certain ambunt of mortification. We make a suitable prepara-tion and thanksgiving. We also fast beforehand. Now we all know that prayer and fasting are subjective acts of virtue, ~nd when made by a person in the state of grace, they have a three-fold value in the sight of God. For the sake of brevity, the theologians use tbre'e tech-nical words to express this three-fold efficacy. They say 'it is "meri-torious, satisfactbry, and impetrative." What they mean is that every act of virtue wins more sanctifying grace (meritorious efficacy), removes some temporal punishment (satisfactory), and pleads with God for spiritual and temporal favors (impetrative). In addition, therefore, to the sanctifying grace which comes spontaneously from each Communion, a person also gets more sanc-tifying grace from his acts of virtue elicited before and after receiving the sacrament. Since we can never give one iota of sanctifying grace, no matter by what means it is acquired, to another person, it is evi-dent that the grace proceeding from these acts of virtue at Commun-ion time is also retained by the communicant. However, the satisfactory and impetrative efficacy of these acts may be relinquished in favor of others when we offer Communion for them. Suppose we consider first the gift we make when we hand over the satisfactory fruits of our Communions. Ordinarily we are able to make a fitting preparation for the 262 oep*e,noer, I95 ! COMMUNION FOR OTHERS reception of Holy Communion. Not only do we fast, rise early, kneel down, but we also make acts of faith, hope, confidence, desire, humility, and perhaps acts of perfect love for God. Now each of these acts of penance and of prayer, by reason of our good subjective dispositions which accompany them, has the power to take away some temporal punishment. Moreover, since we are the ones who do the penance and say the prayers, we have the right to have our otot~ temporal punishment lessened by them. What happens, then, when we offer Communion for another? We transfer this incalculable benefit to the other party and, if he is in the state of grace, he receives it. The same is to be said of'the~ prayers we say at the moment when we receive our divine Lord and during the time that He remains pres-ent within us. We communicate the satisfactory value of all these prayers to the other person. Instead of shortening our own purga-tory we shorten the purgatory of another. We', so to speak, suffer vicariously and gratuitously for some one who has no real claim to our sacrifice. If we reflect for a moment, we shall also understand why the satisfactory efficacy of these virtuous acts preceding, accompanying, and following Holy Communion exceeds that produced by the same acts elicited at some other time. We suppose, of course, that our fer-vor (and by that we refer not to our feelings, but to our acts of will) would be equal in both instances. We shall also understand why Communion remits more temporal punishment than other prayers listed in a spiritual bouquet--for example, rosaries or visits to the chapel. We take for granted, of course, that our cooperation would be equally diligent and that the same number of acts of virtue would be made. Otherwise it could easily happen that a rosary re-cited devoutly and animated by many acts of virtue would remit more temporal punishment than a Communion prepared ~or and received listlessly and negligently. Buy other thin~s being on a par, there is an objective reason why Holy Communion should take away more temporal punishment than the rosary or other pious works. The truth of this statement rests .on the fact that ordinarily the acts of virtue we make in connection with Communion are more fer-vent (here again we do not refer to feelings of fervor) and more numerous than those evoked by other works of piety. This is pa.r-ticularly tru~ of the prayers we say during our thanksgiving' after Communion. And it should be noted that temporal punishment is 263 CLARENCE MCAULIFFE Review for Religious canceled in proportion to the fervor and number of our.tSrayers. But why should our prayers after Communion be more fervent? Because Christ is then physically present within us. As a result of His sacramental presence, both the number and the quality of the actual grac'es showered upon us are ~uperi6r to those which necessarily accompany every pious supernatural work. After Communion our Savior inserts a continuous stream of vivifying actual graces into our minds and hearts, and these graces have as their general object, not to arouse merely confidence or faith or humility, but love itself, the most noble of all the virtues. If we ponder these facts, we shall. readily see. why our prayers after Communion have a singular power to reduce the debt of punishment incurred by somebody else. So much for th~ satisfactory value of Holy Communion. We can be comparatively brief in treating of the sacrament's impetrati've fruit because it rests on the same principles we have been discussing. By offering Communion for others, v~e also mean that we trans-mit to them the petitional power of both our preparation and thanksgiving. The very same acts of virtue have not only a satis-factory, but also a pleading or intercessory value. They implore God to brant spiritual and temporal f~vors. Here again, since we are the ones who do the praying, we are the one~ who have a right to obtain the favors. But we,relinquish this right in fav~)r of other~ when we offer our Communion for them. We forget our own needs; we fore-go some benefits that would surely come to ourselves. ~re sacrifice ourselves for the other party. Of course, we must remind ourselves again that we cannot surrender those benefits that flow spontaneously from the Sacrament, such as the remission of venial sins, the growth in love for God and other people, the new title to everlasting glory and the curbing of unruly impulses. But there are many other spiritual and temporal favors that every person needs. There are .many that we ourselves need, even though we often do.not know precisely what" they are. Yet we forget our-. selves and transfer the intercessory vigor of our Communions to others when we offer Communion for them. It is like writing a let-ter of recommendation f6r som~ one else to obtain a benefit that you yourself need and have a right to; and it is a letter of recommenda-tion that you know is certain to be heeded. It is well to remember also that this impetrative efficacy of~Com-reunion is likewise of exceptional ~luality, just as the satisfactory efficacy, and for the same reason. The number and kind of actual 264 September, I~51 COMMUNION FOR OTHERS graces stirred up in the soul after. Communion exceed those accom-panying other good works. .Consequently if we co-operate with them, our acts of virtue will be correspondingly more fervent so that their pleading value is enhanced. Unfortunately, most of us probably do not pray explicitly "after Communion for the person for whom' we offer the Communion. This is, of course, not necessary since our intention made beforehand suffices to obtain for the otber~the satisfactory and impetrative fruits of the sacramefit. However, if we do remember to pray expressly for the' other person after we have received Communion, we shall un-doubtedly increase the value of our gift for him. It stands to reason that our Savior' listens to our. requests with a more willing ear when He is actually present within us with His Sacred Humanity. We recommend, therefore, the practice of praying explicitly after receiving Communion for the person to whom we relinquish the benefits. We may even ask Our Savior to grant certain spedfic favors, especially spiritual ones, to the other party. In conclusion, then, we cannot give away to anyone else the ¯ principal fruits of our Holy Communions. These we have itemized in the beginnihg. In addition to those listed, we might also add that when an indulgence is granted for the reception of Communion or for some prayer said,before or after receiving the Sacrament, we can-not offer it for another living person. Nevertheless, we do a singular favor foi others .when we offer a Communion for their intention. We sacrifice'for theirbenefit the satisfactory and impetrative fruits which are won by our acts of virtue preceding, accompanying, and follow-ing Holy Communion. MEDICO-MORAL PROBLEMS Medico-Moral Problems, Part III, by Gerald Kelly, S.J., contains complete dis-cussions of euthanasia, therapeutic abortion, organic transplantation,, and adult baptism. Also included are discussions of co-operation in illicit operations, the delivery of a. hydrocephalic infant, and lobotomy for pain relief. The booklet is published by the Catholic Hospital Association of the United States and Canada, 1438 South Grand'Blvd., St. Louis 4, Mo. 50 cents a copy; 12 for $5.25; 50 for $,20;' 100 for $37.50. Parts I and II can be obtained at the same place and at the same prices. 265 uestdons and Answers --20- An unexpected opportunity has arisen to sell a piece o{ communlt~ property {or $100,000, which is much more than we could get for it under normal circumstances. But the property must be transferred.withln ten days, otherwise the offer will be wlfhdrawn. VVhat shall we do about gefflng permission of the Holy See? Fortunately His Excellency, the Apostolic Delegate, now has faculties from the Sacred Congregation of Religious to permit the contracting of loans, sales, and alienations of property belonging to a religious institute, when the sum involved does not exceed a half million gold dollars, provided that the conditions laid down in canons 534 and 1531 be observed. We take this opportunity to inform our readers that the Sacred Congregation of Religious has also granted two other special facul-ties to the Apostolic Delegate: to dispense.religious for the reception of Holy Communion from the obligation of the Eucharistic fast so that they may take something by way of drink or m. edicin~, when their physician considers the keeping of the fast injurious to their health; also to shorten or prolong the postulancy prescribed by the Code of Canon Law (see Bouscaren, Canon Lau2 Digest, Supplement 1943-1948, p. 131, under canon 858). m2 I-- I have heard that permission of the Holy See is required {or th~ aliena-tion of notable relics and images. Is it proper ÷o infer that relics and ¯ venerated images may be bought and sold? Does his include sacred vessels? To .buy and sell is only one form of alienation. Hence it does not follow as a general rule that relics and venerated images may be bought and sold simply because the Holy See at times gives permis-sion to alienate such things. Since three distinct things are included in this question we think it advisable to treat each class separately. Relics. Canon 1289 states very plainly: "It is unlau~[ul (nefas) to sell sacred relics." To do so would be to commit a sin of simony. However, it would not be sinful to charge and pay for the metal case in which the relics are usuhlly inclosed. Canon 1281, § I tells us that "notable relics or precious images, and likewise all relics or images 266 QUESTIONS AND ANSWERS Which are honored in any church with great devotion on the part of the people, cannot be alier~ted validly nor transferred permanently to another church without the permission of the Holy See." What is me~tnt by notable relics? Paragraph two of canon 1281 gives us a list of notable relics: the body, head, arm, forearm, heart, tongue, hand, leg, or that part of the' body in which the martyr suffered, provided it be "entire and" not too small." Such relics may not be alienated without the permissi6n, of the Holy See. Since it is for-bidden to sell. relics, alienation here must be taken in its other meaning, that is, to give away, to lend, and the like. The permission of" the Holy See would be required also to alienate relics which °are not notable; provided that they are honored in a church with great devotion on the part of the faithful. Small relics in the possession of private persons do not come under canon 1281, but they may never be sold. Precious [maqes. Ecclesiastical goods (church property) are shid to be.precious,when they have a ~pecial value by reason of artistic, historical, or material content (canon 1497, § 2). An image is said to be precious if it was painted by a great artist, or was made of precious materials, and has a notable valu&, that'is, over 1000 gold life (about $335 in our present money). Such images, as well as others which are not precious but which may be called venerable because of the great devotion of the faithful towards them, may not be alienated without the permissiqn of the Holy See. Sacred Vessels. Things are said to be sacred when they are .destined for divine worship by reason of their consecration or con-stitutive blessing. Canon 1305 tells us that "an article of sacred equipment which is blessed or consecrated loses its blessing or conse-cration . . . if it has been put to degrading uses 6r has been exposed for public sale." On the other hand, canon 1539 states that "in the sale or exchange of sacred things no account of the consecration or blessing is to be taken in determining the price." We may say, there-fore, that sacred vessels may be sold privately by one individual to another, or by one moral person to another (a church or community to another church or community) provided no extra charge is made for the blessing or consecration. But sacred things may not be exhibited publicist for sale without losing tbeir blessing or consecra-tion. This applies principally to auction sales and to the placing of a sacred object in the window or in the show case of a store open to the public. 267 QUEST, IONS AND A .NSWERS Reuieu) for'Religious We may conclude by adding that a consecrated chalice and paten do not lose their consecration'by being regilded (canon 1305, § 2). May exfreme unction be admlnls+ered before any major opera÷ion? For the valid reception of extreme unction the subject must be in " danger of death ¯from sickness or old age. If the person who is to, undergo major surgery is already in this condition, he is capable of receiving the sacrament before the operation. It may be that this is ge~nerally the case, but it is not necessarily so. Some operations which may entail a great deal of danger are performed for removing some chronic condition which might not become dangerous, without the operation, for a long time. Such patients cannot be anointed before the operation. In practice, it is not easy to decide whether to anoint a person. before an operation or t6 hwait the outcome of the operation. ¯ There is no universally-established practice; nor could there be: Some patients are clearly not capable of receiving the sacrament before the operation; others are clearly capable; and still others are "borderline cases." Moreover, the pastor or chaplain has not merely to decide whether the patient can be validly anointed l~ut also to judge when the anointing would be most appropriate and beneficial. Our ¢ons+ffufions +el[ us +ha+ "[eff~rs fo +he S~s+ers as well as +hose senf by +hem shall pass +hrough ÷he hands of +he superior who may read +hem," In view of +hls s+a+emen+, may a eAenera[ chap+er eAranf +o 9olden jubilaHans +he prlvllecAe' of seal[n~ +belt leffers before ~ivlng ÷hem ÷o +hl superlor7 "-['he general chapter has no power to change the constitutiofis, unless the constitutions themselves give it that power, which is not likely. On the other hand, since the constitutions' do not oblige the superior 'to read all letters which pass through her hands, the general chapter could recommend that superiors refrain from reading the letters of golden jubilarians, but it could not take away the right to read them which is contained in the constitutions. The general chapter may likewise request that the constitutions be changed in this matter, if that be the wish of the majority. Such a request for a change in the constitutions would be made to the local ordinary in the case of a diocesan congregation, or to the Holy See (Co.ngrega-tion of Religious) in the case of a pontifical institute. 268 QUESTIONS AND ANSWERS Ret~iew /:or Religious m24-- Is the novice master to be present at the discussion of the general council which follows upon his report on the novices who are preparing for first professlon? Canon 563 reads as follows: "During the course of the year of novitiate, the master of novices, conformably to the constitutions, must present to the .chapter or the higher superior a report con-cerning the conduct of each of the novices." Strictly speaking there-fore, the master of novices makes his report to the chapter (in inde-pendent monasteries! or to the higher superior, but not directly to the gefieral council, unless the constitutions prescribe this. Hence a written report should be given the higher .superior who, in turn, will communicate it to the general council. Many constitutions have an article based on art. 300 of the Norrnae which says that "whenever in the general council the novices or the novitiate is discussed, the mistress should be called, who will make known her mind on the subject under discussion, or submit opportune information." There will be no need (and certainly no obligation) for the master of novices to remain at the council session after he has given the infor-mation prescribed by canon 563. If necessary, h~ can always be called back for further information. ~-25-- Is it permissible for sick Sisters who are not completely bedridden to ¯ receive Holy C~ommunion by the cell of a Sister who is confined perman-ently to her bed. These Sisters can manage to get around although the doctor's orders are that they rest as much as possible. Likewise the sana-torium in which they stay has' an elevator and the chapel is on the first floor. The general rule is that all should receive Holy Communion in the chapel if they can conveniently do so. If the Sisters are so sick that they are obliged to miss Holy Mass, even though they are up and about their rooms or in the corridor, they may receive Holy Com-munion on the floor on which they li~'e. As to the elevator: if the Sisters use .it to go to'another floor for their meals, then they should use it likewise to go to the chapel to receive Holy Commu'nion. In general one may say that if going to the chapel for Holy Com-munion would lengthen the time for the Eucharistic fast, or would put ar~ additional strain upon a sick Sister who is not confined to her 269 NEW MEDITATION BOOKS Review [or Reh'gious bed, she may receive Holy Communion on the floor on which she lives. --26-- Is the practice of saying I000 Hall Marys on the Feast of the Annun-ciation ÷o be considered a superstition? Everything. will depend upon the motive a person has in re-peating the Hail Mary that often on the Feast of the Annunciation. If this is done simply out of love for Our Lady, there is nothing wrong with it, since, it is a laudhble act of devotion. ~If, on the other hand, the practice were based upon a ~purious ,revelation, or a sup-posed efficacy which it does not have of its own nature (that of intercessory prayer), then it might be superstitious. New Medi!:a!:ion Books Like St. Teresa of'Avila, many religious,need a meditation book for many years to help them in their prayer. Four such books, writ-ten as helps for contact with God in prayer, have recently been pub-lished or reprinted. The authors are a German Capuchin, an Ameri-can Jesuit in India, an American Benedictine, and a Hungarian bishop. The books vary in purpose, content, and form. Direct, ~arnest, Practical One of the books is the fourth volume of MEDITATIONS by Father Bernardine Goebel, O.F.M.Cap., translated by Father Berch- 'mans Bittle, O.F.M.Cap. Adapted for the use of the Friars Minor Capuchin, the direct, earnest, and practical reflections will help any follower of the Gospel. The present volume is for the'time from Trinity Sunday to the Twelfth Sunday biter Pentecost. The meditation for Sundays is usually on the Gospel of the.day. Some of the topics developed f6r the course of a week are the Eucharist, the Mass, faith, hope, char!W, and love of .neighbor. Each meditation begins with a brief sum-mary of the meditation followed by a brief introductory paragraph, develbps two points w.ith a consid,eration and*application, and ends with a prayer. (Province of St. Joseph, 1740 Mt. Elliott Ave., Detroit 7, Michigan, 1950. Pp. 264. $2.50.) Prodac~ of Missionarg Zeal From the 'mission.field ~f Ifidia comes MEDITATIONS FOR EVERY 270 " September, 1951 NEW MEDITA'FION BOOKS DAY by Rev. P. J. Sontag; S.J. It has recently been reprinted in an attractive two volume set. The first volume containin~ I87 medi-tations covers the first half of the liturgical year from Advent to Trinity Sunday. The second volume complete~ the year bringing the total number to 369. Most of the meditations are based on the life of Christ. Meditations on the Apostles Creed, the Our Father, the sacraments, on social justice and Catholic Action are included, as ¯ ycell as meditations for the First Fridays, the lit.urgical feasts, feasts of special saints, and over twenty meditations "honoring Mary. Though the meditations'were l~repared specifically for the l~iity, priests, seminarians, and all religious will find them belpful. Each meditation fias two or three (the. additional gives the account from Scripture) preludes and three ¯points which contain ample matter for reflection. For the colloquy, the author modestly hnd wisely con-fines himself to suggesting the person, Our Lord or a saint, to ad-dress. The set belongs to the Science and Culture Series and has a preface by the general editor, Joseph Husslein, S.J. (The Bruce Publishing Company, 400 N. Broadway, Mil,waukee 1, Wisc., 1950. Pp. I, xviii q- 476; II, ix q- 466. $10.00.) Goal ol: Monasticism Volume three completes THE.SCHOOL OF THE L, ORD'S SERVICE by, Rev. Bernard A. Sause, O.S.B. (author of "Bene, dicti~e Spirit-uality," REVIEW, X, 7). The set gives a meditation based on the Rule of St. Benedict for every day of the" year. The present volume for the ninth to the twelfth month contains the text of the Rule of St. Benedict and thirty meditations on ea'cb .of the foll~)wing four subjects: spirit of detachment: good zeal': practices, interpretations. and attitudes that have grown from the Rule: and intimate union with God. There is a bibliography and a composite index for the three volumes. Each meditation contains a carefully developed consideration, an examen for the day, and a practical application. The considerations are enriched by quotations, examples, and commehts ~arnered from Benedictine tradition, The sources are given after each meditation. The author's" development of zeal is especially noteworthy. He pre-sents the virtue of zeal in a concrete, appealing'manner by singling out for each day of the month a Benedictine monk, nun, or lay Brother who exemplified some aspect of zeal in his or her life. Not all of the exam, plats are canonized saints. The book deserves and 2'71 NEW MEDITATION BOOKS rewards a careful, prayerful reading. (St. Meinrad, Indiana: The. Grail, 1951.' Vol. iII, Pp. vi q- 575. $4.00.) Devotion and Inspiration Rt. Rev. Ottokar Proh~szka, bishop of Sz~kefeh~rvfir, who died on March 28, 1927, was an outstanding and saintly prelate and a gifted, prolific writer. His MEDITATIONS ON THE GOSPELS are brief, s.wift-moving reflections on the entire life of Our Lord. He presents a text from the New Testament, gives a few short reflections, and leaves preludes, affections, and colioquies to the exercitant. The meditations should be a source of devotion and inspiration to many. The author w!;ites in the introduction to his work: '"I am come that they may have life, and may have it more abundantly.' I wish to serve this purpose of Jesus at His Incarnation, and to that end I am sending this book out into the world. It is intended to assist in the development of the life of Cbrist within our souls . Christ is God Himself in human shape, and I have to adore Him, and delight in His sublime beauty, in the depth and unique quality of His Soul, in the powerful originality of His mind, in the charm which He diffuses and in the life which flows forth from Him. My soul hangs upon His lips and hearkens to His every word. I see God reflected in Him as in a mirror; I bow my head upon His bands and surrender my heart to Him. He is God's Instrument; He will form me and harmonize thd conflicting elements within me." The present Newman edition bad three volumes fin one. The authorized translation from the Hungarian is by Margaret de Pill. Father C. C. Martindale, S.J., has written the foreword. (Wes.t-minster, Maryland: The Newman Press, 1951. Pp.: I, xiv + 229; II, ix + 322; III, viii + 282. $5.50.) SPIRITUAL BOOK ASSOCIATES (381 Fourth Ave., New York 16, N.Y.) September Selection--R. Garrigou-Lagrange, O.P. Our Saviour and His Love for Us. $6.00. October Selection--Henri Petitot, O.P. The True Story of Saint Bernadette. (Cf. REVIEW, May '51, p. 161). $3.50. 272 ¯ 8ook Reviews THE HISTORY OF THE POPES. By Ludwlcj yon Pastor. Translated by E. F. Peeler. Vol. 36: Benedict XIV (1740-1758). Pp. 513; Vol. 37: Clement XIII (1758-1769). Pp. 4S8. B. Herder Book Co., St. Louis, Missouri. $5.00 per volume. This REVIEW (September, 1950) carried a notice of Volume 35 of the English Pastor, showing Pope Benedict XIV in the opening years of his pontificate working "with a pistol at his head," 'a weapon held by Catholic sovereigns demanding that he let them run the Church as well. ' It was particularly in m'eeting their concerted attack on the Society of ,lesus that Benedict XIV fought for his papal powers. Now Volume 36, the latter part of Benedict's pontificate, and 37, that of Clement XIII, come t6 hand, and their entire content is predominantly devoted to later phases of this titanic contest. Even so they bring the st.ory only to the end of the second last Act, and tfien break off while the~ translator works on the ddr~otternent. Will the Society, in the end, be suppressed? Will this regiment, of twenty-two thousand religious, in some forty provi,ces, 600 col-leges and over 1400 churches, be sacrificed? Read the next volume to foll~w shortly. To religious of both sexes, and members of whatever type of canonical organization, this story cannot but have deep and abiding interest. That it chanced to be the Ignatian Society against which the storm broke was because it was the "Swiss Guard" of the day, and the ruler of the Swiss Guard can expend his troops in battle, or order them back to the barracks to disband. Despite the faults and human weaknesses of the papacy's de-fenders, the story leaves them with the honorable distinction of. "canonical" death in the line of duty. Certain European monarchs were persuaded that the papacy had to be cut down to reasonable size. As the Minister Tanucci put it (37, 13) : "Certainly the primacy of the Pope was incontestable; he was the supreme head and centre of the Church; he had the right to summon a General Council, and he was infallible, but only when 15e made decisions in conjunction with the Bishops. But the Papacy in the form it had assumed in his day would have to. be abolished." 273 BOOK REVIEWS "The only way to treat the Pope was to . . . kiss his feet and bind his hands'~ .(28). So, under forms of exquisite politeness and courtly'deference, a violent strtiggle was waging. If the current tyranny of atheisti~ Commu, nism were being carried, on under the appearance of Catholic Leadership, if Marshal Stalin had his official minister at the Vatican to shape Catholic policy,.we could all the easier understand the high and mighty language of "unavoidable administrative necessity" that permeates these endless pages of eighteenth century despotism: It was proved with mathematical precision again and again that the mon-archs were but acting for the Church's good in withstanding the Pope, etc. Have we not heard these tunes being aired in our own day? Will it. be different in the twenty-second century, or the twenty-fifth? Details are all irrelevant; the contest wages still: evil has not prevailed, but it availeth much--GERALD ELLARD, S.J. THE LOVE OF GOD AND THE GROSS OF JESUS. By ÷he Rev. Regl-nald Garrigou-Lagrange, O.P. Transl~÷ed by Sisfer Je~n~e Marle, O.P. Volume Two. Pp. vi q- 461. B. Herder Book C;o., Sf. Louis, 1951. $~.00. This volume carries forward and completes Father Garrigou- Lag~ange's studies on divine love and the perplexing trials that are apt to befall souls fairly far advanced in the way of that love. Briefly this is the content of it. Part one deals with "crosses of the senses." These ar4 understood to be just what St. 3ohn of the Cross describes as "the night of sense," and hence here we ,have Fr. Garrigou-Lagrange's interpretation of that portion of St. 3ohn's doctrine. Correspondingly the second part is taken up with St. dohn's !'night of the spirit." Both sections, therefore, are concerned with what one might term the dark, distressing, disconsolate, phase of the mystical life. Part three is headed, "The Life of Union through desus and Mary." Among the themes considered are the inhabita-tion of the Blessed Trinity, the unity and sublimity of the apostolic life, the priesthood of Christ, His kingship, the Blessed Virgin Mary as a model of reparation, and St. 3oseph as a model of the hidden life and first among the saints. As parts one and two would com-fort'and strengthen one who is suffering, the rigors of the night of the soul, so this third part has much that is positively very magnificent and inspiring. The Three Ages of the Interior Life is expressly offere~l to the 274 September, 1951 BOOK REVIEWS public by Ft. Garrigou-Lagrange as a synthesis of this work and Christian Perfection and Contemplation (vol. I, v). Hence it shares in the merits and demerits of that larger and later work. These were discussed at length pro and con'in this REVIEW previously (Novem-ber, 19'49, pp. 297-317; March, 1950, 78-95). ' Since The Love of God and the Cross of Jesus was subsequently incprporated in The Three Ages and presented there in the form which the author now prefers, it seems rather surprising that it should be translated and published at this time. Except for scholars who wisl~ to see both studies, one who wants Fr. Garrigou- Lagrange's ideas on these matters should preferably seek them in the later and more definitiire work--AUGUSTINE G. ELLARD, S.J. THE GIFTS OF THE HOLY GHOST~ By John of St. Thomas. Trenslated fro~ the Latin by Dornin~c Hucjhes, O.P. With e Foreword by Walter Farrell, O.P. Pp. x -f- 293. Sheed end Ward, New York, 19SI. "$3.7S. Now Fr. Hughes has done, and in beautiful form, for English readers what Madame RaissaMaritain did a number of years ago for the French, that is, he has made a translation of the celebrated
The Situation In The Middle East This Record Contains The Text Of Speeches Delivered In English And Of The Translation Of Speeches Delivered In Other Languages. ; United Nations S/PV.8164 Security Council Seventy-third year 8164th meeting Tuesday, 23 January 2018, 3 p.m. New York Provisional President: Mr. Umarov. . (Kazakhstan) Members: Bolivia (Plurinational State of). . Mr. Llorentty Solíz China. . Mr. Shen Bo Côte d'Ivoire. . Mr. Tanoh-Boutchoue Equatorial Guinea. . Mr. Ndong Mba Ethiopia. . Ms. Guadey France. . Mr. Delattre Kuwait. . Mr. Alotaibi Netherlands. . Mr. Van Oosterom Peru. . Mr. Tenya Poland. . Ms. Wronecka Russian Federation. . Mr. Nebenzia Sweden . Mr. Skoog United Kingdom of Great Britain and Northern Ireland . Mr. Allen United States of America. . Mrs. Haley Agenda The situation in the Middle East This record contains the text of speeches delivered in English and of the translation of speeches delivered in other languages. The final text will be printed in the Official Records of the Security Council. Corrections should be submitted to the original languages only. They should be incorporated in a copy of the record and sent under the signature of a member of the delegation concerned to the Chief of the Verbatim Reporting Service, room U-0506 (verbatimrecords@un.org). Corrected records will be reissued electronically on the Official Document System of the United Nations (http://documents.un.org). 18-01889 (E) *1801889* S/PV.8164 The situation in the Middle East 23/01/2018 2/11 18-01889 The meeting was called to order at 3.05 p.m. Adoption of the agenda The agenda was adopted. The situation in the Middle East The President: The Security Council will now begin its consideration of the item on its agenda. Mr. Nebenzia (Russian Federation) (spoke in Russian): I should like at the outset to apologize to the members of the Security Council and the Secretariat for the fact that I ruined their siesta today. We have requested the convening of an open meeting of the Security Council because the issue that we intend to raise is far too important for the discussion to be held in closed consultations. We have nothing to hide. When we discussed Syria in consultations yesterday, many touched on the importance of establishing a new structure to investigate instances of chemical-weapons use in Syria to supplement the Organization for the Prohibition of Chemical Weapons-United Nations Joint Investigative Mechanism (JIM), which fully discredited itself. We have never forgotten this issue, and we have consistently recalled in meetings our readiness to continue consultations on this matter, as noted by Minister Lavrov to the Secretary-General last week. Yesterday, however, we were unable to rise to that call. Today, upon instruction from our capital, it is my honour to report the following. Russia has consistently stressed the importance of taking the most serious approach to the problem of the manufacture and use of chemical weapons. We are troubled by manifestations of chemical-weapons terrorism in the Middle East, which are not limited to Syrian territory. Unfortunately, the JIM, which no longer exists, caused the collapse of the investigation, which from a scientific and technical perspective was an utter failure and became an instrument for political manipulation. Members of the international community and the Security Council were well aware of the Russian specialists' scrupulous analysis of the conclusions of the JIM. In an attempt to interpret certain elements of the Russian approach, during consultations on 9 January the United States delegation circulated the relevant document. However, at no point in the document was there even an attempt to approach the matter from a professional standpoint. The so-called refutations of our position do not stand up to any criticism. I invite Council members to familiarize themselves with the material supporting our position in the response that we circulated yesterday as an official Security Council document. Today, incidentally, senior representatives of the United States Department of State made further unfounded accusations alleging that Russia is hindering international verification of the facts of the use of chemical weapons in Syria. We have already responded to that, and anyone who wants to can read Russia's Deputy Foreign Minister Ryabkov's comments on the issue. No one has called more than we have for a further investigation — a professional one rather than a simulacrum — into the incidents involving the use of chemical weapons in Syria, and at the moment we are still trying to get the Organization for the Prohibition of Chemical Weapons (OPCW) to send its specialists to Syria to see for themselves the stockpiles of chemical weapons left by militants in liberated areas that the Syrian Government has discovered. By the way, during yesterday's consultations, following the reports of various recent incidents involving the use of toxic substances in Syria, which have yet to be verified, the representatives of the United States and the United Kingdom — without a second's pause or any evidence, let alone an investigation — hastened to declare them the work of what they refer to as the Syrian "regime". Now they are trying to drag Russia into it too. Secretary of State Tillerson brought this up in Paris today at the meeting of the so-called international partnership of States against impunity for the use of chemical weapons, basing his argument on an incident that allegedly occurred yesterday in eastern Ghouta. However, his statement was devoted almost exclusively to Russia. By the way, does nobody find it strange that this alleged incident, whose genuineness has yet to be confirmed — as does the identity of its perpetrators, if it is genuine — coincided very conveniently with the meeting in Paris and the forthcoming Syrian national dialogue conference in Sochi? An amazing coincidence. Some States are persisting in their attempts to push through an anti-Damascus verdict at the OPCW at all costs, and thereby undermining that respected organization's authority. Others are seeking to scrape together a narrow alliance of anti-impunity-ites through non-legitimate formats. In November of last year, Russia, working with others of like mind, put together draft resolution 23/01/2018 The situation in the Middle East S/PV.8164 18-01889 3/11 S/2017/968, which would have ensured that the JIM's activities conformed to the the high international standards of the Chemical Weapons Convention, which guarantee a genuinely impartial and professional investigation. The initiative was blocked by a number of delegations at the time. We want to rise above those differences and propose creating a new international investigative body that could establish the facts that the Security Council needs in order to identify those who used toxic substances as weapons, based on irreproachable, irrefutable information from transparent, credible sources. It must be professional and non-politicized. We have prepared a draft of such a resolution and ask that the Secretariat circulate it. We hope that Council members will study our initiative with their capitals as soon as possible. We are ready for substantive consultations. Mrs. Haley (United States of America): Russia has convened us with almost no notice, and then put forth a proposal that it hopes will distract from the new French initiative to hold accountable those who use chemical weapons. Today, Russia is again doing what it does best with regard to chemical weapons. It is running from the facts. It has the audacity to lecture the Security Council about how to stop the use of chemical weapons. I know that I have said this before, but it is worth repeating. In the past year, Russia exercised the right to veto three times to kill the Organization for the Prohibition of Chemical Weapons-United Nations Joint Investigative Mechanism (JIM) in Syria. All by itself, Russia killed the Mechanism, which we had specifically tasked with identifying those responsible for using chemical weapons in Syria. Russia should look in the mirror before bringing us into the Security Council to talk about chemical weapons. Earlier this week, we received yet another report that the Al-Assad regime had used chlorine gas on its own people. Dozens of civilians had to be treated for suffocation. Syrian children were literally gasping for breath as chlorine gas surrounded them. Of course, it is no coincidence that this week's chlorine-gas attack reportedly happened in the exact place that the Al-Assad regime is trying to take over militarily. We know that it resorts to such brutal tactics when it wants to retake territory, without any regard for innocent civilians, and we know that Russia has looked the other way for years while its Syrian friends use those despicable weapons of war. Russia is complicit in the Al-Assad regime's atrocities. Will the representative of the Russian Federation say anything at all today about the suffering caused by Al-Assad's barbaric tactics? Will it hold Al-Assad to account? Of course not. It never does. It is therefore fitting that Russia brought us here on the same day that a new initiative on accountability for chemical weapons has been introduced in Paris. Today, France launched an international partnership against impunity for chemical weapons. We strongly support that effort and commend France for its leadership. More than 25 like-minded countries have come together to share and preserve information on who has used chemical weapons and to make sure that the perpetrators will be held accountable. Make no mistake — the United States, together with the Council, will continue to pursue those who have used chemical weapons to ensure that they are held accountable for their atrocities. Russia says that it has concerns about this French initiative to share evidence of the use of chemical weapons. That is no surprise. Russia opposed the Joint Investigative Mechanism because it collected facts about who used chemical weapons in Syria. Now Russia is questioning the French effort to collect facts on who used chemical weapons. What can we conclude? To put it simply, when Russia does not like the facts, it tries to distract the conversation. That is because the facts come back over and over again to the truth that Russia wants to hide, which is that the Al-Assad regime continues to use chemical weapons against its own people. Today, Russia once again threw around many different accusations. Again, that is not surprising. Russia often puts out misleading and unfounded claims to confuse the conversation about chemical weapons. In fact, this happens so often that we recently wrote to the Security Council with a detailed assessment of Russia's misleading claims. The letter is public and available for anyone to see. We encourage everyone to take a look at it for themselves. Here is the bottom line. The Security Council gave the Joint Investigative Mechanism a mandate to tell us who used chemical weapons in Syria. When investigators found the Islamic State in Iraq and the Sham to be responsible, Russia was fine. When the investigators found that the Al-Assad regime had used them, Russia tried to find any excuse to poke holes in the investigation and threw up smoke to question the findings. But hat is not how independent investigations work. You do not get to question the findings when they do not go your way. We are therefore not going to accept any Russian proposal that undermines our S/PV.8164 The situation in the Middle East 23/01/2018 4/11 18-01889 ability to get to the truth or that politicizes what must be an independent and impartial investigation. If the Russians want to work in good faith towards that goal, we are ready to re-establish the JIM, with its original, independent and impartial mandate, right now. But anything less is unacceptable. To be crystal clear: the United States supports accountability for anyone who uses chemical weapons. We agree with Russia that the Islamic State in Iraq and the Sham must be held accountable for its use of such weapons, as the Joint Investigative Mechanism has found. But the difference between the United States and Russia is that we believe that no one should be let off the hook. Chemical weapons must never be used. Russia can continue to talk for as long as it wants about chemical weapons. It can bring it up in the Security Council Chamber as often as it wants. We welcome the debate. The United States and the international community will not be fooled. We remain steadfast in pursuing accountability for those who use chemical weapons. We stand strong in doing all we can to preserve the norm against their use. We remain forever committed to preserving the truth about what the Al-Assad regime has done in Syria and, sadly, what it will likely continue to do. Mr. Delattre (France) (spoke in French): We meet today after receiving news about another chemical attack in Syria — this time in Douma — which resulted in more than 20 victims, including women and children. Furthermore, the attack was penetrated in a de-escalation zone. We are closely following all available information. We expect that the international investigative mechanism in place — in particular the Fact-finding Mission — will shed light on the attack. As we commemorate the one hundredth anniversary this year of the end of the First World War, during which chemical weapons produced on an industrial scale were used for the first time in history, repeated chemical-weapon attacks in Syria are an affront to the human conscience and a violation of the most fundamental norms of international law. The facts prove that the scourge continues to exist. Last year in Syria, on 4 April, more than 80 people, including women and children, were killed by a powerful nerve agent. Four years prior, 2,000 Syrian civilians were gassed in Ghouta with sarin gas. The use of chemical weapons was confirmed by the Organization for the Prohibition of Chemical Weapons (OPCW). The OPCW-United Nations Joint Investigative Mechanism (JIM) clearly determined that the Syrian regime and Da'esh were responsible for those attacks. France itself independently confirmed that the Syrian regime was responsible for the attack perpetrated on 4 April. Since 2013, investigations have revealed more than 100 allegations of the use of chemical weapons, primarily in Syria but also in Iraq and Malaysia. Chlorine gas, sarin, mustard gas and VX — all deadly nerve agents — have returned to the forefront of the international arena a century after the horrors of the First World War. Gruesome images of the victims of such weapons of terror, which we thought we had long ago left behind, have also resurfaced. We cannot allow the use of such loathsome weapons to become commonplace. They destabilize entire regions and threaten everyone's security. They increase the risk of chemical terrorism, which we all fear. They also weaken the regime against chemical weapons as well as the entire non-proliferation regime. They undermine international law and call into question the outcome of international forums that have been held for decades. That is why we must take action. We owe it to history; it is a responsibility we must shoulder together. Those of us who claim to be committed to the non-proliferation regime and helped to build it should bear that in mind. Let us be clear: those who hamper our efforts to combat impunity endorse de facto impunity for the perpetrators of such chemical attacks. They prevent us from deterring and bringing to justice those who participated in chemical-weapon programmes and those Governments and entities that give the orders to carry out attacks. We therefore cannot turn a blind eye and allow them to continue — and all the more so, and I repeat this, given that the chemical-weapon non-proliferation regime is the most developed and successful of all international non-proliferation regimes. Allowing it to be weakened without taking action would be tantamount to accepting the erosion of the entire non-proliferation regime on weapons of mass destruction, which we built together, step by step, over decades and which now serves as the backbone of the international security architecture and one of multilateralism's main accomplishments. France has therefore proposed the establishment of a new international partnership to combat impunity for the use of chemical weapons by anyone — State and non-State actors alike. That partnership was launched yesterday in Paris at a conference convened by the 23/01/2018 The situation in the Middle East S/PV.8164 18-01889 5/11 French Minister for Foreign Affairs, Mr. Jean-Yves Le Drian, at which representatives of 24 States were in attendance to reiterate their willingness to work together to counter the threat. I should like to mention just a few of the partnership's ambitious commitments. They include the transfer and sharing of information, when possible, about the perpetrators of attacks; a commitment to impose national or international sanctions against entities and individuals concerned; assistance for building State capacity with regard to designations and sanctions; and the publication of a single, consolidated list of the names of individuals involved in attacks. Criminals who claim responsibility for developing and using such barbaric weapons must know that they will not go unpunished. Once again, this is about the future of the entire collective security system. One should not be able to violate the most basic norms without eventually facing the consequences. Owing to obstruction on the part of certain countries, we were unable to renew the JIM's mandate at the end of last year. Yesterday's consultations on Syria confirmed that an overwhelming majority of the members of the Security Council do not agree with the current impasse. In that regard, we take note of the proposal made today by Russia. We will consider it in the light of the principles I have just outlined. The new partnership launched in Paris does not aim to replace international instruments and the investigative mechanism established by the United Nations and the OPCW. Instead, it seeks to complement and bolster that structure by making a new operational instrument available to the multilateral system and the international community. It will assist investigations and help the international justice system in its work. It is neither an anti-Syrian instrument nor an exclusive club of countries. All countries can join this pragmatic and open partnership by adhering to its statement of principles. Through the partnership, they will show their commitment to law, international stability, justice and security in order to end impunity for the perpetrators of chemical attacks and their accomplices. We must therefore work through the partnership to consolidate the regime prohibiting chemical weapons. The cornerstone of the partnership was laid in Paris and embodies our faith in effective and demanding multilateralism. In an effort to take immediate action, I can confirm that France has imposed asset-freezes on networks involved in the proliferation of chemical weapons in Syria. In conclusion, I recall that there will be no justice or sustainable peace in Syria without putting an end to impunity. How can we continue to defend the regime and reiterate its willingness to speak in good faith and seek a political solution when that very same regime employs barbaric weapons against its own people? There has never been a larger gap between words and deeds. At the United Nations in both Vienna and Geneva, I said that we must work together to reach a political solution in Syria. Implementing an inclusive political solution as outlined in resolution 2254 (2015), which serves as our guidepost now more than ever, will depend upon a neutral environment in Syria guaranteed by the regime's clear commitment to credible constitutional change and democratic elections. It is the only way to permanently end the suffering of Syrians. We continue to believe that we can, and must, bring the Security Council together to proceed in that direction. Mr. Allen (United Kingdom): When I heard today that Russia had called for an urgent meeting on the use of chemical weapons in Syria, I was glad that we could return to an issue on which the Council has a duty to ensure that those responsible are held to account. That duty is even more pressing today, because yet another heinous attack on civilians was reported yesterday to the Council by the Secretariat. In that attack, in Douma, in eastern Ghouta, at least 21 civilians were treated for symptoms consistent with exposure to chlorine. That followed another reported attack in eastern Ghouta on 13 January, affecting six people. In 2016, the Organization for the Prohibition of Chemical Weapons-United Nations Joint Investigative Mechanism (JIM) found in three cases that the Syrian regime had used chlorine gas to attack civilians. Last year, it found that the regime had used sarin in Khan Shaykhun. Now, as the regime is escalating its attacks on eastern Ghouta in an attempt to force the besieged opposition to surrender, we remain deeply concerned about continuing reports of the use of chemical weapons in Syria. In all of this, we should not forget that it was the regime's 2013 attack on eastern Ghouta, using sarin, that led to the Council's adoption of resolution 2118 (2013), which had the clear, unanimously endorsed aim of disarming Syria's chemical-weapon programme. Throughout that process, Russia has claimed to be acting as a leading Power, a guarantor. But when the Al-Assad regime deliberately ignored its obligation to stop using chemical weapons and continued to do so with careless regard for human life, Russia chose to S/PV.8164 The situation in the Middle East 23/01/2018 6/11 18-01889 abuse its power of veto to protect that regime. Russia says that it supported the renewal of the JIM mandate and that it was the rest of us who killed it, because we could not agree with Russia's terms. Yet Russia's proposed draft resolution would have removed the JIM's ability to investigate the Al-Assad regime, which has been found responsible for multiple attacks. Russia has made it clear several times that it will not support a new investigative mechanism as long as it has the power to hold to account a State Member of the United Nations, and it seems, from a rapid reading of the latest text, that this proposal is another attempt to shift attention to non-State actors. The Russians have even claimed that Syria is a signatory in good standing to the Chemical Weapons Convention. It is not. It has not completed its declaration. The Organization for the Prohibition of Chemical Weapons has repeatedly warned of inconsistencies, gaps and omissions. Russia has great influence over the Al-Assad regime. For the sake of the Syrian people and for preventing the future use of chemical weapons, we call on Russia to persuade its Syrian friends to get rid of their chemical weapons and comply fully with the Chemical Weapons Convention. By ending the JIM, Russia also stopped its investigations of chemical attacks by Da'esh. The investigators had found that those terrorists had carried out at least two such attacks. We condemn Da'esh unreservedly for its use of these vile weapons, which is yet another reason why we must defeat those terrorists once and for all. The United Kingdom was proud to join the international partnership against impunity for the use of chemical weapons led by our French colleagues today in Paris. The use of chemical weapons is barbaric, illegal under international law and must stop. We must ensure that we can re-establish a mechanism to ensure accountability. We all know where the obstacle to that lies. In response, we will only redouble our efforts to pursue accountability for these crimes. Mr. Van Oosterom (Netherlands): The Kingdom of the Netherlands is deeply shocked by the ongoing attacks using chemical weapons in Syria. The Secretariat briefed the Council yesterday on yet another alleged chemical-weapon attack, the second this month. Two surface-to-surface projectiles targeted eastern Ghouta, releasing what is suspected to be chlorine. The attack resulted in injuring 21 people through exposure to chlorine, of whom eight were men, six women and seven children. Furthermore, there are shocking estimates of 130 chemical attacks between 2012 and 2017, with more than 60 pending allegations of chemical-weapon use in Syria still to be investigated by the Organization for the Prohibition of Chemical Weapons (OPCW) and its Fact-finding Mission. The Netherlands condemns in the strongest terms the use of chemical weapons by any State or non-State actor. I would now like to make three points. First, accountability for the use of chemical weapons in Syria is neither optional nor negotiable. Secondly, it is unacceptable that four years after Syria joined the Chemical Weapons Convention, its declaration is still unable to be verified as accurate and complete. Thirdly, the Netherlands will use its membership of the Security Council to bring accountability to the fore. We regret the dismantling of the OPCW-United Nations Joint Investigative Mechanism (JIM). We were convinced of the professionalism and independence of the JIM's work, and its results still stand. The Council should shoulder its responsibility in that regard. In particular, the countries on the Council with influence on Syria should use it with the Syrian regime to convince it to refrain from further chemical-weapon attacks, acknowledge its past use of such weapons and complete its chemical-weapon declaration. As long as the Council remains deadlocked, our focus on accountability will not stop here. We will look for complementary measures so that impunity will not prevail. We therefore thank France for taking the initiative to establish an international partnership against impunity for the use of chemical weapons. The Netherlands participated in the meeting of the partnership that took place in Paris today. The Paris initiative aims to collect evidence of the use of chemical weapons anywhere in the world. It will enable States to take action to uphold the international norms against the use of chemical weapons. It represents a political commitment to increasing pressure on those responsible for the use of chemical weapons, and the Kingdom of the Netherlands is fully committed to that goal. Furthermore, the International, Impartial, and Independent Mechanism to Assist in the Investigation and Prosecution of Persons Responsible for the Most Serious Crimes under International Law Committed in the Syrian Arab Republic since March 2011; the Independent International Commission of Inquiry on the Syrian Arab Republic; and national prosecution in third countries, as well as sanctions, remain instrumental for achieving accountability for the crimes committed 23/01/2018 The situation in the Middle East S/PV.8164 18-01889 7/11 against the Syrian people. We must use all the tools available to us to achieve accountability. In conclusion, the Netherlands remains convinced that a referral of the situation in Syria to the International Criminal Court in The Hague is by far the best option for achieving accountability for the extremely serious crimes that have taken place in Syria. Mr. Skoog (Sweden): Yesterday the Council members were briefed by Under-Secretary-General Jeffrey Feltman on yet another alleged chemical-weapon attack in Syria. Allegations of the use of such weapons continue to be reported. There are some 60 cases of the reported use of chemical weapons in Syria that are currently being examined by the Organization for the Prohibition of Chemical Weapons (OPCW) and that its Fact-finding Missions continue to investigate and report, including a case of a sarin attack in Lataminah in March of last year. I would like to reiterate once again that Sweden condemns the use of chemical weapons in the strongest terms. It is a serious violation of international law and its use in armed conflict amounts to a war crime. Bringing the perpetrators of such crimes to justice remains a high priority. There must be no impunity for those responsible. That is why we participated in the meeting of the international partnership against impunity for the use of chemical weapons held today in Paris. As a member of the Council and the OPCW Executive Council, Sweden attaches great importance to all international efforts to combat the use and proliferation of chemical weapons by State and non-State actors alike, anywhere in the world. We trust that the French initiative will complement and support our collective work in multilateral forums, as well as the existing multilateral mechanisms to achieve unity around those important goals. That also includes the Human Rights Council's Independent International Commission of Inquiry on the Syrian Arab Republic and the International, Impartial and Independent Mechanism for the Syrian Arab Republic, which play an important role in collecting information. It was highly regrettable that the Council was not able to agree on an extension of the Organization for the Prohibition of Chemical Weapons-United Nations Joint Investigative Mechanism. It is a critical to establish a similar new impartial and independent attributive mechanism now. The Council needs to come back together and speak with one voice. We need to be forward-looking and overcome our differences with a view to protecting the international disarmament and non-proliferation regime and ensuring accountability. That should be possible if everyone engages seriously, constructively and genuinely in good faith. We stand ready to engage in such efforts in order for the Council to fully shoulder its responsibilities. Ms. Wronecka (Poland): We are deeply concerned about the reported use of chemical weapons in eastern Ghouta, which is in clear violation of international law and deserves condemnation in the strongest possible terms. This alleged use of chemical weapons, as with other incidents, including in Talmenes, demonstrates the need to hold perpetrators accountable. There is no space for impunity in this regard. We support taking all the necessary measures to fill the gap left by the Organization for the Prohibition of Chemical Weapons-United Nations Joint Investigative Mechanism, so as to ensure that no one goes unpunished for using chemical weapons, which cause unacceptable harm and suffering. Those responsible for chemical attacks must realize that they will be held accountable because their acts are an affront to all humankind and the basic rules of civilization. We support the tireless work done by the Organization for the Prohibition of Chemical Weapons. We are convinced that it is the responsibility of the Security Council to establish and maintain a suitable institution to investigate alleged cases of the use of chemical weapons. Let me take this opportunity to thank France for today's hosting of a high-level meeting to launch a new initiative to protect the core values underpinning the credibility of the non-proliferation regime on chemical weapons established by the Chemical Weapons Convention. Poland joined that new partnership with the sole purpose of using all the tools at our disposal to end impunity for those responsible for chemical attacks and to promote and complement existing standards and mechanisms against the use of chemical weapons. We look forward to working on this issue in the Council in the months to come. Mr. Tenya (Peru) (spoke in Spanish): The Security Council has the highly sensitive responsibility of contributing to the prevention of the use of chemical weapons, which entails identifying and prosecuting those responsible for atrocities such as the one perpetrated yesterday in Syria. S/PV.8164 The situation in the Middle East 23/01/2018 8/11 18-01889 Peru participated in the meeting convened by France today to establish a partnership to combat impunity for the use of chemical weapons, at which a declaration of principles was adopted. The document sets out a series of measures aimed at ensuring that individuals and entities responsible for the use of chemical weapons are brought to justice. During that meeting, Peru's Ambassador to France referred in particular to paragraph 3 of the terms of reference, which had been circulated in advance, wherein it is expressly stated that the purpose of the initiative is not in any way meant to replace, reproduce or supersede international inquiry and investigation mechanisms that serve the same purpose. Our Ambassador also expressed his satisfaction with those words, insofar as Peru, as a member of the Security Council and a member of the Executive Council of the Organization for the Prohibition of Chemical Weapons, encourages the necessary action to be taken by those competent bodies. Peru condemns in the strongest possible terms the lack of accountability in the continuing incidents involving chemical weapons in Syria, for we believe it undermines international regimes on the matter and weakens peace efforts in the region. Mr. Shen Bo (China) (spoke in Chinese): China expresses its grave concern about the use of chemical weapons in Syria and extends its deepest sympathy to the Syrian people for their suffering. China's position on chemical weapons has been clear and consistent. We firmly oppose the use of chemical weapons by any country, group or individual for any purpose and under any circumstances. The use of chemical weapons is unacceptable, whenever or wherever they are used. China supports a comprehensive, objective and fair investigation into such incidents in order to arrive at a conclusion that can stand the test of time and to shed light on the facts in order to bring the perpetrators to justice. China welcomes the draft resolution circulated by the delegation of the Russian Federation that would establish a new investigative mechanism on Syrian chemical weapons. China appreciates the efforts made by Russia in the Security Council to continue to advance the work on the Syrian chemical weapons issue. China will seriously study the draft resolution and actively participate in consultations on it. It is imperative to establish a new investigative mechanism to find out the truth and to deter further use of chemical weapons in Syria. We hope that Council members will participate in the consultations in a constructive manner and strive to reach consensus on the establishment of a new mechanism. The Syrian chemical weapons issue is closely linked to a political settlement to the Syrian question, and it requires a comprehensive, balanced and integrated approach. China supports the role of the Security Council and of the Organization for the Prohibition of Chemical Weapons as the main channel for achieving an appropriate resolution to the Syrian chemical weapons issue. We hope that all the relevant parties will adopt a constructive attitude and seek appropriate solutions during consultations. We must maintain the unity of the Council and coordinate with the relevant parties in an effort to actively promote the political process in Syria. Mr. Llorentty Solíz (Plurinational State of Bolivia) (spoke in Spanish): Bolivia reiterates its strong, categorical condemnation of the use of chemical weapons and chemical substances as weapons as unjustifiable and criminal acts — wherever, whenever and by whomever they are committed. We believe that there can be no justification for the use of such weapons, regardless of the circumstances and of who uses them, as it constitutes a serious crime under international law and a threat to international peace and security. We emphatically condemn the reported use of chemical weapons in the city of Douma, in eastern Ghouta. That incident must be investigated in order to identify the perpetrators, bring them to justice and ensure that their actions do not go unpunished. Accordingly, we reiterate our support for the work carried out by the Organization for the Prohibition of Chemical Weapons and its Fact-finding Mission in the Syrian Arab Republic. However, as we have stated on other occasions, we emphasize the urgent need for an investigative mechanism with a clear mandate that can carry out its assigned tasks of investigating methodically, transparently, technically, faithfully, with assistance and in a fundamentally depoliticized way. We must have a mechanism that can develop an independent, impartial, complete and conclusive investigation to hold accountalbe those responsible for such horrific crimes. We believe that, if what we want is an independent and transparent mechanism, we have the challenge of not exploiting the Security Council by bringing geopolitical interests on the ground into the Chamber. We have 23/01/2018 The situation in the Middle East S/PV.8164 18-01889 9/11 the challenge of demonstrating to the international community the unity of the Council. To that end, we must not turn the Chamber into a sounding board for warring confrontation and, even less so, transfer the immediate interests of the battlefield to this setting. In that regard, we welcome the proposal put forward by the Russian Federation today. We will study the text, and we hope that consultations will be convened as soon as possible and that they will result in the Council and the international community having on an independent investigation mechanism. It is essential that we overcome the lack of trust that exists in the Council. Furthermore, we must always bear in mind that no initiative, however well intended, should supplant our responsibilities, as established by the Charter of the United Nations. Mr. Alotaibi (Kuwait) (spoke in Arabic): The ongoing use of chemical weapons in Syria represents one of the deplorable elements of this crisis, which has been continuing for seven years. It is all the more deplorable when we see that there is an absence of justice and accountability and that there is impunity for every criminal who has contributed to and participated in such crimes against civilians. Following the attack when chemical weapons were used in Ghouta, where most of the victims were civilians, we witnessed the unity of the Council in ensuring that such a crime would not be repeated and that perpetrators would be held accountable through the adoption of resolution 2118 (2013). However, unfortunately, we note that there are still reports of chemical attacks in Syria, most recently by Mr. Jeffrey Feltman, Under-Secretary-General for Political Affairs, yesterday regarding a chemical attack on the city of Duma on 13 January. We would therefore like to express our disappointment that the Security Council has been unable to reach consensus on renewing the mandate of the Organization for the Prohibition of Chemical Weapons-United Nations Joint Investigative Mechanism, which, we believe, carried out its work in a professional, impartial and independent way. As a result, the failure to renew the mandate meant the complete absence of a tool for accountability in Syria. For that reason, the perpetrators of such crimes will go unpunished and there is no guarantee of holding them, or any perpetrator of such crimes in future, accountable. The State of Kuwait has a firm, principled position strongly condemning any use of chemical weapons at any time, anywhere and by anyone, since the use of chemical weapons is a grave violation of international law. We underscore the need to hold perpetrators — individuals, entities, non-State groups or Governments — accountable. As members of the Security Council, we are responsible for maintaining international peace and security. We must therefore seek alternatives and mechanisms, agreeable to all members of the Security Council, to ensure the independence, impartiality and professionalism of any new future mechanism to ensure that criminals are held accountable. We note that there is a draft resolution before us on establishing a new mechanism. We recall the clear and decisive language in resolution 2118 (2013), which stipulates the need to hold accountable those responsible for the use of chemical weapons in Syria. In that regard, the State of Kuwait welcomes the French initiative to convene the Paris meeting on an international partnership against impunity for use of chemical weapons. Along with a number of countries, the State of Kuwait participated in that event to underscore the importance of strengthening the values of justice and accountability and to implement the principle of ending impunity. We support the international mechanisms established by the General Assembly and the Human Rights Council to gather evidence regarding any crimes related to human rights violations in Syria. In conclusion, we emphasize that it is important for the Security Council to stand united when dealing with issues that threaten international peace and security, such as the incidents mentioned in reports on the Syrian crisis, through the unanimous adoption of such resolutions as resolution 2118 (2013), on chemical weapons; resolution 2165 (2014), on the humanitarian situation; and resolution 2254 (2015), on the political track of the Syrian crisis. Mr. Tanoh-Boutchoue (Côte d'Ivoire) (spoke in French): My delegation thanks the Russian Federation for having called for this emergency meeting of the Security Council with a view to once again discussing the issue of the use of chemical weapons in general, and in Syria in particular, where, it seems, that atrocious weapon is being used. My country, which is opposed to the use of chemical weapons, ratified the Convention on the Prohibition S/PV.8164 The situation in the Middle East 23/01/2018 10/11 18-01889 of the Development, Production, Stockpiling and Use of Chemical Weapons and on Their Destruction in order to show the world our determination to work with other international stakeholders for the complete elimination of such weapons. To that end, on this very day, 23 January, we signed in Paris the declaration of principles, issued by the meeting held at the initiative of France on the topic of combating impunity through the international partnership against impunity for the use of chemical weapons. Côte d'Ivoire extends its full support to that initiative and vehemently condemns any use of chemical weapons, regardless of the reasons or perpetrators. In firm support of the values of equity and justice, Côte d'Ivoire wishes to draw the attention of the Security Council to the need to set up a new consensus mechanism aimed at combating the use of chemical weapons. In that regard, we welcome the Russian initiative to propose the establishment, by means of a resolution, of a new mechanism. We assume that such a mechanism, like the previous one, would be tasked with identifying perpetrators of the use of chemical weapons, in general. In the specific case of Syria, the perpetrators of such acts must be identified and be held accountable for their actions. Inaction by the Council on this important issue would be a bad sign and send a message of encouragement to those who indulge in the use of chemical weapons with impunity. To conclude, my delegation calls on the Council to act in a consensus-based and coordinated manner in order to establish a new mechanism, for our action must prompt us not only to protect and to help victims, who are martyrs in the endless war in Syria, but also to work to uphold international peace and security. Mr. Ndong Mba (Equatorial Guinea) (spoke in Spanish): The use of chemical weapons, the issue we are considering is critically important to the Republic of Equatorial Guinea. We categorically repudiate and condemn their use by any country, State or non-State actor. We also condemn in the strongest terms the recent chemical-weapon attacks in Syria. With regard to the issue of who is responsible for the use of such weapons, there is no consensus among the members of the Security Council on that. We realize that the Security Council must address the issue of the use of chemical weapons in a spirit of understanding and unanimity, with a view to combating impunity, thereby sending an unambiguous message to anyone who has used such weapons or is thinking of doing so that they will be held responsible for their actions. We repeat that we categorically condemn the production, stockpiling and use of chemical and other weapons of mass destruction. If we are to take steps against those who have used such weapons, we must clearly identify the responsible parties in a way that leaves no room for doubt. That is why, given the lack of consensus among the members of the Council and the need to identify those responsible for the use of such weapons, we are of the view that the proposal that the Russian Federation has just made is worth considering as a new opportunity for conducting a fully transparent investigation whose results all Council members would have to accept, thereby fostering the unanimity and consensus within the Council that would enable it to take the necessary steps against the perpetrators of the heinous act of using chemical weapons. The President: I shall now make a statement in my national capacity as the representative of Kazakhstan. We are deeply worried about the fact that chemical weapons continue to be used in Syria. It is regrettable that this inhuman and illegal type of weapon is being used with the specific purpose of intimidating ordinary people, since it mostly affects unprotected civilians. Another discouraging fact is the lack of unity and the deepening confrontation among the parties on the chemical dossier, which complicates our ability to address this threat in an appropriate way. It is therefore urgent to start thinking about developing a new investigative tool that can effectively counter all such chemical crimes. Any delay or inaction on the part of the Council could lead to an increase in the commission of such acts in the absence of clear plans and mechanisms to end impunity. We welcome the Russian Federation's proposal to establish a new mechanism, giving us a new opportunity to look into the matter. Since we will have to start over with the creation of an investigative mechanism, we must try to get it right from the very beginning, on a basis of consensus. The mechanism should be impartial, depoliticized, professional, representative, and with a clear mandate that will preclude any doubts and ensure the credibility of its work. That does not mean that we think the previous mechanism was unfit for its purpose, but it is obvious that accountability requires a Security Council that is united in its decision-making. 23/01/2018 The situation in the Middle East S/PV.8164 18-01889 11/11 Kazakhstan is ready to contribute and to assist in finding the best way to move forward together. I now resume my functions as President of the Council. The representative of the Russian Federation has asked to make a further statement. Mr. Nebenzia (Russian Federation) (spoke in Russian): I am taking the floor to further clarify our position. It is a pity that my friend Mrs. Haley has left the Chamber. She mentioned that we convened this meeting today on short notice, for which I apologize. As I recall, however, we have frequently been convened by Mrs. Haley's call, and we are ready to do it again. Please let her know that I am doing it because I am always very pleased to see her here. Once again, everything that we heard from the United States in its statement today was about Russia. The fact that it is rejecting our proposed draft resolution from the get-go says a great deal. It once again betrays a truth that we are sadly familiar with. The United States has no need of any independent professional mechanism. It is not only betraying a truth, it is betraying itself in the eyes of the international community. Let me say straight out what I spoke about before in a rhetorical question. It was no accident that the allegations — which will remain allegations until they are confirmed — about the use of chemical weapons in eastern Ghouta emerged on the eve of some important political events for Syria, the meeting in Vienna and the Syrian national dialogue conference in Sochi. Furthermore, I will say it again, why does the United States need an investigative mechanism when both yesterday and today, before any kind of investigation, it asserted, without apparently a shadow of doubt, that it was the Syrian Government that did it? It has taken the role of both judge and prosecutor. Does the United States at least understand that it is betraying itself by this? If it genuinely wants to establish a professional, independent attributive mechanism, it should at least read the draft resolution before rejecting it. Did we not discuss a new mechanism with Council members of the Council at the conclusion of the multiple acts in the political spectacle surrounding the closure of the Organization for the Prohibition of Chemical Weapons-United Nations Joint Investigative Mechanism? We did not time our draft resolution to coincide with any events or partnerships. However, I want to reiterate something that I spoke about at a Council meeting presided over by President Nazarbayev on 18 January, which is that no commissions, partnerships or so-called independent mechanisms in this area can be legitimate unless they are approved by the Security Council. That must be our premise. I would like to echo what the Permanent Representative of Sweden — and he was not the only one — said in his statement, which is that we must overcome our differences, engage in dialogue and try to restore the Council's lost unity. That is the aim of our proposal. The meeting rose at 4.10 p.m.
Issue 20.1 of the Review for Religious, 1961. ; Volume 20 1961 EDITORIAL O~FICE St. Mary's College St. Marys, Kansas BUSINESS OFFICE 428 E. Preston St. Baltimore 2, Maryland EDITOR R. F. Smith, S.J. ASSOCIATE EDITORS Augustine G. Ellard, S.J. Henry Willmering, S.J. ASSISTANT EDITORS John E. Becker, S.J. Emile G. McAnany, S.J. DEPARTMENTAL EDITORS Questions and Answers Joseph F. Gallen, S.J. Woodstock College Woodstock, Maryland Book Reviews Earl A. Weis, S.J. West Baden College West Baden Springs, Indiana Published in January, March, May, July, September, Novem-ber on the fifteenth of the month. REVIEW FOR RELI-GIOUS is indexed in the CATHOLIC PERIODICAL IN-DEX. JOHN XXIII Devotion to the Precious Blood [The following is an English translation of the Latin text of the apostolic epistle Inde a prirais, which Pope John xxIiI issued on June 30, 1960, concerning the fosterihg 6f devotion to ~the Precious Blood of Christ. The original text oF the docu-ment is to be found in Acta Apostolicae Seitis, 52 (1960), 545-50.] From the first months of Our pontifical labors, it oc-curred to Us again and again--and our. solicitous~ and plain-spoken words have often been an indicatioh of Our future intentions--that when daily practices-of religious piety were to be discussed, We would invite the faithful to an ardent honoring of that reality which in a remark-able way manifests the mercy of God for the souls of men, for holy Church, and for the entire ~orld~. We would in- ' vite them, in other words, to a special veneration of the Precious Blood of Christ Jesus, our Redeemer and our Savior. ~' We Ourselves became accustomed to this devotion in the home in which We were raised. Even today it is with happiness that We recall that every day during the month of July Our parents used to recite at home the litanies of the Precious Blood. Following the apostolic exhortation, "Take heed"to yourselves and to the entire flock whereof the Holy Spirit has made you bishops for the ruling of the Church of God which he acquired by his own blood" (Acts 20:28), We have decided, venerable Brethren, that the principal and pressing duties of Our pastoral office demand that We first of all take care of sound doctrine and secondly that We provide for the right exercise and conduct of religious piety, both" in its public and its° private manifestations. For this reason it hag.seemed to Us opportune to exhort Our sons to consider the indissoluble bond which should link the two widely diffused devotions to the Holy Name of Jesus and to the Sacred Heart of Christ with the're-. ligious homage to be offered to the Precious Blood of the Incarnate Word which was poured forth "for man~ for a remission of sins" (see Mt 26:28). ÷ ÷ ÷ D~votion to Precious Blood VOLUME 20, 1961 4, 4, ]olm XXIH REVIEW FOR RELIGIOUS 4 Just as it is of the utmost importance that the liturgical action of the Church should be in full accord with the profession of the faith;since "the law of belief determines the law of prayer";1 and just as no forms of piety should be introduced which do not flow from the purest fonts of the truths of faith; so it is also right that the various types of devotions should agree among themselves. It is actually necessary that those forms of piety which are re-garded as the most important and which are more apt for the attainment of holiness should in no way disagree with or oppose each other. It is likewise necessary that the forms of piety which from the viewpoint of value and of use are of limited and minor importance should yield ground to those forms which contribute more to the ob-taining of the salvation that was accomplished by Him who is "the mediator between God and men, the man Christ Jesus, who gave himself as a redemption for all" (1 Tim 2:5-6). If the faithful derive the driving forces of their personalities and the discipline of their lives from a correct faith and a sane piety, then they can be assured that they are thinking with the Church and that through their union of prayer and their charity they are clinging to that Christ Jesus who is the Founder and High Priest of the lofty religion which derives its name, dignity, and power from Him. Even if only a hasty glance be directed to the admirable new emphases that the Church has attained in the field and area of liturgical piety--and such emphases are in full accord with that salutary progress of the faith wards a fuller understanding of divine truth-~it becomes consolingly clear that in the last few centuries this Aposto-lic See has often and openly approved and recommended the three religious devotions We have already mentioned. Although these devotions had been introduced into the practice of Christian living by a number of the faithful during the Middle Ages and although they were after-wards propagated in various dioceses and in various re-ligious orders and congregations, yet it was necessary that the authority of the Chair of Peter should intervene in order that these practices might be declared to be in ac-cord with Catholic faith and that they might be extended to the universal Church. It will be sufficient to recall here that from the. sixteenth century Our predecessors had bestowed spiritual benefits on the devotion to the Holy Name of Jesus which in the previous century St. Bernadine of Siena had untiringly propagated ~hroughout Italy. In honor of this Holy Name an Office and a Mass were first approved, then a litany.~ x See the encyclical Mediator Dei, Acta Apostolicae Sedis, 39 (1947), 54. t See .4cta Sanctae Sedis, 18 (1886), 509. fewer were the benefits with which the P~oman Pon- :iffs promdted the devotion to the Sacrffd 'Heart of Jesus, devotion that was so greatly helped to its achievement its full and complete form and its universal propaga-aon by those matters whlcti~were~,made clear'to St. Mar-garet Mary Alacoque by Christ when He appeared to her showing her His Heart. With admirable unanimity the Roman Pontiffs have honored this religious practice not only by pointing out its power and its nature but also by declaring its legitimacy and by promoting its use through-out the entire world~a All this has been done in many public documents of the Church, the three most impor-tant of which are three encyclicals devoted' t6 this topic.4 As was only right, the consent and the approval of this Apostolic See were not lacking for the devotion to the Precious Blood of Christ, the remarkable promoter of which in the last century was St. Gaspar del Bufalo, priest of the Roman clergy. In this connection it will be remem-bered that at the command of Benedict XIV a Mass and an Office were composed in honor of the adorable Blood of the Divine Redeemer; Moveover, Plus IX, in order to fulfil a vow made to God at Gaeta, ordered this liturgical ¯ feast to be extended to the universal Church.5'Finally the Supreme Pontiff of happy memory, Pius XI, raised this feast to a double of the first class in order to per-petuate the memory of the jubilee which took place on the occasion of the nineteen hundredth anniversary of the' redemption of the human race. He did this because he was convinced that the increased solemnity of the feast would foster a deeper devotion to the~: Blood of the Re-deemer and that thereby more abundant effects of the same divine Blood would result for mankind. We were but~ following the example of Our predeces-sors when, in order that devotion to the Precious Blood of Christ, the immaculate Lamb, might grow an, d flourish, We approved its litanies as properly set forth by' the sacred .congregation8 and recommended to the entire Christian family the private and public recitation of the same by attaching to them special indulgences.7 Our de- 8 See the Of?ice o! the Feast of the Sacred Heart, Second Nocturn, Fifth Lesson. *The encyclical Annum sacrum in dcta Leonis, 19 (1899), 71 ft.; the encyclical Miserentissimus Redemptor in Acta Apostolicae Sedis, 20 (1928), 165 ft.; and the encyclical Haurietis aquas in Acta Aposto-licae Sedis, 48 (1956), 309 ft. ~See the decree Redempti sumus of August 10, 1849, in the Ar-chives of the Sacred Congregation of Rites, decrees for the years 1848--49, folio 209. e See Acta Apostolicae Sedis, 52 (1960), 412-13. ¢ Decree of the Sacred Apostolic Penitentiary of March 3, 1960, in Acta Apostolicae Sedis, 52 (1960), 420. 4. 4. 4- Devotion to the Precious Blood VOLUME 20, 1961 4. 4. John XXIII REVIEW FOR RELIGIOUS 6 cision in th~is matter, pertaining as it did to the solicitude for all the churches (see 1 (]or 11:28) which is proper to the .Supreme. Pontiff, was prompted by the hope that in these days of great and pressing spiritual needs the faith-ful might continue to increase their respect for those three forms of Christian piety which We previously praised and that they come to see them as possessing a perpetually salutary power of effectively promoting the spiritual life. Since the feast and month are now approaching which are dedicated to the Blood of Christ, the price of our re-demption and the pledge of a salvation and of a life that will never fail, the faithful should meditate on this Blood with renewed fervor and should partake of it by more frequent reception of the sacrament of the Eucharist. Il-luminated by the light which comes from the profitable admonitions of Sacred Scripture and from the precepts of the holy fathers and doctors of the Church, they should recall how abundant and limitless is the power of this truly Precious Blood, "one drop of which is able to wash the entire world from every sin," as holy Church sings t.hrough the lips of the Angelic Doctors and as was wisely confirmed by Our predecessor, Clement VI.0 The power then of the Blood of Christ, God and man, is infinite; infinite too is the love which moved our Re-deemer to pour it forth for us. This shedding of His Blood began .eight days after His birth when He was cir-cumcised. Later it was shed more copiously when being in agony in Gethsemani, He prayed the longer (see Lk 22:43), when He was scourged and crowned with thorns, when He climbed the hill of Calvary and was there affixed to the cross, and when at the end His side was opened by a great wound which was to be the sign of the divine Blood that flows out into the sacraments of the Church. All these events show that it is not only fitting but even highly necessary that all the hithful, reborn as they have been in the streams of this Blood, should adore it in a spirit of religious homage and should honor it with their love. It is most salutary and entirely fitting that the worship of adoration which is due to the chalice of the Blood of the new ~fid eternal testamefit, especially when it is ele-vated in the Eucharistic sacrifice for the worshipful gaze of the faithful, should be followed by the reception of that Blood. This is possible, because in the sacrament of the Eucharist the Blood of Christ is received since it~is joined by an indissoluble bond to His Body. Joined in mind with the priest, the faithful who attend" Mass can In the hymn ddoro te devote. See the bull Unigenitus Dei Filius of January 25, 1343, as cited in Denzinger-Rahner, n. 550. most properly repeat to themselves the words which the priest says at the time of his sacred Communion: "I will take the chalice of salvation and I will call upon the name of the Lord . The Blood of our Lord Jesus Christ guard my soul unto life e~ei:nal, Ameh." There can be no doubt that in this way the faithful, whenever they wor-thily approach the sacred synaxis, will receive a more abundant, share of those fruits of the redemption, of the resurrection, and of eternal life which the Blood offered by Christ "throu.gh the Holy Spirit" (Heb~9:14)~acquired fbr all the family of mankind:Nourished by the Body and Blood of Jesus Christ and sharing in that divine power of His which has raised up in the Church numberless ranks of martyrs, the faithful will find it easier to bear ~the labors and troubles of everyday life; and should it be necessary for the sake of Christian virtue~and the kingdom of God, they will even sacrifice their lives, for they will be burning with that ardent love which caused St. John Chrysostom to exclaim in his writings: "Let us come back from the table as lions, breathing fire, terrible to the devil, realizing who our Head i~ and how great a love He has shown for us . This Blood ~hen it is worthily re-ceived, drives out the devils and _calls to our side the angels and even the Lord of the angels.~. This Blood when it was poured forth Washed the entire world . It is the price of the world; it is that b~ which Christ bought His Church . These thoughts will moderate our passions. How long will we cling to present things? How long will we refuse to be aroused? How~lo.ng will we take no care of our salvation? Let us reflec( what honors God has be-stowed on us;.a.n.d then letus give thanks and give back glory not only by our faith but also by our deeds.''x° It is to be hoped that those ~ho are honored by the name of Christian will frequently consider the fatherly exhortation of the first Supreme Pontiff when he wrote: "Spend the time of your sojourn here in reverence, in the realization that you were redeemed not by gold or silver., but by the precious blood of Christ, as of a lamb without blemish and without spot" (I Pet 1:17-19). May they also.listen closely to the Apostle of the Gentiles when he says: "You have been purchased at a great price. Glo-rify God then and carry Him in your body" (1 Cor 6:20). If all the faithful take these texts to heart, then their way of life by which they should be an example to others will become more noble and more fitting. Thus it will come about that the Church, strengthened by such virtue, will carry out its earthly task to the profit of the human race. Men, peoples, and nations will be joined by a close bond of brotherly love, if they will yield themselves to the move- See Homily 46 on the Gospel o] John in Migne, Patrologia Graeca, 59, 260-61. + + + Devotion to the Precious Blood VOLUME 20, 1961 ments of the grace of that God who wishes all men to be ¯ saved (see 1 Tim 2:4), who has willed the redemption of them all in the Blood of His only begotten Son, and who hag called all of them to become members of the one Mystical Body whose Head is Christ. Civil society itself will thereby enjoy a serene peace; and human nature, which was created to the image and likeness of its Maker (see Gen 1:26), will become yet more worthy of God. It was to a consideration of this lofty dignity to which mankind has been divinely called that St. Paul exhorted those converted Jews who were too much attached to the institutions of the Old Testament even though the latter was but a dim figure and image of the New Testament: "You have come to Mount Sion, to the city of the living God, the heavenly Jerusalem, to the companionship of many thousands of the angels, tb the comunity of the first-born who are now citizens of heaven, to God, the judge of all things, to the spirits of the just who have been made perfect, to Jesus the mediator of the new covenant, and to a sprinkling of blood that is far more eloquent than that of Abel" (Heb 12:22-24). We are certain, venerable Brethren, that Our fatherly exhortation, when communicated in the way you judge best to you.r people and your clergy, will be put into salu-tary and effective execution in a spirit of willing coopera-tion. Accordingly as a sign of heavenly gifts and as a pledge of Our special benevolence, We impart in full charity Our apostolic blessing to each and every one of you as well as to your flocks, especially to those who carry out Our desires with devoted alacrity. Given at Rome in St. Peter's, the thirtieth day of June, on the vigil of the Feast~ of the Precious Blood of our Lord Jesus Christ, in the year 1960, the second of Our pontificate. John XXIII REVIEW FOR RELIGIOUS CHARLES A. SC.HLECK, C.S.C. The Sister in the Church When something good, nobie, and sublime is called into question or becomes obscure, it usually calls into existence an immense amount of thought,~reflection, and literature. Indeed, if we are to meet the demands of the situation fully and adequately, the whole matter of the entire reality must once more be subjected to a prolonged and meditative scrutiny. There is usually not so much a question of justifying its existence as there is of getting back to its roots, of elucidating and bringing into the light and clarity of the common vision the fundalnental and essential meaning of the institution in question. And this is especially true when this institution has been estab-lished by God or by His Church. What we feel in such a case is the need to see straight, or rather to see into the core and the heart of the reality itself. In the past such was true of several of the mysteries of divine revelation, the Incaination, fok example, the Trinity, grace, the divine motherhood. This calling of an institution into question together with" the consequent obscurity that almost destroys our appreciation of it has been common in our own day in the case of the Church herself, Mariology, the role of the laity in the Church, and Christian virginity or the religious sister in the Church. Consequently we witness today an outpouring of much labor, thought, and writing which, with more or less suc-cess, attempts in one way or another to penetrate into the divine reasons for the existence of such mysteries and their essential and basic meaning. And while each of these re-alities would certainly be a most interesting topic for our consideration, the one that is being singled out in the present .article is the institution of Christian virginity, or more precisely and exactly, the role of the religious sister in the Church. At the very outset we ought to note that one aspect of this vocation has rarely been called, into question or fallen into obscurity at least as far as the apostolic re- Thee Reverend Charles A. Schleck, C.S.C. teaches theology at Holy Cross College (seminary), 4001 Hare-wood Road N.E., Wash-ington 17, D.C. VOLUME 20~ 1961 9 ~. ~. sa,~, c.~.c. REVIE~ FOR RELIGIOUS lO ligious sister is concerned. And that is the utility, the contribution which such a vocation makes to one or other of the needs of our visible society. There are very few who would call into question the utility of the teaching, or of the care for the sick and the abandoned, or of the other spiritual and corporal works of mercy which form part and parcel of the various apostolates and missions entrusted to apostolic communities of religious women in the Church. In fact, the thought and the writing that has come forth in defense of the sister's vocation has tended to make this its principal and chief weapon. But when we come to another aspect of this vocation, one that touches the very soul of it and centers around the fundamental meaning of this vocation, then we find very few even among Catholics who understand what is perhaps the primary and basic mission of the sister in the Church. The proof of this, it seems, lies ih the fact that the question Ut quid perditio haec still remains in the minds of so many inside and outside the Church"To what avail is this loss of womanhood, this institution of virginity?" From the fact that this question mark still rematns and is even looming larger in certain areas of our country in spite of all the writing and speaking that has been done on the subject, we can conclude, without any kind iSf violence or exaggeration being done to the actual situation, that people by and large do not consider the collaboration in action with other institutions of so-ciety as a sufficient explanation of the vocation of the re-ligious sister. And that is a sobering thought; for these people are, perhaps, more right in their conviction or as-sumption than any of us ~ould be willing to admit. No, it is not the i'prose" of the sister's vocation that needs° clarification in the eyes of the world and in the minds of men, and perhaps even in tier own mind. It is rather the "poetry," so to speak, or the poetic symbolism of the life and mission of the sister in the Church that must be mole constantly and widely diffused both inside and ~outside the Church. For without that difftision we can not hqpe 'to make men see and love the vocation, the mission, or the role wl~ich God intends her to play in the Mystical Body Of the Church. We musi then ask ourselves the question: What is this "poetry" or this basic notion which lies at the very root of the sister's mission in the Chtirch? Only when we an-swer that question satisfactorily will we be able to di-minish and soften and, in the case of many, eliminate the objections which they raise against it. Only then can we hope to show those outside the Church and to very many inside, that the mission and the presence of the sister, far from being a block or an obstacle to the continuation of life, is itself a source of vitality and one of the most ex- cellent ins~truments by which the highest and most sub-lime form of life, if not perhaps begun, is nevertheless nourished, increased, protected, and safe-guarded, and most often formed and fashioned. The religious sister is ~v~fi tb the Church not:so much as a model or an image according to which other women must pattern their lives; neither is she given to the Church as a kind of living representation of the grace of the Christian life as it would .have been given Ito all. except by reason of some fault or' guilt on their part. No, she is given to the Church as a kind of sacrament,' a v,s~ble s~gn, a symbol of one, even of several mws,lble reahtles. To understand this assertion thoroughly, w,e need to re-call briefly the mysteries of the Trinity and of creation. In the first mystery, that of the Trinity, ~we know that God the Father communicates His own nature to God the Son, and these two persons~ commumcate this same nature to the Holy Spirit. Yet while all thre~ of these per-sons possess the one same divine nature, skill from our very limited vision this nature appears to take on differ-ent~ aspects when we consider one or other oflthese persons according to His distinctive properties or characteristics. We obtain a much clearer picture of the richness of each of the persons by linking up certain qualities or perfec-tions with which we are familiar, with one o~: other of the . divine persons. Thus itis by reason of the various kinds of processions which we find in this myster~ that we at- .~ tribute understanding to the Word of God Who proceeds by way of an operation of the divine intell~,ect; similarly we attribute love and affection to the Holy Spirit because He proceeds by way of an operation of theI divine will. In the second mystery, that of creation, God seems to have wished that His various perfections I~e manifested and shared in by many different creatures, each acc.ording to a very definite limitation, such that some would repre-sent Him more perfectly and more fully, than others. For only in this way could the fullness of His b~ing be made somewhat clear. When we focus our gaze on material creation, we see that only one creature came into being, made, as we are told, according to the lmage~ and likeness of God. Only one received a perfection or perfections which would enable it to know and to love ~;od, to share and participate in the most intimate opI e.rations of the Godhead. That creature was man. Or let ks say, it was human nature, possessed by two different~individuals who I reflect the riches of this nature in such d~ffe~ent ways that the fullness of the mystery of the human composite might stand'out the more clearly and might m,rror more per-fectly the riches of the Godhead. For we must not forget that man and woman also belong to those th.ings of which it was said by the Apostle: "From the foundations of the 4. ÷ ÷ The Sister in the Church VOLUME 20, 1961 II C. A. $chl~cl~, REVIEW FOR RELIGIOUS world, men have caught sight of His invisibl~ nature, his eternal power and his divinity as they are known through the things he has made" (Rom 1:20). In something of the way in which the divine nature was shared in by two person~ other than the Father, proceed-ing from Him and yet personally manifesting and empha-sizing different aspects (at least according to our imperfect vision), so too in the mystery of the human composite we see one nature shared in by two individuals who mani-fest in their whole make-up the distinct perfections of the rational creature. And just as the Word of God is the one to whom we attribute the intellectual operations of God while the Holy Spirit is the one to whom we apply the affective operations of God, so too (I do not mean to say that the parallel is entirely exact) man is the one in whom we see manifested more visibly the operations of the mind and the duties of the intellective side of our being, while woman is the one in whom we see manifested more visibly the operations of the will and the duties of the affective side of our being. Since all created beings are sent into the world as signs or "sacraments" in the broad sense of this word, and since man is an image of the Trinity, we might say that man and woman are visible signs and symbols of the intellec, tire and affective operations and perfections of God. Man is a sign or a "sacrament" more especially of God as truth, and woman is a sign or "sacrament" more especially of God as love. In a sense, then, we might say that man reflects more the Second Person of the Blessed Trinity, the Word, while woman is more the reflection of the Third Person of the Trinity, the Holy Spirit. Now while it is true that the original plan of God was interfered with and that it was set right again only when the two persons proceeding from the Father were sent in mission to men, still it is precisely here--in relation to the fall and the two missions necessitated by it--that the "poetry" or the "sacramental" role and meaning of the religious sister begins to appear in all its dignity and sublimity. For when we consider the mystery of these two divine missions, we see that the Son of God was sent in mission to instruct men and to teach them the way of salvation. His function was to preach by word of mouth those mysteries and that knowledge of God which had been hidden from the foundation of the world. The Holy Spirit, on the other hand, was sent in visible mission only very briefly and for a different purpose. For He was sent both as a sign and as a kind of mother-principle. He was sent as a sign of sanctification, a sign of what the interior renovation which takes place within the soul in the state of grace actually is. In fact, the very creatures under which He appeared manifested this role: the dove and the fire. The one, the dove, manifested the innocence of sanctity, its caution, its fruitfulness, and its silence; while the other, the fire, manifested love and the knowledge proper to love, the wisdom of the heart. Moreover, the Holy. Spirit was sent as a kind of.mothe~:prlnclple, a pi~i~i~i~ '~f re-birth, to mold the human race into a new creature. This was the work He was to continue in a silent and hidden manner by acting as the soul, the vitalizing force and power of the Church, giving birth and life to the family of God. While it is true, then, that in the mystery of the Trinity the Holy Spirit is in a sense passive, since He is the term of a divine procession but not a principle of any further divine procession, still He does not remain passive. Rather He becomes active, most active, together with the Father and the Son in the work of sanctification or of what we might call the Trinification of the members of the family of ~God. This role of the Holy Spirit has certain affinities with the role of woman. Although, of the two individuals pos-sessing human nature, she embodies the characteristics of receptivity, acceptance, and submission, this does not mean that she is inactive or merely passive. The case is far otherwise. She receives or accepts, but only to give flesh and-blood, so to speak, to what she receives, to clothe it with the more sublime qualities of human nature. By reason of her entire being--her body, her soul, her powers of understanding, her capacity for affection, her aptitudes, and her inexhaustible devotion--she is made to mother the human race, to know it in all of its depths and.heights, its crudities as well as in its sublime potentialities. Thus, she has been endowed by God with a maternal instinct to form someone for family life, whether it be for the human family or for the family of God. In fact, this func-tion is one that she is not free to side-step; she is not free to isolate herself or to make her life self-cente~ed. For she exists for humanity; she is at its very foundations, not so much to direct and govern it, but rather to give it birth and to direct its initial steps in the pursuit of the human race's common goal. Woman exists, moreover, as an inspiration for all to seek the things that are above; likewise she is a sign of what this higher life actually is. She was given to man as a~companion, a helpmate to enable him to attain the sub-lime end for which he had been destined. And when she realizes the potentiality that lies within herself, she acts as a focal point or as an exemplar for the human race. Hence in the present economy of our existence, the divine idea of a complete human nature as something that trans-cends all difference of sex is better translated by woman than by man,, not only because her beauty excels that of ÷ ÷ ÷ The S~ ~ the ~hurch VOLUME 20, 1961 ~. A. $cltleck, ~.~. . REVIEW FOR RELIGIOUS 14 man, but also and especially because she presents an idea that is remarkable for the contraries which it unites-- somewhat as the activity of the Holy Spirit is presented to us in the Sequence for Pel~tecost, something like the ac-tivity of grace itself. For feminine nature presents us with an idea that is simple, yet very profound. She appears as one in whom we find a mingling of grace and gravity, of a smiling yet deep seriousness, of enjoyment and sacrifice, of song and silence, of purity and fecundity. It is in Mary' that we find the most perfect realization of this womanly' perfection. How the rest of womankind has realized this ideal and performed her role can be very readily seen by scanning the pages of history,, both sacred and profane; She has often led man away from God--she has often performed the role of the first Eve; and yet she has often led man back to his God---she has performed the role of the second Eve. Her influence ~has accompanied man. to near perfection, and it has also plunged him into an abyss of hate and despair. In fact, we can say that the destiny of man in his relationship with God depends to a great extent upon the silent directive force and power of wo-man, befit good or evil. Whether it be for good or evil de-pends very much upon her veil of mystery, her unassum-ing surrender to goodness and her willingness to share her time and her qualities with man in a spiritual or in a physical sense. Without her cooperative participation, the totality of human existence would become distorted and sterile. For her role in human existence will always be that of a bride, of a woman moving within the realm of man, not rejecting her veil which is a sign of her ac-ceptance, of her l~at mihi, not struggling to attain that which is properly man's, but surrendering her whole be-ing in an effort to make her contribution to the end result which is the unity of the human race with God. Like the Holy Spirit with whom she has a certain af-finity, woman is not only passive or receptive. She is com-municative, in fact, essentially communicative; and .like the person of love whom she represents, she tends to be-come dit~usive, 'to create or to prepare [or the members of the human family the best that this family contains in the depths of its own being--life, freshness, the poetry of love, fidelity, service, and care. It is only when woman actually lives or incarnates in her own life these characteristic marks of the Holy Spirit that she arrives at the fulfillment of her mission in crea-tion. And it is only in and through her arrival there that she attains that vision proper to wisdom, one that reaches from end to end seeing all things and judging all things according t° their proper place in the divine plan. It is only in the measure that she fulfills her role that she will be enabled to see the needs of souls, the needs of the Mys- tical Christ, and the destinies of the humffnfamily. For in proportion as her affective nature becomes more and more purified, she Will become more and more like to the person of the' Holy SpiriLwho, is personal love in the mystery of the Trlmty; and she-will be g,ven~that gift which is part and parcel of her vocation--wigdom and the divine vision which this implies. For as h~r'affections become purified, she learns~o .center herself and her life in God who will constantly infuse intd her a deeper love which is perfected by one 'of~His most precigm Sifts w~sdom. Thus we can say that'only in proportion as there grows in the woman the untarnished innocen~e~0f Mary the girl, will there also' grow in her the. deep compas-sionate gentleness and wisdom and.vision of Mary the mother, enabling her like Mary to cover the world with a silent and still co-redemption. Consequently, we can say that ~oman's vocation and mission is to imitate and continue partially at least and in a visible way the mission of the Holy Ghost--to mother the human race inits relatidnship with God by showing men that God isoa God of lov~ and that it is man's duty to find God not go much by r~ducing Him to our level of thought and limitatiofis, 'but rather/by going out of ourselves and in the" darkness Of a deep faith ~and trust, loving beyond what we see. M6reover, she was meant to be a perpetual sign to man of what the soul in the state of grace is--the bride of the L6rd. If this is the fundamental role of woman by her very nature, we should exPect that any furthervocation which she might be called upon"by God td exercise in the divine plan would not depart from this. Rather we would expect it to call her to a more perfect fulfillment of this funda-mental and basic role or vocation; for grace, as we hav~ so often heard, builds upon nature. It should come-as no surprise, then, that w~ should conceive of the religious vocation which lies at the very basis of the sister's way of life as a dall or an invitation from God much more than as an arbitrary decision on the 15art of a woman to enter the religious life. It is;' we might say, a special glance 'or grace which God Himself directs towards certain souls whereby He lifts thein from the realm of His common love and elevates them t6 that of His special love. We can say that if a woman goes out of the world in attempting to realize a religious vocatibn, she does not do so arbi-trarily; she does so onl~ in :response to an invitation by which God addresses her by'her first name, going beyond the common love which He shows otherg'and embracing her with His ~pecial love. A sister gods out of the world (and ~this is implied in the religious life) only became she has been given an-other task by almighty God/For she is given- to the Church The~ Sister in the Church VOLUME 20; 1961 REVIEW FOR RELIGIOUS 16 and to mankind, not so much as a type or figure as we mentioned above, but rather as a sign in much the same way as the Holy Spirit was given to the world in His visible manifestation as a sign. And because she is given to the Church as a sign, her whole life must be, as it were, a kind of graphic picture or parable. For in her there was meant ~o become lifelike and instantly visible what in all others is usually kept secret and hidden. In her what is innermost in the Church of God is turned outward; and the City of God, which lies so concealed in others, becomes the town which is set upon the mountain--visi-ble for all to see. I am speaking, of course, of the life of man with God. It is this role which the sister constantly plays in the Church; we see it in the habi~ she wears, in the houses she lives in, the bearing which marks her per-son, and in the very disposition of her life. Her mission and vocation in the Church was meant to publish this truth: that this woman belongs entirely to God, that she lives only for Him and only with Him. This is, it seems, what the vocation of the religious sister was meant by God to signify; and the external marks which set it off from all other vocations (something like the plate of pure gold worn by the high priest of the Old Tes~tament) indi-cate immediately that the one belonging to this yay of life is set apart for the Lord. God knew that by reason of the fall the observance of the first and greatest commandment--to love God with one's whole heart and soul--would be most difficult to keep. For the mind of man, wounded by original sin, would tend to look downward; his heart would tend to become immersed in the things of time even though he be ordered to an eternal destiny. The sublime idea of union with God would be recalled and brought to birth in him only through what he saw or only through what he would in some way sense. God knew that if know.ledge would be had only through the instrumentality of the senses, through contact with visible things such as the spoken or the written word, then love would be recalled to man and begotten in him only t~hrough what he would in some way sense, only through some visible instrument; and in this case the love that would be recalled and be-gotten in him would be a share and participation in God's own love itself. It was for this reason that God instituted Christian virginity, and the Church ~gave this institution a very definite form in the religious life; *for the sister was to be a sign or a "sacrament," that is, a visible sign of an in-visible reality. It was one of the best possible ways of realizing and of answering the cry of the psalmist, "We no longer see the signs," which you have placed before us, Lord. While a sister is a sign of many things---of the fact that God exists, of the fact that He can touch a soul in a most intimate way, of the fact that He can ask a soul, or rather demand of 'it as it were~ 'to live for Hi~n ~lone-- still the sister is above all according to the divine~plan a sign of a yet greater mystery, 'For her mlssxon was set up by God to signify that He is love, that He is one who loves and can be loved. She was meant to indicate perpetually, not so much in her own individual person as in the insti-tution which she incarnates, that man is called to experi-ence God's personal love, that a human soul is called to be the bride of the Lord. This explanation is not just ~ sentimental, metaphor; it is something, which fias been constantly re-echoed in the literature of the Church--in the figure of the Church herself as the ,immaculate spouse of Christ, in the person of the bride of the Canticle of Canticles, in the figure of the chosen people as the Jerusalem or Sion of the Old Testament, in the.figure of Mary, and in the figure of the New Jerusalem who is said by St. John in the Apocalypse to be sent down from heaven by God all clothed like a bride who has adorned herself in readiness to meet her husband (Apoc 21:2). It is in fact rather clearly indicated there that the new Jerusalem is a figure of the Church and of the individual members of this Church, each of whom is called to be the bride of the bridegroom who is the Lamb (Apoc 21:9). There is, we might say, a common desire in the Church to see this heavenly Jerusalem or to catch some glimpse here on earth of the soul that is ready to enter into glory or who already participates in vision. In the sister that desire was to be fulfilled. For while it is true that the re-ligious profession taken together with the reception of both man and woman is essentially the same, a represen-tation of an eschatological state, nevertheless it is only in the case of tlie sister, because she is a woman, that one of the principal effects--the closest possible union with God---is brought out most strikingly and unmistakably. The man's consecration to God is considered to be a kind of second baptism, a ceremony in which his death to the world and his resurrection unto God is signified. But in the case of the woman, the ceremonies taken in their en-tirety form a kind of marriage rit~, a marriage in which she unites herself to the God-man as His bride. Conse-quently only the sister is able to signify in her very being and. person the marriage of the Christian with God, be-cause only she cfin be by nature a bride. The veil and, in some cases, the ring that she receives at the time of her profession were meant to be a perpetual reminder both to herself and the world that there is another world of r.eality that lies far beyond the surface vision which takes up the thoughts and the attention of the majority of men. 4- + The Sister in the Church VOLUME 20, 1961 17 ÷ ÷ ~,. A. $chleck, REVIEW FOR RELIGIOUS 18 The excellence of this marriage over that of the sacra-ment lies in the immediacy of the union with Christ the God-man as well as in the permanence of the bond that is established at that time. For we kno~ that in the re-ligious profession a woman unites herself' immediately to Christ, whereas in Christian marriage, She unites herself only. mediately to Him, through the intermediary of a human creature who represents Christ for her. The bond of the religious profession, moreover, is not dissolved at death; rather it is 'one that realizes its full meaning and significance not here on earth but only'in eternity since it is the reward of virgins alone tO follow, the Lamb whithersoever He goes in the everlasting hills. It is in this way that a sister is a visible and constant symbol to the world of the sublime privilege and destiny which rests upon all human souls--to be a bride in search of the bridegroom. Sublime though this role of the sister is, there is yet another one which is not merely attached to this destiny of being a bride of Christ, but is its natural outcome. We know that in and through human marriage the bride as-sumes the interests 'and the concerns of the ~bridegroom. Consequently, in the marriage signified by the'religious reception and profession of the sister, she assumes the in-terests and concerns of eternal love, of God who is infinite love. Thus her love is not only not annihilated by her profession, but it is given new life and becomes much more dynamic and extensive than that which is had be-tween two persons united to each other through Christian marriage. It is meant to assume the status arid proportions' of the love of the God-man Himself. If the bride reflects the interests and the concerns of the bridegroom, she does so in a very definite way in accordance with her own na-ture. Since this nature is feminine, she rel~resents God as love and she reflects the concern of God for souls in a ma-ternal way. in fact, we can say that the maternal office or role for which she is created is not only not annihilated in her profession but is brought to its highest and most perfect fulfillment because she exercises it over a greater number of souls and with respec~t to the highest life that can be given to a creature, a share in the life of God Him-self. This is as it should be. For a natural desire, one that is implanted in a creature by God Himself, must be capa-ble of being ftilfilled and must be fulfilled in some way or other if that creature is to realize its highest possible perfection. In calling the sister ~o her vocation, the highest voca-tion to which a woman could aspire in the Church, God will not--I think that "we can say can not---destroy this aspiration which lies deep in the very make-up of every woman. Rather He will bring it--He must bring it--pro- vided there is no'obstacle on her part--to its fullest and most perfect realization. To be pure and untouched~oand wholly consecrated to God and yet to have the heart and soul of.a mother is the unique wonder of Mary; and,it is also at the very heart and m);s'te~ 0f the sister's ,~6cation. It is a grace which is given to her initially in the grace of vocation itself, in much the same way as the fruit of the tree is given already in the very seed of the tree. And that grace will die or grow in the sister in the same measure or proportion as the grace of vocation dies or grows in her heart. It is of this also that a sister is a continuing sign or symbol to the world---that only a virgin motherhood is' compatible with~ a~_divine motherhood, that is, one that has as the whole purpose of its existence to lift up the souls of its children to :God, Just as Mary became filled with,grace and,superabundant 'in it, so to9 the sister is called to something similar--to be filled ~with grace but in such a way that she not only receives it but commtini-cates ,and diffuses it' to others as .a mother communicates and diffuses life to her children. Consequently, the.phrase which the Church in her liturgy.applies to Mary can also be applied in a certain sense to her: "And ~having the honor of virginity, you have also the joyof'motherhood," I think that it is true to say ,that only this understand-ing and presentation of the sister's, role in .the Church will make it more meaningful for her and restore it to its rightful place of: excellence~among the ways of life that lie"open to the faithful. For unless there is ~a deep faith and conviction in her marriage with Christ and in her spiritual motherhood, ~ the deeper motivating forces of, her vocation c~)uld easily remain somewhat obscured"and the consequent fruit of her apostolate diminished. And unless the missiofi' of the sister is presented to all the faithful during the years of their academic training and instruction,.espeCially in high schools and colleges, not by means of a ~¢il~d of "fly,by~nigh~" program but by one that openly juxtaposes it to marriage and presents it in all of its fullness, with its beauty, excellence, and joys, to-gether with its peculiar trials and difficulties, the question Ut quid perditio haec? spoken of above.will remain in the minds of a great many of the faithful and continue to ;. serve' as a parent,al objection to the very vocation itself: For all the attractiveness and beauty which this picture of the sister's mission in the Church might present, there° is one warning that might be voiced before c6ncluding, a-warning which becomes ever more necessary as the prog-ress of our technical civilization moves on with the.speed of an object drawn by the pull of gravity.And that is that 'the sister as well as the institution which she incar-nates must not fail to hold up the mystery of the cross-- in schools, in vocation literature, and above all in ,the The Sister in the C~hurch VOEUME 2~ 1961 19 4. + C. A. Schleck, REVIEW FOR RELIGIOUS 20 actual living of the religious life itself. The presence of this sign of contradiction, its mystery, its sorrow and its joy, must always be the very basis of her way of life. For the essence of the religious life is "to go out from the world." Consequently, the religious sister is to bear in mind that here on earth she is called upon to fulfill the obligations of a bride and .a mother. The privileges and the rewards that shall be hers--that of "following the Lamb whithersoever He goes" and that of ~eeing "her sons coming from afar off and her daughters rising up at her side" (see Apoc 14:4; Is 60:3 ff.)--are reserved for eternity: These will be hers only if she has understood and accepted at the very outset of her religious life and has observed ever more faithfully during it the injunction of St. Ambrose: "The root and the flower of virginity is a crucified life.". It is this life, together with all that it implies in the case of the woman--silence and stillness and hiddenness especially--that is necessary not only for this vision to remain throughout her life but also for it to grow and to reach to new extensions and heights so that all the various lights and shadows of its beauty might appear in all their fullness, richness, and splendor. Such a vision of the "Word breathing forth love" as St. Thomas says (Summa tkeologiae, .1, 43, 5, ad 2), can be purchased only where there is lived and practiced prayer and disci-pline. These requirements have today made the vocation of the religious sister especially difficult. For the growing demands of her apostolate in the world along with the almost imperceptible infiltrations of elements foreign to her. vocation which such an apostolate often implies, could easily diminish and even destroy the possibility of retaining and developing this vision. If she remains faith-ful, however, to a constant and personal practice of these requirements, she will enable herself to fulfill her two-fold role, that of being a virgin in search of Christ and that of being a mother in whose conceptions no sin is passed on to the offspring, but only grace, only a share in the life of God Himself. Like freshly fallen snow on a mountain she will lift her gaze.only to God; and yet under the heat of the sun (which stands for the activity of'the Holy Spirit) she will melt and give life-giving water to those who dwell in the fields and valleys below. And he who drinks of this water shall never thirst, but it will become to him "a fountain of living water springing up unto life everlasting" (Jn 4:14). In conclusion we might sum up very briefly what we have attempted to give in these few pages. A religious sister leaves the world to become a sign or symbol, repre-senting God to men and men before God. For God loves humanity in her person, and in her person humanity gives its loving answer back to God. This, I think, is the mission given to the sister both by God and by the Church. When she returns to the world in the exercise of her apostolate, regardless of what this might be, she does so primarily as a sxgn, a symbol of the pasclial mysterxes, of tiuman na-ture's death to sin and resurrection unto God. In her case, this resurrection will be not so much unto light and knowledge as unto love. We know, that no apostolate, no vocation has any real meaning except in some relation to communication of life through light or through love. In the case of the religious sister it is in ke~eping with her very nature that the communication be more often predominantly through love; and even when it is through light, through the instruction of youth, it will be a spread-ing of vision in and through the warmth of love. Therein lies the "poetry" or the sacramental meaning and the divine design for the sister's mission, a mission whose fullness and richness and meaning must be made known to the world today; for it presents the solution to the needs of our day a constantly deeper interiorisation of doctrine and life, a flowering of the contemplative spirit, and an intense outpouring of charity and love. It is true that the world of today needs a rational theology; yet before it can become capable of this theology, it needs the vision which lies behind it, the vision wfiich made the very Summa of Aquinas seem like so much straw--the vision of eternal light that loves and is love. This role, this mission, this need for the presence of the sister in the Church has been very well indicated by a passage from one of the works of St. John of the Cross: 0 Lamps of fire, in whose resplendent light the deepest caverns where the senses meet,- erst steeped in dark-ness dire, Blaze with new glories bright, and to the lov'd one give both light and heat. Living Flame of Love, Stanza 3 This is the work of the Spirit and it is also the mission of the sister in the Church. And so in the end we come back to the beginning. The sister's apostolate or primary mission is very much like that of the Holy S15irit with whom she has a very definite affinity--to diffuse within the souls of men the gift of created love which is the com-mon bond uniting us with God and with each other in the friendship of divine charity or in the community of love which is the Church. If the sister fulfills tfi~t mission, on the day of her entrance into eternity she will merit to hear the words which the Prophet addressed to the new Jerusalem many centuries ago: "Arise, O Jerusalem, and stand on high, and behold the joy that comes to thee from thy God" (Bar 4:36; 5:5). 4- 4- The Sister in,- the Church VOLUME 20,, 1961 JEAN GALOT, S.J. Thanksgiving After Holy Communion, + ÷ + The Reverend Jean Galot, S.J. is Professor of Dogmatic Theology at Coll~ge Saint-Albert, Eegenhoven - Louvain, Belgium. REVIEW FOR RELIGIOUS 22 In recent years it seems that some observers have no-ticed a decline in personal thanksgiving after Holy Com-munion. 1 The liturgical too;cement would seem to have led some of the faithful, including priests, to neglect any prayer which is not official, liturgical prayer, or prayer with a community flavor. On the other hand; the publi-cation b~y Father Karl Rahner of two articles on the theo-logical justification for thanksgivings gives us an oppor-tunity to reconsider this aspect of Holy Communion. We would like to do this not only from the standpoint Of prac-tice, but also doctrinally. Firstly, we shall ask what connection there is between thanksgiving and the Mass. In particular, is it correct to say that thanksgiving has only minor importance because Mass is it.self essentially a thanksgiving? Then we shall look at the reason usually given for making a thanksgiv-ing; namely, the continuation of the real presence of Christ in the communicant. But is this, in fact, the chief justification for the practice? Finally, there are some conclusions about the length of the thanksgiving and the manner of making it. Having a better understanding of Holy Communion and of its effects in us will lead us to see the attitude it requires of the communicant. By t~he end of this study it is hoped that the great im-portance of the matter in all religious formation will be ,apparent. This is the year of the Eucharistic Congress which has as its theme "Pro mundi vita" [For the life of the world], and it is also the fiftieth anniversary of St. Plus X's decree on the Communion of small children. It would be rewarding were the thoughts here outlined to contribute in any way to a fresh development Of Eucharis-, uc p~ety. . x This article originall~ appeared in Revue des Communautds Re. ligieuses, 32 (1960), 73-86. The translation is by Rev. D. Brigstocke, s.J. *"Danksagung nach der hl. Messe," Geist und Leben, 32 (1959), 180-89, 442-48. Thanksgiving Completes Our Participation in the Mass It is very t~ue that the whole Mass is a thanksgiving. The expression Eucharist~.makeS this clear. The word was applied by the primitive Church to the sacr~iment which Jesus instituted at the Last Supper; and the reason may be found in St. Luke and St, Paul: when He consecrated the bread, Christ "gave thanks" .(Lk 22:19; 1 Cot 11:24). It is the attitude which distinguished Christ at this capi-tal moment that has given its name~ to the sacrament. In memory of. Christ His '~disciples have likewise "given thanks" to God by repeating the gesture of consecration,3 ~How is this characteristic attitude to be interpreted? To give thanks is to thank God and to adopt the disposi-tions ofsomeone who has received everything from Him, and is glad to offer Him everything in return. At the moment of the Last Supper, Christ wished, to proclaim that He held everything from the: Father, hnd at,the same time He wanted to make a complete offering of Himself to the Father in a way .which would for ever perpetuate His oblation on Calvary. By this, thanksgiving, which is intended to be an act of total homage to the Father, the bread is blessed;~ it is consecrated because, being ,offered to God, henceforth it belongs to Him; it becomes the in-strument of divine blessings. The thanksgiving is an obla-tion, and the blessing of the bread is the sign of this obla-tion, its material symbol This is as much as to say that one must n6t have too restricted an idea of thanksgiving, confining it tO an outburst of gratitude alone. It signifies a return to God of what He has given to man. It is .a "Thank you" which is expressed by a profound offering of the self. If the Mass is to be called a thanksgiving, then it is within this very broad meaning of the word. Those who take part in the Mass have to acknowledge with. Christ that they h~ve received everything from the Father and that with Him they present to the Father all that has been bestowed upon them. They do this by uniting their offer-ing,' which should l~e as complete as possible, with that of the Savior, Does this mean to say that fervent.participation in,the Mass, with this attitude of thanksgiving, makes a thanks-giving after Holy Communion secondary or only slightly useful? We might notice that Father Rahner, while put-aFor the employment of the term Eucharist in the prim~itive Church an~d especially in St. Justin see P. Batiffol,'L'Eucharistie, la prdsence rdelle et la transsubstantiation, "l~tudes d'histoire et de th~o-logie positive," 2nd series; J.-A. ~Jungmann, Missarum Sollemnia, I, 45 ft. ~In St. Matthew (26:26) and St. Mark (14:,22) the equivalent of "having given thanks" is "havin~,g blessed." 4, Thankagiving Holy vo,.u~E ~o. ÷ ÷ ÷ ~ean Galot, REVIEW FOR RELIGIOUS ting in the first place the thanksgiving constituted by the Mass itself, maintains that thanksgiving after Holy Com-munion means much and is truly recommendable. And if one thinks of the personal participation by the priest or the faithful in the Mass, with all that this sharing de-mands, it cannot be said that thanksgiving has only sec-ondary importance. For its role is to complete partici-pation in the Mass, and to ensure the full fruit of this participation. In fact, participation in the sacrifice of the Mass reaches its culmination in Communion. This is the sacrificial meal. Certainly the sacrifice has its value on its own. Once the Consecration has taken place the essence of the sacri-fice has been accomplished, with its worth ex opere operato applied to the intentions for which the Mass is celebrated. But in the sacramental order the personal participation by the priest or faithful in the sacrifice of Christ remains essentially insufficient so long as it has not ended in Communion. This remains true, however fer-vent the will to unite oneself with the Offering and the Consecration.5 The object of Holy Communion is the full association in the Savior's sacrifice of those who are present at the sacramental renewal of this sacrifice. It unites them to Christ's offering in virtue of an efficacity ex opere operato different from that of the Consecration, and which completes the latter by acting in each com-municant individually. This sacramental efficacity may be explained in other terms by saying that here it is no longer the member of the faithful who tries simply to unite himself to the sacrifice of Jesus, albeit his efforts are sustained by grace; it is Jesus Himself coming to unite the Christian to His sacrifice. He comes to incorporate the individual with His sacrifice, and He does so by a divine power enabling the fa!thful to offer that which human weakness would have precluded. This sacramental incor-poration in the sacrifice may be translated in terms of thanksgiving: by Holy Communion Christ comes to in-corporate the faithful into His own supreme thanksgiving --a thanksgiving repeated at each Mass and which in-cludes the offering of His death. Christ associates the Christian with Himself, placing him in this situation of giving thanks. The sacramental efficacity of this incorporation, while it proceeds essentially from the divine strength of Christ, depends also upon the dispositions of the faithful. As with the rest of the sacraments, the effect ex opere operato of Holy Communion does not dispense the faithful from cooperating with grace. Christ gives Himself with His 5 Cf, the Council of Trent (DB 944) encouraging the faithful to sacramental communion at each Mass they attend. omnipotence, but the soul still has to open itself to Him and welcome Him. This attitude of welcome, this opening of the self and subjective fervor will have an influence upoh the fruits of Communibn. Here it is that we discern':the'i~nportance 6f'indi~,idual thanksgiving after Holy Communion. The Christian really has to "receive, Christ in such a way as to allow Christ to incorporate Him fully into His own sacri,fice. In order to be able to receive Christ in this way, one has to pay attention to Him, try to show Him the sentiments of welcome that He deserves, .and make ohe's own the thanksgiving that Christ brings with Him. This can only be achieved in those moments~ of recollection When a cer-tain intimate dialogue occurs. The time of thanksgiving after Holy Communion is the moment when all that has happened at the altar enters deeply into the soul of the Christian in order to transform it. At this moment the communicant yields himself to that immense giving of thanks which was the theme of the Savior's sacrifice. He commits himself personally to this thanksgiving by allowing Christ to penetrate to his. fur-thest depths, and by devoting all his powers as a man, his ability to reflect and to will, to the work of extending the Savior's reach within him. Thus, thanksgiving after Holy Communion is not a simple movement of personal piety which just happens to be added to a liturgical action in itself fully sufficient. It~is not a complement, with value only secondary. It is the reception and welcome of the liturgical and sacramental action, a welcome without which this liturgical action could not produce in the com-municant that which one has a right to expect. True--the thanksgiving is individual. It has to be, because it signi-fies a personal welcome given to the coming of Christ, and it has all the more worth in proportion as the depths of the personality are engaged. But this individual com-plement is claimed by Holy Communion and therefore by the liturgical action of the community which is the Mass. Besides, while remaining an act of the individual, the thanksgiving allows the member of the faithful to rise to a higher le~,el of community charity. It does this pre-cisely because in Holy Communion the Christian wel-comes to himself the love of Christ. . There is, therefore, no reason for neglecting thanks-giving after Holy Communion, or for holding that it is an act of private piety which we may omit at will. On the contrary, it is the ordinary completion of 'the Mass. Its importan.ce is not less for not being found among the prayers that the priest recites officially. By its very essence the thanksgiving has to be something intimate,~ a reaching-out and utterance of the soul; and as such it gua,rantees the full effect of the Mass in each of the faithful. + Thanksgiving A.~e~ Holy Commumon VOLUME 20, 1961 ~e~ ~, sJ. REVIEW FOR RELIGIOUS Thanksgiving and the Real Presence of Christ For some time after Communion the sacramental pres-ence o£ the bod~ o£ Christ remains in us.~ It is difficUlt to decide the exact duration o£ this presence, but it does not cease be£ore the dissolution o~ the species. Accord.oing to some medical opinion, a small host in a healthy stom-ach does not corrupt before haft an hour.7 On the other hand, it is even more 'important to notice that this bodily presence o~ Christ in the communicant is given essentially £or a spiritual action, and more speCially £or a spiritual presence o~ Christ in u~. For Christ comes to nourish us spiritually. Father Rahner has good reason £or insisting upon the spiritual pregen.ce o~ Christ that Holy Communion produces. Thinking o~ the Eucharist, St. Paul Spoke about "spirit-ual food" and "spiritual drink" (1 Cor 10:3-4). He un-derstood the efficacity o£ the Eucharist as being o£ the spiritual order because, to speak more precisely, this effi-cacity was due to the Holy Spirit: "in 6ne Spirit we have all been made to drink" (1 Cor 12:13). According to these views, it is not the Bgdy or the Blood of Christ, as such, in their simple material reality, which operates in the communicant, but the Holy Ghost whom they bear. St. Paul was ectioing Christ's teaching. In the l~romise o~ the sacrament a's St. John recounts it, the Master had under-lined the spiritual nature o~ the etticacity of the Eucharist: "Only the spirit gives li£e; the flesh :is of no avail" (Jn 6:63). By itseff the flesh would be powerless to exert any sanctifying activity; it is only through the Spir!t that it can act in this way. In order to better understand the connection which exists between the Eucharistic body and the Holy Ghost, we should recall that the Body present in the Eucharist is the glorifie.~d Body o[_.the Savior. It is His risen Body. It is true that th.is Body is giv~en to us in a ~sacrifice. But the sacrifice, While it renews the offering of Calvary, renews too the completion of this offering and' its acceptance by the Father: :that is to~ say, the glorification o~ Jesus. That is why the Mass omme'mbrates not only the Passion~ but . e Father Rahner has put £orward a new theory~ according to which 'the real presence would cease [xom the moment of communicating, because from that instant the species of bread can no longer be con-sidered as food, being .no longer eatable. According to him there would begat this moment the equivale.nt of corruption of sp.ecies'. In' principle, however, tradition considers that physical corruption of ~ ¯ the species must occur before the real presence ~ceases. One might!! also add that the species of bread do. continue to be a nourishment' I even ~fte'r actual manducation, and so they remain the sign 6f the I real presence. Therefore the presence of the Body of Christ certainly I persists after the ~ctual°moment of communicating. ~ C~. Cardinal Gasparri, Tract. canonicus de Sanctissima Eucha- I ristia, (1897), n. 1194~ also the Resurrection and Ascension. Without the Resur-rection and the Ascension the sacrifice would be neither perfect nor consummated. Therefore, at the moment-of consecration it is the risen Body of Christ that becbmes present on the altar, and\in,.Holy Commufii61i~,iit is this risen Body which the faithful receive. Now the charac-teristic feature of the glorified humahity of Christ is that of being filled with the Holy Spirit,.and of b.eing able to transmit and communicate thissame Spirit.,At the Resur-rection the Body of Christ was tr~a~stormed and spirit-ualized by the Spirit. So it is that St. Paul considers the risen Christ as He who possesses the Hgly Spirit, and who bestows Him for our sanctification,s "The last Adam was made into a quickening spirit" 0 Cor" 15:45). This Pauline teaching is based on the testimony of the Gospel itself, which shows us in the risen Chyist Him who says.to His apostles, "Receive ye the Holy Ghost" (Jn 20:22), and above fill Him who sends, the Ho.ly Spirit to all the disciples on the day of Pentecost (Lk .24;49; cf. Act The reception of the glorious flesh of Christ in the body of the communicant produces as a consequence a general pervasion by the Holy Spirit. Before all let us notice that the Holy Ghost does not veil the presence-of Chr!st, as though He were an intermediary acting as a screen. On the contrary, He causes the ~piritual diffusion of this p~es-ence; it is He who causes the action and love of the Savior to penetrate the soul. It is through Him that the presence of Christ gr6ws deeper and more intimate. It is this spiritual action of the bodily presence of the Savior in the communicant that demands the latter's cooperation if that action is to be exercised fully. It fol-lows that this spiritual action requires the most fervent thanksgiving possible. We are now in a position to define more exactly the role of thanksgiving. For our part, i.t is the welcome to the bodily presence of Jesus as a presence which acts in a spiritual manner and thus penetrates the soul. It is, be-sides, traditional to think of thanksgiving along these lines: the Christian who has just communicated addresses himself to Christ present in his heart, Christ who. has reached and penetrated into his very soul. The communi-cant desires to make some answer to this spiritual pres-ence. This concentration of attention upon the spiritual presence of Christ should not lead to the conclusion that the bodily presence is without importance. The spiritual presence is bound up with the bodily presence:. ,we have recalled that it is the glorious Body of Christ that is the s Cf. F. X. Durrwell, La Rdsurrection de ]dsus, myst~re de salut, (Paris: 1949), pp.,196-23. 4- 4- 4- Thanksgiving Alter ltoly Communion VOI~UME 20, :1961 ÷ ÷ ÷ lean Galot, SJ. REVIEW FOR RELIGIOUS 28 bearer of the Spirit. In th6 rest of the Sacraments there is an action by the Holy Spirit, together with an infusion of grace; the Eucharist is the only sacrament wherein we receive not only grace, but the author of grace. In it we receive the spiritual presence of Jesus after a fashion that ig quite exceptional, arising from the fact that this pres-ence is the immediate result of the presence of His Body within us. It is this bodily presence which guarantees the spiritual presence at its highest pitch, together with spiritual nourishment, Thanksgiving after Holy Com-munion has as its object the spiritual assimilation of the presence of Christ. The Duration of Thanksgiving According to what principle should we determine the lengt.h of thanksgiving? Father Viller writes, "It is nor-mal for it to last as long as the Eucharistic presence of our Lord remains in us.''9 But it is quite legitimate to enquire with Father Rahner whether this criterion is fully justified. To begin with, certain inconveniences arise when we seek to measure the duration of the thanksgiving by the duration 'of Christ's bodily presence in the com-municant. If, as Cardinal Gasparri states on medical evi-dence, a small host remains in the stomach for not less than half an hour, and a large one for an hour, then this p~i~sistence of the species will in any case require a very long thanksgiving. Besides, were this criterion to be adopted, it would be for doctors and biologists to decide upon the length of the thanksgiving. In addition to this, such a criterion does not appear to be founded on the true nature of the thanksgiving. The proper object of the latter is not the reception of the Body of Christ in the stomach, but the reception of the total Christ by the soul. We are not dealing with an assimilation by the body of the Body of Christ, but with a reception and assimilation "of His spiritual presence. We have tried to stress that the bodily presence of Christ is designed to give us His spiri-trial presence more comp.letely and immediately. Since the role of the thanksgiving is to open the heart or the soul to this spiritual presence of the Savior, its duration should be measured by the amount of time nor-mally needed if such'a welcome is to occur. It should be long enough to allow the person of Christ to exercise His action in the soul of the communicant and to fill it with His life in the measure that He Himself wishes. What 'must take place is a penetration of our intelligence and will and sentiments by this presence, and there must also be a personal effort to achieve this intimate relationship with Christ. No absolute norm can be given for achieving Communion (pratique), in Dictionnaire de Spiritualitd, II, 1282. this, simply because one has to take into account the sub-jective dispositions of each individual. But in general spiritual writers think that about a quarter of an hour is good measure for most. This isJong enough to ach,,ieve the degree of recollection whi~li ig n~ssary if profound con, tact is to be made. with the person of the Savior, and if the depths of the soul are really to be opened to Him. Certainly it would be arbitrary to declare that the last prayers of the Mass are a sufficient thanksgiving after Holy Communion, and that once the litUrgical action has been completed there is no need to prolong the prayer which should act as an echo to the.sacrament just received. On the contrary, itmay be said in general that the mere fact of following the prayers 6f the priest up to the ending of Mass is not sufficient to afford Christ th~ intimate and personal welcome which His Eucharistic. presence asks of us. It is to be regretted that there are those.who syste, m~tically favor the departure of the faithful as~.soon as Mass h~s ended. If there are many lives in wl~ich frequent reception of Holy Communion fails to produce the fruit that might be expected, may this not be because the welcome offered tq the Eucharistic Christ is not fervent enough, and because the thanksgiving which should lie the surge of a° personal. love is too brief and superficial? It has already been no-ticed that sacramental efficacity ex opere operato requires man's cooperation if it is to have its full effect. Father Rahner writes that this efficacity eX opere ope-rato cannot be increased by the thanksgiving, and that it simply depends upon the disposition of the soul at the moment of Communion. He adds that if this disposition exists it will in fact be manifested by a meditative and recollected thanksgiving,xo But if it is true that strictly speaking the thanksgiving does not augment the efficacity ex opere operato, it does none the less allow th.is effic~city to be. exercised in the fullest measure desirable. It is not only at the precise moment of communicating that 'the bodily presence of Christ produces its spiritual action. This is continued later. It will be fully efficacious to the degree that the soul yields itself to it in thanksgiving, attempting to respond by faith and love. The length of the thanksgiving does influence the efficacity of the sacra-ment, seeing that normally a certain time is called for if a welcome is to be considered fervent. It is therefore un-derstandable that the Church should recommend a thanksgiving which goes on after the Mass has ended. In this connection it is worth citing from Mediator Dei. As this encyclical is expressly concerned with the liturgy, it ~o Rahner op. cir., pp. 186-87. ÷ + + Thanksgiving A~ter Holy o~munio~ VOLUME 20, 1961 29 ÷ ÷ REVIEW FOR RELIGIOUS 30 is particularly noteworthy that it should stress the per-sonfil thanksgiv.ing d~manded by the liturgy. When the Mass, which is subject to special rules of the liturgy, is over, ~the person who has received Holy Communion is not thereby freed from his duty of thanksgiving; rather; it is most becoming that, when the' Mass is finished, the person who has received the Eucharist should recollect himseif, and in intimate union with the divine Master hold loving and fruitful converse with Him. Hence they have departed from the straight way of truth: who, adhering to the letter rather than the sense,~assert and teach that, when Mass has ended, no such thanksgiving should be added, not only because the Mass is itself a thanks-giving, 'but also because this pertains to a private and personal act of piety and not to thegood of the community. But, on the contrary, the very .nature of the sacrament de-mands that its reception should produce rich fruits of Christian sanctity. Admittedly~the congregation has been officially dis-missed, but each individual, Since he is united with Christ, should not interrupt the hymn of praise in his own soul, "al-ways returning thanks for all in the name of our Lord Jesus Christ to God the Father" (Eph 5: 20). The sacred liturgy of the Mass also exhorts us to do this when it bids us pray in these . words, "Grant, we beseech thee, that we may always continue to offer thanks" (Postcommunion, Sunday Within the Octave of Ascension) " .and may never cease from praising thee" (Postcommunion, First Sunday after Pentecost), Wherefore, if there i~"no time when we-must not offer God thanks, and if we must never cease from praising Him, who would dare to reprehend or find fault with the Church, because she advises her priests (canon 810) and faithful to converse with the divine Redeemer for at least a~ short while after Holy Communion, and inserts in her liturgical books, fitting, prayers, enriched with indulgences, by which the sacred mlmsters may make suitable preparati6n before Mass and Holy Communion or may return thanks afterwards? So far is the sacred liturgy from re-stricting the interior devotion of individual Christians, that it actfiaily fosters and promotes it so that they may be rendered like to Jesus Christ and through Him be brought to the heavenly Father; wherefore this same discipline of the liturgy demands that whoever has partaken of thd sacrifice of the altar should return fitting thanks to God. For it is the good pleasure of the di;gin~ Redeemer to hearken to us when we pray, to converse witfi us intimately and to offer us a refuge in His loVing Heart. Moreover, such personal colloquies are very necessary that we may all enjoy more fully, the supernatural treasures that are contained in the Eucharist and, according to our means, share them with others, so that Christ our Lord may exert the greatest possible influence ofi the' souls of all. Why then, Venerable Brethren, should we not approve of those who, when they receive Ho!y Communion,~ remain on in clbsest familiarity with' their divine Redeemer even after the congregation has been"officially dismissed, and that not only for~the consolation of conversing with Him, but also to render Him,due thanks and praise and especially to ask help to defend their souls against anything that may lessen the efficacy of the sacrament and to do everything in their power to cooperate with the action of Christ who is so intimately present. We exhort. them to do so in a special manner by carrying out their resolu-tions, by exercising the Christian virtues, as also by applying to their own necessities the riches they have received with royal liberality. The author of that golden book The Imitation of Christ certainly speaks in accordance with the letter and the spirit of the liturgy, when he gives the following advice to the person who approaches the altar, "Remain on in secret and take delight in your God; for He is yours whom the whole world cannot take away from you" (4 [12).Xffr," ~" ,~ The Manner o[ Making the Thanksgiving The very first principle is that of personal liberty. The same way cannot Be laid down for everyone, and there is no universal formula. Wffat is important above all is that in this meeting with Christ the soul should express itself personally. One cannot, then, lay it down as a hard and fast rule that the best way to make a thanksgiying is to follow the priest in the prayers he says towards the end of Mass. Besides, taken from the point of view of giving thanks, it must be admitted that in the Roi'han Rite these prayers are very brief and only slightly' d.eveloped. Cer-tainl); at Masses where the congregation sings or pub-licly recites the pray+rs, this activity will be shared by tl~0se who have communicated. They 16ave till later the completion of their thanksgiving in a thore personal man-ner. But where neither hymns nor'prayers are expected from the congregation, each communicant is free to fol-low his own taste. On the c;ther hand it is quite possible that an individual will need educating in the use Of thig liberty. An obvious example is that of children, and the same may be "true of a number of the'f~tithful. In orderto help their thanks-giving a prayer may be recited or an intention placed before them. Care should always be taken to introduce va,riety in order to avoid monotony and routine. But if there is great freedom in the loving converse that a thanks-giving should be, there are still certairi principles which should guide .the exercise of this liberty. We suggest, at any rate, two such principles. _Firstly, thanksgiving is the kind o.f prayer .which is par excellence directed towards the person of our Lord inti-mately present. Indeed, as we have noticed, the Eucharist is d!stinguished from the other sacraments by this gift of the personal presence of Christ. It follows that after Com-munion we should be concerned to develop all that brings our attention to bear upon the very person of the Savior. Before all else.~ this person claims our ad~oration. In renew-ing his faitfi'in the presence of God now bestowed upoh him so intimately, the communicant adores the Lord with his whole soul; and proclaims before the Infinite Being that he is a creature and utterly depend~nt. But as this in-finite being is now his guest, the com~nunicant tries to converse with Him familiarly. He c~mverses with Christ who is the identi(al'Christ of the Gospel, the Christ who The Cath~oiid Mind, 46 (June, 1948), 363--64. ÷ +- + Thanksgiving Alter Holy Communion VOLUME :~0, 1961 ÷ ÷ ÷ lean Galot, $.]. REVIEW FOR RELIGIOUS 32 enjoyed being in the company of men. The thanksgiving is the privileged moment in this personal dialogue. On the other hand it is no less important to recall that the thanksgiving is indeed the prolongation of the Mass and its completion in the individual soul. In consequence .there should be an effort to develop the dispositions which unite the soul with those of Christ in His sacrifice. Be-fore we go on to mention these dispositions, a word should be said about the Mother of God. MaTy can bring great help to the soul in its effort to unite itself to Christ's sacri-fice, just as she aids in the effort towards union with 'His person. The Blessed Virgin remains the model of per-sonal welcome to the Savior's presence, as well as of an intimate sharing in the redemptive sacrifice. She has a mission to draw souls along this way. It will be particu-larly helpful to have recourse to her in order to ensure a genuinely fervent thanksgiving. Among the dispositions which associate us with Christ's sacrifice is gratitude, for it has given its name to the Eu-charist. We have to own that we owe all to God our Father, and we should thank Him accordingly. It is to Him that we owe in the first place the immense benefit of Com-munion itself, and the gift of the Savior's body. Then comes offering. Once we have owned that all is the Father's sift there is the wish to.°ffer Him all in re-turn. The total offering that Christ makes in the Mass entails a total offering by the communicant. Thus'Com-munion prepares the soul for the sacrifices of the day ahead those sacrifices 3vhich are the effective seal of what has been offered at Mass. If it is possible to foresee certain sacrifices, it may be desirable to offer them in advance during the thanksgiving; thus the Christian will be helped to accept them in the right spirit when they come, a spirit of intimate union with Christ and the love which was carried to love's extreme limit. Thanksgiving gives the soul the opportuniiyto adopt an ideal attitude of gener-osity Which it will ~try to maintain when the difficult mo-ments do in fact arise. We should also-mention confidence and joy. Christ present in the soul is the glorious Christ, and his sacrifice was consummated in the triumph of the Resurrection. The thanksgiving should strengthen confidence in the victory the Savior h~is won, both in Himself and in others, and in such a way that the communicant is able to face more firmly obstacles to his personaFreligious life and apostolate. There should also be a renewal of spiritual joy. Coming from Communion the Christian should have a heart filled with enthusiasm and be manifestly happy, for he has just welcomed the triumphant Christ. Neither should prayer of petition be forgotten. The sacrifice of the Mass is celebrated in order to spread divine graces more abundantly upon men. The communicant ought to unite himself with the salvific will of God which, in Christ, inspires sacrifice. With the Savior he should de-sire the expansion and progress of His Kingdom; he will become more and more one. w~th the intima~t,e~desires of Christ in proportion as he makes his own the great inten-tions of the Church and asks for their fulfillment. At the same time the communicant entrusts his own private in-tentions to Christ, intentions that represent his own share of responsibility in the advancement of the Kingdom. He will take advantage of the Savior's presence in order to express his desires and hopes and to obtain their satisfac-tion. Finally, among those dispositions which we may expect the thanksgiving to develop is fraternal charity, that love of one's neighbor of which Christ's sacrifice is the perfect and extreme form. Ever since St. Paul the Church has loqked upon Holy Communion as the most powerful sac-ramental bond linking Christians, the artificer par excel-lence of the unity of the Mystical Body. Thanksgiving should contribute to the flowering of charity, both of that direct charity which concerns the people with whom daily life brings, us into contact, as well as 6f that more ample charity which goes out to the furthermost confines of the whole Mystical Body, and which is marked by a special goodwill towards our separated brethren. Such, then, are the essential dispositions which thanks-giving should develop. One could add others, or further stress certain aspects of those which we have mentioned. With Father Rahner we say .that all that is really pious may find its place in the thanksgiving, all that touches the heart of the communicant, his cares and his intentions. For the point is that thanksgiving may be seen as a kind of r~sum~ of Christian piety, of which it is the richest and most complete moment. In thanksgiving participa-tion in the sacrifice of the Mass~ reaches its peak, just as does union with the Savior's person. All the diverse, inti-mate attitudes of a man before God may therefore here be manifested in the deepest and most concrete fashion, with a most sincere personal impulse. Thanksgiving A]t~r Holy ommunion VOLUME 20, .1961 I~MILE BERGH, S.J. The Communicant's Our Father ÷ ÷ + The Reverend ~mile Bergh, S.J. is editor of Revue des Commu-naut~ s Religieuses and Professor of Canon Law at Coll~ge Saint-Albert, Eegenhoven - Louvain, Belgium. REVIEW FOR RELIGIOUS 34 The Lord's Prayer expresses perfectly the-dispositions which should be found in the Christian who participates integrally in the H01y Sacrifice by sacramental Com-munion. It is certainly proper to think that at the mo-ment when our Lord actualizes in us in a special way His work~of salvation, He teaches us by His Spirit the prayer of redeemed sons. Le~ us then respond to this grace. Father! We are to call You by this name because Your Son, present in us, communicates to us His" divine life. May His Spirit make us taste Your paternal love. Our Father! We all form but one body, we who h~ive partaken of the same bread. In Christ we encounter all of Your sons. We will be always more brotherly toward them. We pray to You especially for our brothers, sep- "arated Christians, that they may participate ih our Eu, charist in the only Church of Christ. Who art in heaven! We believe firml~ that we have re-ceived the bread come down from heaven. Grant, our Father, that we may live close to You in spirit in the so-ciety of~the angels and saintS. Hallowed be thy name! The Eucharistic offering gives You perfect glory. YoUr holiness, Your power, Your love, all Youi attributes proclaim themselves in this mystery. W~ Unite our adoration to the Holy, holy, holy of the angels. We render You all honor and glory through Your beloved Son. Thy Kingdom come! Grant that from the rising of the sun to the going down thereof all people will offer this purest sacrifice to You, so that the entire universe may submit to the sweet yoke of the Lord Jesus. May His reign of truth and of life, of holiness and grace, of justice, of love, and peace extend itself by means of the Eucharist to all nations. Thy will be done on earth as it is in heaven! To receive communion is to participate in the obedience of Your Son. In everything He has done that which was pleasing to You. We give ourselves over to His will as He has given himself over to Yours for us. Make us, by the Spirit of Jesus, faithful and loving, patient and resigned. So 'the world will believe that You are Love, and the fiat of ~he earth.will echo the Amen i~f heaven. ~ . ~ Give us thi~ day 9ur daily bread! After the gift ~which You have just given us, the bread of eternal-life, can we doubt for a moment your Providence and not wait to re-ceive from it all the help for which our misery has need? Give us each day the bread of heaven. Give it to us in our last hour. Give it to all suffering humanity, for it is the guarantee of eternal happiness. Forgive us our. trespasses! By the ~mystery of the Re-demption, ~,hic.h has just renewed itself.,~f~ "us, by the power of the Body~and the Blood of Jesus, our Savior, purify us of our faults; give us deep contrition for them, pen~etrated with love and~fihal confidence. .~ As we forgive those who trespass against us! On the altar as at Calvary You pardon Your enemies. You have desired that we should reconcile ourselves Witti one another be-fore presenting our offering. Teach~ us to imitate You~ mercy w.hmh ng~ther judges ngr condemns, but pardons without tiring. By the charity which we draw from the Heart of Your Son may we be everywhere and always artisans of peace and union. Lead us not into tempthtion! We-ha~e been made mem-bers of Your Divine Son. Do not l~t us profane His most holy Body. We ate threatened on eve~ sid6,.,f0'r w'e are feeble and inconstant, imprudent and (owardl~. Welean solely on His strength and His 'love. YoUr S6.n could not be very powerful, were He unable to support U.S from one day to the next. But deliver us from evil! For one who has understood what Communion i~, tl~ere is but one evil" on earth: to lose or allow to grow cold by s~in the friendship of God. Deliver us from sin and fronl everythin~g-which leads to sin. Deliver poor. sinners fr6m their slavery.~ Amen! It is Your love which, after halving invented the marvels of the Incarnation" and the Redemption,. has crowned their magnificence with the ~ystery of the Eu-charist. We believe in-and w~ will always believe even more in Your charity. The Communicant's Our Father VOLUME 20, 1961~ MICHAEL NOVAK Saint East and West ÷ ÷ ÷ Mr. Michael Novak, a well known writer on various subjects, is cur-rently studying for a graduate degree in ~unhiivleorssoitpyh.y at Harvard REVIEW FOR RELIGIOUS In these days of the re-unifying of East and West, the great John Chrysostom stands as a long-ago figure to whom both sides already turn with reverence and love. The Bishop John (3't47-~07) won the hearts of his people so wholly by his gifts of spirit and of tongue that they could not refrain from calling him as by a proper name: John of the Mouth of Gold. The saint and bishop is a crucial figure for the understanding of the meaning of the East. For he was Bishop of Constantinople in the time in which it was beginning to exert its power as the new center of the East. At the time of Nicaea in Byzantium was still inconsiderable. To the cultured world, it meant little save as the recent choice of Con-stantine for his eastern headquaiters. To the Church, it was again inconsiderable, compared to the great sees of An tioch and Alexandria which, with Rome, formed the triangle of influence in the first three centuries of Chris-tianity. But by ~81, at the second ecumenical council, Constantinople had squared the triangle by becoming the third great patriarchate of the East, and had in fact shouldered out her Eastern rivals to take second rank to Rome alone. Rome and Constantinople: two instead of four. The Emperors, of course, both of East~ and West, would be sympathetic to such centralization.' Magistrates and bishops, these were the focal points of leadership among the people (not as in our own day, when com-munications leaders, unions,, vocal professional classes, and so on, offer other focal points of leadership). To have the bishops aligned with the magistrates was then the simple key to unity and civil peace. To have one 'bishop in authority in each half of the Empire was to limit to two the locks in which to turn the key. In ~98, when St. John was raised to the patriarchal throne of Constan-tinople, the system was beginning to manifest what would be its classic workings. John Chrysostom had been ordained a priest and had been preaching at Antioch for a dozen years when he was kidnapped and borne away to Constantinople. He was kidnapped, so that neither he nor the people could . successfully protest--there was vigor and imagination to actualize cabinet decisions in those old days. How did John react to the outrage? There was no escaping the sit-uation. For the glory of God he set his hand to" the task with courage, then with joy: ., ~.' ~" Cardinal Newman's famous essay gives us perhaps the best image of this man Chrysostom, for whom the Car-dinal felt one of the most intimate ties among all the men of history. Why was John a great orator? Because he spoke in the measures of Cicero? to the public weal like Demosthenes? mystically like the ardent Origen? as a witness of the faith like Athanasius? s~,eepingly and cre-atively like the grei~t~Augtistine? humanly and commonly upon the Bible like the Antiocheans among whom he was trained? No, says Newman, he won the greatest ac-colade of any human orator because of his closeness to his people's heart. He spoke for them, adapted all his talent and his heart to their needs and characters. ~They crowded one another to hear him. He defended them. He loved them. Against those who plotted against him, the high in Church and Empire, the people were his strength: not at all because he was a demagogue, but be-cause he was a shepherd who knew his Own, whose own knew him. His greatest characteristic, the secret inner x~ord of his life, Cardinal Newman conceives, was his "intimate ~ym-pathy and compassionateness for the whole world,~ not only in its strength but in its weaknesses." His singular mark is "the interest he takes in all things, not so far as God has made them all alike, but as he has made them different from each other., the discriminating affection-ateness with which he accepts everyone for what is per-sonal in him and ianlike others., his versatile recogni-tion of men, one by one, for the sake of that portion of good, be it more or less, of a lower,order or a higher~ which has severally been lodged in them., the kindly spirit and-the genial temper with which he looks round at all things which this wonderful world contains." Out of such love, Chrysostom could approach his peo-ple with balm and sweetness evefi when ~he chastised. He hated and feared only sin; he was willing to die over and over for his people; he told them that. His own life was active and abstemious to infective measure. He did chas-tise; he made enemies. Impulsive and courageous both, he was not cautious with that talent of his: he spoke. The people loved him mightily for his courage and his single-ness. "His friends loved him with a love stronger than death, and more burning than hell; and it was well to be so hated, if he was so belovedT' When Theophilus, the Patriarch of Alexandria, enviously contrived with the of-fended Empress Eudoxia to exile John in 403, the first ÷ ÷ ÷ Saint ot East and West VOLUME 20, 1961 4. + 4. Michael Novak REVIEW FOR RELIGIOUS 38 exile, John could not be cautious even while his fate hung in the balance. He preached with great fervor to his people: "Christ is with me; what then have I to fear? . Already you are even more earnest than before. And when tomorrow you go out singing the litanies I shall be with you, for where you are, there also am I, and where I am there are you. Though separated in space we shall ever be one in spirit, for we form one body and it cannot be separated from its head . I am ready to give my life ten thousand times over for you . You have watched many days and nothing has moved you from your pur-pose. You have not been weakened by threats or by long-drawn- out waiting--you have done what I have always been w~anting you to do: set earthly things at naught, turned your backs on this world, risen above the slavery of the body. That is my crown, my consolation, my anoint-ing, my token of immortalityl" 1 Thus was John's union with his peop!e. His affection-ate heart poured out toward each of them, and they re-sponded. By a ruse, at the time of his second exile, he called for his riding mule at one side of the cathedral, then slipped out the other, lest the gathering crowds riot against the Imperial troops who led him off: John always thought of the people. In exile, too, on the far eastern shores of the Empire "in the loneliest spot on earth," John thought of them. He wrote them hundreds of letters, asking of their health, consoling, chiding, directing, beg-ging money for new missionary needs which he had come upon in his travels. John's first trait was compassion. His second was sanguinity: never have I had it so good, he writes shortly after he had nearly died, this frail man in his sixties, in toilsome travel; the cool air, the leisure, the care heaped on me have refreshed me. "My health was never better." His third characteristic was courage and impetuositymtogether with his goodness, these brought him to his exile and his martyrdom. To understand the malice and passion that could have moved Christians to send so good a shepherd to exile and to death, we must reflect on many aspects of the Chris-tianity and of~ the world in John's time. The peoples around the blue Mediterranean were now Christians only three hundred years or, much more accurately, only for two or three generations. The perfection of holiness, the expression in manners and institutions of the love and justice of the Lord, had hardly had time to be explored even mentally, f.ar less sink deeply by habit into the tissue and fibre of society. Elementary passions were fierce. Ways and means were direct. Monks--those whom Christianity might be suppo.sed most thoroughly to have transformed 1 Donald Attwater, St. John Chrysostom: The Voice of Gold (Mil-waukee: Bruce Publishing Company, 1939), p. 126. II were known in several places to have torn enemies limb from limb with bare hands; their riots at Alexandria were a terror. The soldiers guarding Chrysostom at Caesarea risked murder and enslavement at the hands of Isaurian barbarians rather than face the mob of monks "Who de-manded that Chrysostom leave the' city. As f6~ tl~*hier-archy, Chrysostom-said he feared nothing as he feared the Bishops. Treachery that led to flogging, tearing with hooks, burning with torches as happened to one of Chrysostom's deacons, a gentle youngster runs through the history of this time as bright scarlet and yellow thread. We must understand the wildness of the. times, and the fierceness of even tl~e next many. centuries, if we are to understand the play of human passion ;ind barbarity upon which Christianity is called to ~zork. Violeni" im-pulses, cruel machiriations, fierce self-int~rest, still rhn rampant in ourselves; but we must make an effort to re-call the times when society itself more directly expressed thes~ evil movements, less effectively neutralized and hid them. Civil magistrates and ecclesiastics may not in the main be hny holier now than heretofore, but political forms, canon law, the persistent suasion of civilized con-ventions prevent their being as violent in their evils as once upon a time save where the primitive passions arise again under the ifnpulse of marching boots and songs and shouts. ~3nce this backdrop of primitive violence is set, still another note in Chrysostom's situation must be recalled. It is this. The glory of European_ civilization was in the fourth century pivoted not yet on Europe proper but still on Alexandria and Antioch and old Byzantium. The East bore the glory of human history. Greek was the great language of the Empire. Christ had come in the East. Greek philosophy was reborn in Origen, Plotinus, Por-phyry. The great councils of the Church were Eastern councils. The Near East flourished with libraries, splen-did cities, the roads and methods taught and fostered by the earlier Romans. The deserts of Egypt and the fast-nesses of Cappadocia and Caesarea heard in th~ still crystal nights the prayers of Eastern monks. Augustine was only now bringing glory to the Latin tongue; Benedict was not yet shifting the pivot of spiritual energy from Egypt to Subiaco. Western Europe was only now b~ing conceived: the East would bring her forth. In the violence of local jealousies and entanglements with the state, Chrysostom, the light of the East, could appeal to Innocent of Rome. The Pope and he could find solace in one another's reverence and love. East and West were not yet fighting against themselves, as mother against her daughter, as land blessed by the presence Of Christ against land chosen as the humble seat of Christian leader-÷ ÷ ÷ Saint o] East and West VOLUME 20, 1q61 ÷ ÷ ÷ Michael Novai~ REVIEW FOR RELIGIOUS 40 ship. Chrysostom appealed to Innocent; Innocent replied with love. But Innocent's powerlessness foreshadowed the doom that'was to come, as the torture and dispersal of his emissaries foreshadowed other injuries of each side upon the other in the centuries to come. These were still prom-ising times, at the end of the fourth century. Chrysostom's fame went around the world; Africa and Italy shared the suspense and pain of his exile, and waited upon his let.° ters. These were among the last generations of unity of sentiment between East and West. Like the mysterious column of flame that leapt up in the night from Chrys-ostom's pulpit and burnt his cathedral to the ground, as he took ship never to see Byzantium again, so the glory of the East was to feel the flame and fire of centuries of strife, long separation, and continued misunderstanding. Why was Chrysostom sent into exile? When he came to Constantinople as Patriarch, he had begun, as Donald Attwater says, to sweep the stairs from the top. He re-buked, encouraged, disciplined, set the example for his clergy. He spoke courageously against the rich, on behalf of the poor for justice' sake, on behalf of Christ for humility's and charity's sake. He rebuked vanities and thoughtless injustices. He spoke plainly to the Empress and her court. At a crucial moment he dared to speak impulsively of the vanity of wealthy women of the court, perhaps even deliberately to ring out adoxia (disreputa-ble) to suggest Eudoxia (the Empress). Theophilus of Alexandria had had little difficulty setting enemies in motion concertedly against him. Exiled once, brought back in glory shortly--in a harbor crowded as a city square, to shouts, to joy--he was soon exiled again, de-finitively. The reasons hardly mattered. Enemies he had. Richly slippered toes he had trampled on. The ardent affection of the people could not prevent the outcome. Why was Chrysostom sent into exile? It was not only for the reasons of state, the trumped-up charges, then the consequent intrigues, the pressures, the Imperial com-mands to make the charges stick. These were trivial, dispensable. If it had .not been these, it would have been others. Good men must be broken. This is the law of Christianity. Chrysostom understood it, explicitly. Chrysostom's great natural gift was his unequalled heart-enflaming tongue; by all the laws of Christianity, his tongue would have to be silenced. Chrysostom had to be sent into exile, to the 'farthest parts of the Empire, so that God's grace might work where he had worked be-fore, Silent now in tongue, his letters live for ages--letters exile forced on him. Chrysostom grasped the fact that the kingdom Christ came to bring has laws for its inner life which set history topsy-turvy. A historian seeing the incredible malice, jealously, and ferocity of religious leaders in these times might marvel, with contempt, that Christianity could achieve so little fruit, even~,among her own.W, i~.t~',hier-archy, favor, churches, energies,~Christianity seems to do so lattle, for all 1.ts lovely wor~ls, to give the race-new hfe. But Christianity is not hierarchy or social acceptability. It is not monasteries or many vocations or crowds in church. All these did not prevent, they caused, the tor-ture of Chrysostom to death. Christianity is sacrificial love. Christian life is sacrificed life. Hence persecutions must come. If they do not come from those outside Chris-tendom, they must come from the corruption or limita-tions in the organization itself. Indeed, saint will perse-cute saint°as St. Jerome and St. Epiphanius joined Chrysostom's enemies; as good Cardinal Manning and khe saintly Newman could hardly bear each other's com-pany without severe constraint. Sacrificial love is the in-ner life of the Church. All the turmoil at Constantinople --jealousy, scheming, lying, banishment, and torture for those who would not w6rship with the false successors-- all this was necessary to make the inner life of Constan-tinople's faithful fructify. Christianity simply cannot live without suffering. External standards and measurements have got, at times, to be set at odds. Only so can con-sciences be proved truly mature, strong, brave, bold, in the darkness of faith and selflessness. "There is no need to remind you, the teacher and shepherd of a great flock," wrote Pope Innocent to Chrysostom, "that everywhere and always good men are put to the test of meeting with injustice and evil . Rest securely then in your good conscience, honored brother, for that is the strength of all good men in the hour of~affliction." "Do not be scan-dalized," John wrote to Olympias, recalling the ~candal of the Incarnation and of all the Scriptures; "remember that things even more distressing happened in the days of the Apostles." Though disunity and injustice racked his see, though true Christians were driven from the churches while the cowardly or the vicious pretended to worship there, though he himself was driven ever further into exile, forced to travel and again to travel (an attempt by his enemies to murder him by physical exhaustion), still Chrysostom could die with his favorite phrase upon his golden lips: "Glory be to God. Amen." Chrysostom un-derstood Christian love. "Be true to yourself and no one can harm you," he wrote in a last short treatise which he sent Olympias. Conscience is the dwelling place of Chris-tianity, and sacrificial love is the life of conscience not duty, or conformity, or complacency, or obligation, or law. Purified will, enamored of persons, and a Person. Hierarchy, canon law, even the Holy Mass itself, the sacra-÷ ÷ ÷ Saint oI East and West VOLUME 20, 1961 41 ments these are but means. They are some of them in-dispensable means, to be sure, given by Christ. But the accent may as accurately be On means as on indispensable. The law is love. The Way is love. The fruit is love. And love means sooner or later darkness, trial, and suffering. If East and West are separate since the tiine of John, it is because all kinds of considerations have got the better of sacrificial love. Historically polemic has been preju-diced and fruitless, each side preferring personal empha-ses to self-sacrificial views of truth. Why do Roman Cath-olics in practice if not in theory, exaggerate the legalisms of the external Church out of all proportion to their Christ-given role? Because these aspects have been under severe attack for many centuries and, knowing their value, these people have not got accustomed to seeing their limitation they are means, not the goal. Why do Easterners resist the effort of unity? Because they do not wish to forfeit centuries of tradition by a too humiliating capi~tulation to Western points of view. There are count-less 6ther reasons: none of them are insuperable, save through lack of charity. The inner dynamism of Chris-tianity is toward unity. Disunity makes for inner anguish; quarrelling causes our intensest pain; selfishness and ac-cusation make witnesses "cry out to the Lord for mercy and for aid. Just so, the scandal of disunity is our trial and darkness. The inner life of the Church is Sacrificial love. That is why the first need of East and West, when we speak of unity, is to focus our eyes with mutual regard on men as lovable as St. John Chrysostom, pride of the East and of the universal Church. Our longing hhs got to be the same as his: to be consumed, like John of the Mouth of Gold, in thq paradoxical, interior ways of the Lord's love. Michael Nov~ REVIEW FOR RELIGIOUS 42 R. F. SMITH, S. J. Documents The documents wh.ich appeared in, Acta Apostolicae Se, d~s I(AAS) during August and September, 1960, will be summarized in this article. Throughout the article all page references will be to the 1960 AAS (v. 52). New Breviary and Mass Rubrics By the apostolic letter motu propriO, Rubricarum in-structum, of July 25, 1960 (pp. 593-95), Pope John XXIII announced a new code of rubrics for the Roman Breviary arid Missal and decreed the revocation of all statutes, indults, and customs contrary to the new code. On the following day, July 26, 1960 (p. 596), the Sacred Congre-gation of Rites duly promulgated the new code of rubrics and directed that their observance be begun on January 1, 1961. The new code~ is a long document of one hundred and forty-four pages (pp. 597-740) and is divided into three parts which deal consecutively with general rubrics, rubrics of the Roman Breviary, hnd rubrics of the Roman Missal. "° General Rubrics Part One of the new code, entitled "General Rubrics," ¯ consists of nineteen chapters. The first of these chapters notes that the document is intended only for the Roman Rite. Chapter Two defines the mean.ing of liturgical days and rules that all such~days are now to be divided into first-, second-, third-, and fourth-class liturgical days. Chapter Three divides all Sundays into first- and sec-ond- class groups. First-class Sundays are the Sundays of Adveht, Lent, and Passiontide, Easter, Low Sunday, and Pentecost; all other Sundays are.second,class ones. First-class Sundays take precedence over all feasts with the ex, ception of the Feast of the Immaculate Conception. A second-class Sunday outranks a second-class feast and, when it occurs on November 2, displaces All Souls' Day. However, first- and second-class feasts of our Lord, ~when 4. 4. Survey oy Roman Documents VOLUME'20, 1961 R. F. Smith, $. ]. REVIEW FOR RELIGIOUS they occur on a second-class Sunday, take over the place as well as all the rights and privileges of the Sunday; in such cases accordingly no commemoration is made of the Sunday. Ferials, Vigils, Feasts Chapter Four defines ferials as days of the week other than Sundays and divides them into four classes. First-class ferials are Ash Wednesday and the ferial days of Holy Week; all these ferials take precedence over all feast days and admit no commemoration except a privi-leged one. Second-class ferials are the Advent ferials from December 17 to December 23 and the Ember Days of Advent, Lent, and September. These ferials outrank sec-ond- class feasts and must be commemorated when out-ranked. Third-class ferials are all the other ferials of Advent, Lent, and Passiontide. Third-class Lenten and Passiontide ferials outrank third-class feasts, but third-class Advent ferials yield to such feasts. All third-class ferials, however, must be commemorated when out-ranked. All other ferials of the year are fourth-class ones and receive no commemoration when outranked. Vigils are divided in Chapter Five into three classes. The two first-class vigils, those of Christmas and Pente-cost, take precedence over all feast days; and the Vigil of Christmas, when necessary, takes the place of the Fourth Sunday of Advent. Second-class vigils, those of the Ascen-sion, of the Assumption, of the Nativity of St. John the Baptist, and of Sts. Peter and Paul, outrank third- and fourth-class liturgical days; the only third-class vigil, that of St. Lawrence, is preferred tO fourth-class liturgical days. Both second- and third-class vigils, when impeded, are commemorated according to the rubrics governing such matters; these vigils, however, are omitted if they fall on a Sunday or a first-class feast or if their feast day is transferred or reduced to a commemoration. Chapter Six groups feast days into first-, second-, and third-clvss feasts. Only first-class°feasts have First Vespers; however, second-class feasts of our Lord have First Vespers whenever they replace a second-class Sunday. The rest of this chapter is concerned chiefly with those feasts which the law now requires to be inserted into particular cal-endars drawn up for the use of dioceses or of religious orders and congregations. Chapter Seven r~tains only three octaves, those of Christmas, Easter, and Pentecost. The octaves of Easter and Pentecost are first-class ones; that is, all the days of these octaves are first-class. The Christmas octave is a second-class one; the days within the octave are second-class, but its Octave Day is a first-class day. Chapter Eight lists the various seasons of the ecclesi- astical year, while Chapter Nine provides for the Saturday Office of our Lady. Chapter Ten considers the Major and Minor Litanies; it notes that, those bound to the Office no longer need to say th'e' ~itany of the Saints on the Rogation Days; it Mso giv~'sq6~al ordinaries ~he ~I56wer to transfer the Rogation Days from their usual place to three other successive days at a more appropriate time. Precedence of Liturgical Days Chapter Eleven gives a breakdown of the days of the ecclesiastical year into the four classes of liturgical days and gives the rank of precedence within each of the four classes. First-class liturgical days. include all first-class Sundays, feasts, ferials, and vigils as well as the days within the octaves of Easter and Pentecosti the Octave Day of Christmas, and All Souls' Day. Seqond,class litur-gidal days are all second-class Sundays, feasts, ferials, and vigils together with the days within the octave of Christ-mas. Third-class ferials and feasts and the one third-class vigil constitute third-class liturgical days, while fourth-class liturgical days include the Saturday Office of our Lady and fourth-class ferials. Chapter Twelve defines what is meant by the occur-rence ~of liturgical days, and the following chapter gives the rules to be followed when two or more liturgical days happen to fall on the same date. In such cases only first-class feasts may be transferred; all other feasts are either commemorated or completely omitted. Chapter Fourteen gives the procedure to be followed in the case of a per-petual occurrence of liturgical days. Chapter Fifteen reg-ulates the situation that arises when the Vespers of one liturgical day conflict with the First Vespers of the suc-ceeding day. If the days are of unequal rank, the Vespers of the higher day are to be said; but if the two days are eqtlal in rank, Second Vespers are to be said with a com-memoration of the other set of Vespers. Commemorations Chapter Sixteen divides all commemorations into priv-ileged and ordinary commemorations. Privileged com-memorations are made at Lauds and Vespers and in all Masses; ordinary commemorations on the other hand are made only at Lauds and in conventual and low Masses. Privileged commemorations are the commemorations to be made of a Sunday; of first-class liturgical days; of~ the days within the octave of Christmas; of the September Ember Days; of Advent, Lent, and Passi?ntide ferials; and of the Major Litanies (but at Mass or~ly). All other commemorations are ordinary. In Masses of first-class liturgical days and in sung non-conventual Masses, no commemoration~is to be made ex- 4. 4. 4- Survey Roman VOLUME 20, 1961 45 cept a privileged one. Second-class Sundays permit a commemoration of a second-class feast only; even this, however, is to be omitted if there is a privileged com-memoration. Other second-class liturgical days permit one commemoration, whether privileged or ordinary. Third-and fourth-class liturgical days permit only two commem-orations, Chapter Seventeen gives the conclusions to be used for the orations and commemorations of the Breviary and the Missal. Chapter Eighteen is concerned with the litur-gical colors; it gives episcopal conferences in mission" ter-ritories the power to change the liturgical colors when they are inappropriate for that particular region. Chapter Nineteen completes Part One of the document by its rubrics for Mass" and Office vestments; according to this chapter the folded chasuble and the broad stole are no longer to be used. 4- 4. ÷ R. F. Smith, S. ]. Breviary Rubrics Part Two of the new code of rubrics is entitled "Gen-eral Rubrics of the Roman Breviary." Chapter One of this part divides the recital of the Office into choral,~com-mort, and individual recital. Choral recital is that of a community obliged to choir by ecclesiastical law; common recital is that of a community (two or three persons are sufficient) not bound to choir. Chapter Two notes that the canonical hours are dis-tributed in a way intended to sanctify the natural day; nevertheless to satisfy the obligation of reciting the Of-rice it is sufficient if all the canonical hours are said in the twenty-four hour period allotted them. Matins (but not Lauds1) may be anticipated after two o'clock in the after-noon of the preceding day. In choral and common recital Lauds should be recited in the early morning and Ves-pers, even during Lent and Passiontide, in the afternoon. The same p.ractice is recommended for private recital. Compline is fittingly made the last prayer of the day, even though Matins of the following day have been antici-pated. When Compline is made the last prayer of the day m choral and common recital, the Pater noster is omitted, its place being taken by an examination of conscience ~of reasonable length; the Confiteor and the rest of Compline are then.recited. All of this is also recommended .for indi-vidual recital. Chapter Three then discusses the calendar to be followed by those bound to the Office. Chapter Four begins by listing three types of Matins. .The first type, consisting of three Nocturns, that is, nine Psalms and nine Lessons, is used on first- and second-class REVIEW FOR RELIGIOUS lit is probable that in private recitation Lauds may still be 46 anticipated. feasts, on the lfist three days of Hply Week, on the Octave Day of Christmas, and on All Souls' Day. The second type consists of a single Nocturn of nine Psalms and three Lessons; it is Used on all Sundays except Easter and Pente-cost, on all ferials except the'q~t three days of Holy Week, on vigils, on third-class feasts; on'the days within the octave of Christmas, and at-the Saturday Office of our Lady. The [hird type of Mating, used only on Easter and Pentecost and throughout their octaves 'if composed of a single Nocturn of three P~Alms find three Lessons. The chapter continues by" considering th~ five kinds of Offices which are now ~6 b~ used in the recital of the Breviary. "I:l{e Sunday Officd i~xcluding th6 Office°for Easter, Pentecost, and the Sunday within the oc'tave of Christmas) is largely the same as formerlywith the excep-tion of Matins. At Matins are recited the nine Sunday Psalms, then the absolution Exaudi; the Blessings to be used are Ille nos, Divinum ~iuxilium, and Per 'evangelica dicta. The First Lesson is the same as the former First. Leg-son of the day's Scripture; the gecond~ Lesson is formed'by u~iting the former Second and Third Lessons of the Scripture; and the Third Lessoh ig the First Lesson of the Homily, that is, the former Seventh Lesson. The festive Office is used for all first-class feasts and is said in the same wgy as an~ Office of a double of the first clasg was formerly said. The semi-festive Office, used for second-class feagts, is said in the same°way that Offices of doubles of the sdcofid clasg'have been~recited since 1~55. The ordinary Office, that uged on third-class feasts and for the Satm'day Office of oui'Lady, is recited like the former simple Office except for s6me changes in the Les-sons. The First Lesson is the former First Lesson of the day's Scripture, the Second Lesson is formed by uniting the former Second and Third Lessons of the Scripture, and the Third Les~on is of'the feast. This Third Lesson is obtained by using the "contracted life of the saint_ in the former Office; or, failing that, by.~om.bining the Fourth~ Fifth, and Sixth I~ssons of the former'prope.r Office of the feast; br finally, if .t.~ae feast has no Proper, by using the former Fourth Lesson of the Common. The ferial Office, used on all fer'ials and vigils except the last three days o.f Holy"Week and the Vigil of Christmas, is like the former ferial Office with Lessons either of the H~omi!y or of t~e day's Scripture. The Dil~eren.t Parts o['~the .OOice ,, ,.+,. Chapter Five, which legislates for the various parts of the Office, makes several changes which "can be-noted here. All Hymns of the Office have only the conclusion given in the Breviary, all changes~ of the conclusion by reason of feast or season being now excluded. The com-plete Antiphon is always to be said in its entirety both ÷ Survey o~ ~ Roman Documents ;=VOLUME 20, 1961 ÷ ÷ R. F. Smith, S. ]. REVIEW FOR RELIGIOUS d8 before and after the Psalms and Canticles of all the canonical hours. The Responsoria of Offices with three Nocturns are to be taken from the Proper or the Common as previously. In the.Sunday Office, however, the first Responsorium will be the one given after the former First Lesson; the second will'be that given after the former Third Scripture Lesson; and the third, when needed, will be the Responsorium formerly recited after the Third Lesson of the Homily. In ordinary Offices with Lessons taken from the day's Scripture, the first Responsorium will be that used after the former First Lesson, while the second will be that formerly used after the Third Scrip-ture Lesson. Ordinary Offices with proper Scripture Les-sons will use proper or o~dinary Responsoria in the° same order as given in the previous kind of ordinary Office. At Prime the Capitulum will always be Regi saecu-lorum and the Lectio Brevis is always to be the seasonal one. In private recital of the Office and when the Office is recited by those who are not deacons, the prayer or oration of the Office is to be preceded-by Domine, exaudi orationem meam with its response in place of Dominus vobiscum and its response. Preces feriales are to be said at Lauds and Vespers of the ferial Office on Wednesdays and Fridays of Advent, Lent, Passiontide, and the Sep-tember Ember Week. They are also to be said at Lauds on Ember Saturdays except on the Saturday within the octave of Pentecost. Chapter Six gives the directions for making the sign of the cross and for bodily posture during the choral and common recital of the Office. It is recommended that the regulations for the sign of the cross be followed also in individual recital.° Mass Rubrics Part Three of the new c~de of rubrics is called "General Rubrics of the Roman Missal." Chapter One gives some ¯ basic notions of the various kinds of Masses and notes that the phrase "private Mass'" should be avoided, since the Mass by its nature is always and everywhere an act of public worship. Chapter Two then considers the calendar to be followed in the celebration of Mass. Chapter Three siates that the conventual Mass, except on fourth-class ferials, must comform to the Office of the day and should be ff solemn Mass, or at least a high Mass. This chapter prohibits the chanting.of the Divine Office during the conventual Mass. Chapter Four is' con-cerned with Sunday and ferial.Masses, while Chapter Five discusses the Mass for feast days. This latter chapter al-lows a priest celebrating a non-conventual Mass to choose a proper Mass for a given feast from the section "for cer-tain places" rather than use a Mass formula from the Common. And in the case of non-conventual Masses, any of the Mass formulas in the correct category of the Com-mon may be used when there is no proper Mass for the feast. Votive Masses "' '" ~' Chapter Six, which deals with votive Masses, begins by general remarks on the subject. It permits all Masses of universal feasts of the Blessed Virgin to be used as votive Masses, excluding, however, Masses of the mysteries of hbr life with the exception of the Immaculate Concep-tion. Sequences are to be omitted in votive Masses and vestment colors should fit in with the votive Mass chosen. In the case of low, non-conventual votive Masses of the fourth class, however, the color of the Office of the day may be used; violet and black, however, are always to be used when demanded by the votive Mass chosen. The chapter then divides votive Masses into four classes. First-class votive Masses, which are those permitted on all litu
