Suchergebnisse

The Mercury October, 1909 HELP THOSE WHO HELP US. The Intercollegiate Bureau of Academic Costume. Cotrell & Leonard, ALBANY, N. Y. Makers of CAPS AND GOWNS To Gettysburg College, Lafayette, Lehigh, Dickinson, State College, Univ. of Penn sylvania, Harvard, Yale. Princeton, Wellesley, Bryn Mawr and the others. Class Contracts a Specialty. Correct Hoods of Degrees The College Man's Opportunity. We offer the Surest Means of finding your right place. Hundreds of good positions open in business, in teaching and in technical work. Offices in 12 cities. Write us to-day. THE JVATIOJS'Al, 0I{ffJ.!\'JZJiTMOJY Of M/*.//•V BROKliHS. Commonwealth Trust Building, Philadelphia, Pa HOTEL GETTYSBURG, Headquarters for BANQUETS. Electric Lights, Bteam Heat, All Conveniences. Free Bus to and from station. Convenient for Commencement Visitors. RATES $2.00 PER DAY. ■Civery CUtac'keol. Joljn T. W[e(i■ PATRONIZE OUR ADVERTISERS. ** i5 « * * ««a ««»a ft a * * ft ft « ft ft ft «a « ft « »« ft ft ft » ft a ft »« « ft ft «»a « ft ft c ft ft » ft ft » ft « ft ft « Seligniqri ARE GETTYSBURG'S MOST RELIABLE TAILORS And show their appreciation of your patronage by giving you full value for your money, and closest attention to the wants of every customer. Give Them *«« * ««a » ft a »»» » «*** a « ft •ft ft ft » ft ft ft « ft ft ft ft ft ft « ft ft ft ft ft ft ft ft ft ft ft ft ft ft ft ft ft ft ft Your Patronage « «« « ♦ * * * * » * •»»«»»*»»»«»»»»«»*»c»»«aftft««»ft»#»»****»»»*«*♦♦ * a a PATRONIZE OUR ADVERTISERS. •* A Special Proposition la open for tbe first person in any com-munity who will deal with us for a Piano or Organ. WEAVER ORGANS AND PIANOS have no question mark to the quality. MAIL THIS COUPON TO US. Send me special proposition for the purchase of a Piano. Name $ WEAVER ORGAN AND PIANO CO., MANUFACTURERS, f | YORK, PA , U S A. | Address \v '■I-' I I II 1II Students' Headquarters —FOR— HATS, SHOES, AND GENT'S FURNISHINGS. Sole Agent for WALK -OVER SHOES ECKERT'S STORE. Prices Always Right TJie Lutheran PuWicdtioij Society No. 1424 Arch Street, PHILADELPHIA, PA. Acknowledged Headquarters for anything and everything in the way of Books for Churches, Colleges, Families and Schools, and literature for Sunday Schools. PLEASE REMEMBER That by sending your orders to us you help build up and develop one of the church in-stitutions with pecuniary ad-vantage to yourself. Address HENRY 8. BONER, Bupt, THE KA ERCURV The Literary Journal of Gettysburg College. VOL. XVII GETTYSBURG, PA., OCTOBER, 1909 No. 5 CONTENTS. ARTICLE I.—TENNYSON" CENTENARY, AUG., 1809- 1909.—Tennyson and In Memoriam 2 REV. CHARLES WILLIAM HEATHCOTE, '05, A.M., B.D. GETTING EVEN 5 E. C. STOUFFER, '11. CULTURE S G. F. POFFENBERGER, '11. NOBLE CHARACTER OUR NATIONAL SAFEGUARD. 9 PAUL S. MILLER, '10. IS THE GRANTING OF ATHLETIC SCHOLARSHIPS GOOD POLICY? 12 PAUL M. MARSHALL, '10. A COMPLETED PLAN 13 TAXIS, '09. THE WORLD IS OVER-ORGANIZED 16 ROT V. DERR, '10. WHAT IS SUCCESS? 21 E. W. HARNER, '12. OUR SYMBOL—OUR IDEAL 23 RALPH E. RUDISILL, '10. AN INDIAN SOLILOQUY 25 1911. EDITORIALS 28 BOOK REVIEWS 31 2 THE MEEOUEY ARTICLE I.—TENNYSON CENTENARY AUG. 1809-1909.- TENNYSON AND IN MEMORIAM. BY EEV. CHAELES WILLIAM HEATHCOTE, '05, A.M., B.D. |ANY problems have disturbed the human race from the very early ages. We have had men in the past history of the world, and in fact through all periods of later development and even now, asking such questions as. Does death end all ? Whence is the origin of evil ? Why do we have suffering ? Is the soul immortal ? Poets, philosophers, prophets, priests, aye in fact all humanity, have grappled and continue to grapple with these deep problems. Socrates, Plato and Aristotle were not the only ancient philoso-phers who sought to know the cause and effect of things. Thus the problem of life, death and immortality have puzzled sages. We have many poets seeking to bring to light various thoughts to explain these things. The Great Master has pointed out to us, and has revealed to us, that if we are true to God, fellowman and self, we shall inherit eternal life. He has revealed to us the con-ditions, how we may be saved, and thus receive immortality. However, with this revelation each generation is able to meet these various problems and with the spirit of truth to be able to understand them in part at least. Also where true understanding is impossible we have a faith in the Christ, which is firm and strong, for, though now we see through a glass darkly, then we shall see face to face, and we shall be known even as we are known. Thus the poets have struggled with these perplexing problems. They probably give us a better insight into the religious consci-ousness of each generation than do the theological writers. They seem to have a deeper prophetic insight into nature. Thus Mil-ton struggled with the same problems. Though his poetry is not popular, nevertheless it is classic. We find there is a deep in-sight into the problems that have confronted the human race. As Alfred Tennyson mourns the loss of his beloved friend and college mate, Arthur Henry Hallam, in the immortal poem, la Memoriam," so Milton has written "Lycidas," a poem, mourning the loss of Edward King of Christ's College. He had perished THE MBHCOKT. 3 in a shipwreck off the coast of Wales on the 10th of August, 1637. Of him Milton writes: "Weep no more woeful shepherds, weep no more, For Lycidas, your sorrow, is not dead, Sunk though it be beneath the watery flood: So sinks the day-star in the ocean bed, And yet anon repairs his drooping head. And tricks his beams, and with new spangled ore, Flames in the forehead of the morning sky." Again, Thomas Gray in his beautiful poem, "The Elegy Writ-ten in a Country Church Yard, points out the tribute to the hum-ble ones who are the strength and power of a nation and who de-part from their loved ones and the world in time seems to forget them. They are deserving of the highest praise and emulation. Thus he writes: "Let not ambition mock their useful toil, Their homely joys, and destiny obscure; Nor grandeur hear with a disdainful smile The short and simple annals of the poor. The boast of Heraldry, the pomp of Pow'r, And all that Beauty, all that wealth e'er gave, Await alike th' inevitable hour The paths of glory lead but to the grave. Nor yet ye proud, impute to these the fault, If memory o'er their tomb no trophiees raise, When through the long-drawn aisle and fetted vault The pealing anthem swells the note of praise. Emerson, our own beloved poet, came face to face with the great problem of death when his son, Waldo, died January, 1842. He wrote the beautiful poem, "Threnody," about the loss of his child. As we read this poem our hearts go out in sympathy to the poet, for we feel every word of the poem vibrating, as it were, with his sorrow. , GETTYSBURG COLLEGE f I Gettysburg, Pa. 1 | - LIBRARY - § 4 THE MEKCDBY. The first part of the poem is a true picture of the poet's grief. He writes: "And, looking over the hills, I mourn The darling who shall not return." In conclusion he writes: "Silent rushes the swift Lord Through ruined systems still restored, Broad sowing, bleak and void to bless, Plants with worlds the wilderness; Waters with tears of ancient sorrow Apples of Eden ripe to-morrow. House and tenant go to ground, Lost in God, in Godhead found." Of the poem Dr. Holmes said, "It has the dignity of Lycidas without its refrigerating classicism, and with all the tenderness of Cowper's lines on the receipt of his mother's picture. Thus when Tennyson wrote "In Memoriam," great grief filled hisieart for the loss of his dear friend and college chum, Arthur Henry Hallam. Tennyson was a man of strong character, pure and noble ideals. He is a philosopher, poet, sage and prophet. His poetry though deep and classic is also popular. He has a living mes-sage for each one. His poetry comes from a deep sympathetic heart and is therefore living and true. Alfred Tennyson, the English poet-laureate, was born at Som-ersby Eectory, Lincolnshire, Aug. 6, 1809. He graduated from Trinity College, Cambridge, the same institution from which Hallam was graduated. Tennyson won the chancellor's medal in 1829 for the poem "Timbuctoo." Tennyson began to write poetry at a very early age. In 1830 appeared a volume of well written verse. In 1842 he published another volume of poems, which showed deep thought and con-templation and which won for him a high place among the Eng-lish poets. In 1847 appeared the "Princess," and in 1850 the world was THE MERCURY. given the immortal elegy, "In Memoriam." In 1855 the poem "Maud," appeared in a volume together with the "Charge of the Light Brigade," and an ode on the death of the Duke of Welling-ton, part of which reads as follows: "Lo the leader in those glorious wars Now to glorious burial slowly borne, Follow'd by the brave of other lands, He, on whom from both her open hands Lavish honor show'd all her stars, And affluent Fortune emptied all her horn. Yea, let all good things await Him who cares not to be great, But as he saves or serves the State." During the remaining years of his life he published the "Idylls of the King," "Enoch Arden," "The Northern Farmers," "Ti-resias," "Demeter" and other poems, "Akbor's Dream," "The Death of Oenone," "Queen Mary," "Harold," "Becket," "The Cup," "The Promise of May," and "The Foresters." He was raised to the peerage in 1874 on account of his ability and also as a tribute to his work. He died Oct. 6, 1892, aged 83 years, at his home Aldworth Surrey. GETTING EVEN. E. C. STOUFFEE, '11. | HEN Eoger Craig received an appointment on the re-porters' staff of the "New York Journal," all his friends and neighbors predicted a bright future for him, and at the beginning of his career it seemed as though their predictions would come true. His willingness to work, keen per-ception and native courteousness made him a favorite with every-one, and at the same time an invaluable member of the staff. The hardest work was assigned to him but he invariably accom-plished it successfully. AVhen he was sent to interview a man he 6 THE MERCURY. usually had a story for his paper. As a result one promotion fol-lowed another in such rapid succession that, any other young man they would have caused to swell up with pride, but Craig only determined to work harder and rise still higher. He had now been in the employ of the great newspaper four years and during that time had risen to the front rank as a re-porter. Occasionally during those four years a letter went from him to the old editor of the only weekly newspaper which his native New England town. boasted. These the old man pub-lished gladly and the townspeople read them eagerly. At the village store when Roger's name was mentioned and his success discussed, old men between streams of tobacco juice, used to say, "I told you that he'd git along." While Craig was getting along in this happy wajr, the morning came when the entire world was shocked by the news that our President, Win. McKinle}1, had been, perhaps, fatally wounded hy an anarchist while shaking hands with him at the Pan-Ameri-can exposition at Buffalo. Eoger heard the news and then thought a moment. A letter wouldn't reach his home town for two days and that would be too late for that week's issue of the paper. Thinking to do a kindness to the old man he sent a tele-graph dispatch to him telling him of the cowardly attempt on the President's life. The old editor was astounded. In all his life as an editor he had never received a telegram. Carefully adjusting his spectacles he read it again and again. This surely must be a mistake. It cannot be possible. Surely no one would try to take President McKinley's life. Wo one could do that. This must, therefore, be a mere joke of young Craig's. And it was plainly his duty to advise the young man against such foolishness. Accordingly two letters left his office that day. One was addressed to Craig at his rooms in New York. It contained a warning against the danger, and a little fatherly advice concerning practical jokes. "A mat-ter of the importance of his recent telegram was entirely too serious for a joke," etc. The other letter went to the managing editor of the "New York Journal" and said that a watch ought to be kept on young Craig, for he must be somewhat beside himself. Then followed a detailed account of the telegram. In the Mid-dleberg "Chronicle" there appeared a long article saying that THE MERCURY. young Craig must have suddenly lost his reason, for this week he became seized with the notion tht President McKinley was assas-sinated, and telegraphed the same to us. Of course we are very sorry for the man and sympathize deeply with him in his afflic-tion, etc. The next morning when the postman brought in the old man's mail he saw the rival newspaper of the neighboring town had its entire front page taken up by an account of the attempt on Mc- Kinley's life. The old man was dumfounded. He might doubt Craig's telegram, but he never could doubt that newspaper. He saw where his rival had beaten, whereas if he had not been so foolish the advantage might have been his. That afternoon he was kept busy cancelling subscriptions to his paper. That night a weary heavy hearted old man wrote a long letter to the young reporter. He offered profuse apologies for the treatment which had been given him and ended by saying that he never would doubt his word again no matter what news item he might send him, he would publish without for a moment questioning as to its truth. Meanwhile the two letters reached their destinations. Eogers received his with a feeling of amusement. His mental comment was merely, "Blamed old fool. He's crazier than I am." But when the managing editor read his a frown crossed his forehead. He pondered a moment and then summoned young Craig. When the young man appeared a stern-faced manager faced him. The manager motioned him to a chair and then said: "I am sorry that I must inform you that your services are no longer required by us. I have here a letter from the editor of your home paper in which he informs me that you have been sending news matters from our office. We pay enormous sums yearly to maintain private wires, so of course we cannot allow our employees to send away what we pay so dearly for." The young man's head swam. Before all looked bright to him. In a moment all was changed. A feeling of intense anger towards the old man, whose ignorance had caused his misfortune, took possession of him and a desire to get even filled his mind. He went to the nearest telegraph sta-tion and sent the following telegram to the old editor: "At last the long-standing dispute between Emperor William and Edward VII concerning the Imperial Crown has been settled. The two 8 THE MERCURY. rulers decided to fight a duel and thus decide. The weapons were automobiles run toward each other at full speed. Santos Dumont in his airship carried Edward VII, the one who was found to be the nearer alive, to Eome, where he was crowned amid loud acclamations from the people." The next morning the little weekly came out with a full page account of the affair and two days later the sheriff closed the little office forever. And so far as young Craig was concerned, the last that was heard of him he was shucking oysters in a wholesale oyster house down along the Chesapeake Bay. *£• *&• CULTURE. G. F. POFFENBERGER, '11. |UCCESS to-day demands both natural ability and cul-ture. In the past, men have risen to the summit of human achievement through their natural ability alone. But the strenuous, vigorous and active life of the pres-ent requires every contestant in the race to be fully trained.Ig-norance in responsible positions is a thing of the past. Nature often endows a man with one talent which if developed, produces a man of genius, if neglected, degenerates him into an abnormal being. Upon one man may be bestowed strong intel-lectual abilities at the expense of his physical nature; to another may be given the vigor with small attention to intelligence; many in the present age are possessed of both qualities. To equalize the gifts of nature culture should be given the office of mediator and instructor. Culture to-day is within the grasp of everyone, whether he be of high or low birth. To all the schools of the country are open; to all the colleges and universities of the land offer their oppor-tunities. Nor is self-culture less practical; for its end is the same though its means are more severe and trying. The reading of choice literature and the associations with great works of art produce an effect upon the character to be marked as the test of the fully trained mind. Critical power in litera- THE MERCUEY. » ture is a degree of cultivation rarely attained, but when attained, it places its possessor in a position almost superhuman. The perception of beauty is another test of culture. Only a small part of this earth is given over to one's needs; the whole universe however, is within the hand of the fortunate one who perceives beauty in nature. Beauty is an all-pervading presence. It unfolds itself in the myriad blossoms of the springtime; it is beneath the dark shade of the summer trees; it haunts even the depths of the earth and sea. The uncultured man looks upon all these with a hardened heart. To the man of culture it is a reve-lation of the proper course of human action not only here, but even through eternity. The greatest attribute of culture is its power not only to in-duce impressions but to produce expressions. The cultured man is an artist. Expression may be made to the world through the medium of the brush, the pen, or a higher medium still, the hu-man voice. Speech is one of our greatest distinctions from the brute, and its highest cultivation marks the highest type of man. Our power over others depends less upon the amount of thought within us, than our power to bring it out. The ages of the world have been marked by the gradually widening breach between man and beast, the physical and the spiritual. The past is behind us, we must keep up with the pres-ent only. Future years will produce still greater changes, and through the influence of culture, mental and spiritual man will attain that perception which his Creator intended for him. NOBLE CHARACTER OUR NATIONAL SAFEGUARD. PAUL S. MILLER, '10. |HEN we speak of character and its influence it is neces-sary first that we know what is meant by character. By character is meant the composite of definite moral and personal traits which serves to distinguish an indi-vidual and to mark the type to which he belongs. Therefore, 10 THE MEKCUEY. noble character is that which, in the highest sense constitutes the man. It is very evident then, that the men who fill our executive chairs must possess noble characters in order that they may be true to themselves, true to the instincts which, with our race seem to go hand in hand with freedom,—love of order and respect for law. A man to possess a noble character need not be a great man as the world classes great men, but the man who has a true, noble character, who uses his gifts rightly and does his duty in whatever station of life he is situated. One of the most important factors to be considered in the de-velopment and acquisition of a noble character, by which the moral nature must be subjected and brought under control, is the will, by which the mental faculties are directed and energized. It is through a strong will that bad habits are overcome and habits of truthfulness, honesty and obedience are established in their stead. It is through a well controlled will that self-respect, self-control and strength of character is obtained. One of the greatest forces in the world is man; and one of the most determinate and irresistible forces in man is his will. When the will collects its forces and makes a final resolution to accomplish some act it is then that man has the power on the one hand to poison the very springs of national life or on the other to become in reality the agent of God. This nation of ours stands as it is to-day because of such reso-lutions as the latter being carried out by men of strong wills and noble characters. With such powerful forces as Washington and Lincoln to guide and urge us on, it is not only right, but it is the duty of every one of us to attain the highest possible standard of noble character. It is from the young men of to-day, those who are now in the course of their education, that our future governors, senators, statesmen and presidents must be chosen. We may assume, then, that if the seed of a noble character is sown in youth we may ex-pect the rising generation to enter this world prepared to fight the battles of life, and our higher offices filled by men who will strive for the betterment of themselves and their posterity and men who may be entrusted with the government of this grand and glorious nation. TUB MEKCURY. IT If the Englishman is proud of his country, scattered as it w all over the world, so that, as he boasts, "the beat of the morning, drum encircles the earth," if the Swiss peasant loves his moun-tain heights, if the Scotchman delights in his desolate moor, and the Irishman thinks his little island of poverty the dearest spot on earth; if even the despised Chinaman dreads to die outside of his native land, what should be the devotion of Americans to this the grandest land the sun has ever shown upon, a land where hu-man happiness is so widely disseminated, where human govern-ment is so little abused, so free from oppression, so invisible, in-tangible and yet so strong. The world is asking the young American to-day what may we' expect of you when you are called upon to take the place of re-sponsibility made vacant by the deaths of those who now occupy them. Are we going to disappoint the world and make a failure of our lives? Or will we meet the demand of the times and profit by the failures and successes of our predecessors. A nation must also possess a character if it would endure; and this is obtained only through the character of the individual. When national character ceases to be upheld, a nation may be regarded as next to lost. When such a state is reached that honor and obedience are seemingly lost, the only remedy is the restoration of individual character, and if this is irrecoverably lost, all is lost. Then let us, as a rising generation, be marked with that great feature of noble character, that moral worth and intelligence that we may have the power to erect a bulwark which shall prove im-pregnable in that hour of trial, when fleets and fortifications shall be vain. If, therefore, it is in our power to preserve this precious heri-tage, let us cling to it with a patriot's love, with a scholar's en-thusiasm, and with a Christian's hope and may this grand nation which is still part of the great universe be as an ornament of a' free people and continue to be free and which God may preserve-till time shall be no more. iETTYSBURG COLLEGE Gettysburg, Pa. LIBRARY 12 THE MEHCURY. IS THE GRANTING OF ATHLETIC SCHOLARSHIPS GOOD POLICY? PAUL M. MARSHALL, '10. HE problem of the athletic scholarship confronts every college or university of prominence to-day; in most cases it is not a question of dollars and cents but a ques-tion of principle and the future welfare of the college. Whether the moral and mental side of an institution is benefitted by the presence of men that an athletic scholarship has brought to its campus is probably debated in the faculty meetings of every school. The true and original purpose of such a scholarship was to help those students athletically inclined who were financially un-able to get through college; it was intended not for the lazy, happy-go-lucky athlete that is never a credit to any college but for the earnest student whose only hope of education lies in his athletics. Such men, working hard for an education, would probably be compelled to resort to summer ball or professional sport of some kind to carry on their college work and then if they attempted to engage in school athletics there would be the cry of "professional-ism" and "impure sports." This is the man to whom an athletic scholarship is a salvation, an inspiration that will goad him on in every line of work; the duty to his college comes first, and in after life any alumnus can point to him -with pride as a fellow-graduate. He is a credit to the institution he represents. But in these attempts to aid the worthy, the bounds have been over-stepped and the college has forgotten the kind of men the athletic scholarship was designed for; an insight into the man's character is overlooked, not a thought is given to his personality;: there is but one thought and that is the athletic ability of the applicant. Credentials of good character and moral worth are not asked for; all that is needed is a recommendation from some former team-mate or coach to insure the receipt of such a scholar-ship. This man, in his few years at college, whilst he may have been instrumental in a few victories, will probably have had a demoral- THE MEECUBY. 13 izing effect on the student body; the tendency to loaf is prevalent., for he is not interested in college work and the result is that in most cases he is classed as a special student. These specials are a drag to the institution and are seldom a credit to their Alma Mater. The man who does not have graduation in view will never take the interest in his work that should be characteristic of every college man. A college is known by its alumni. Are the men who were in college the beneficiaries of athletic scholarships, fit persons to in-fluence increased attendance and bring credit upon the college? The fact that athletic prominence brings success to an institution is undisputed, but the fact carries with it the provision that only men strong in every line of work shall be allowed to represent the college. On the whole the athletic scholarship discourages study and aptitude in any phase of work other than the athletic; is is mis-used and has become rather an easy way of spending four years than an encouragement to deserving students. To the poorly en-dowed small college that must strive in every way to exist where a few such loafers may have an infinite influence on the student body, the athletic scholarship is the cause of a lowering of every standard of the school's worth. In the university the plan may not reflect on the general student life, but no matter where or what may be the school concerned, the granting of athletic scholarships is indiscreet and not in harmony with the best poli-cies of the institution. A COMPLETED PLAN. TAXIS, '09. HE directors of The Slicem Packing Co. Limited had gathered together and had been discussing the rumors relative to the investigation of their business by the government deputies. The board room was filled with. the smoke from their cigars, and a hush pervaded the chamber. Each man was thinking deeply of the approaching storm. "WelL 14 THE MERCURY. fellows, this city is too hot for me, and I am going to take a trip abroad for my health," finally declared the youngest, and most promising director. "But, Des, that'll never do. You see that will put us in a poor light and we can't afford it," apologetically said one of the others. "Oh shucks Gordon! Poor light or not, I am going abroad. Now gentlemen, you have heard my de-cision. Do as you think best; I shall do as I have just said." So saying H. G. Desmond Vanderpew abruptly left the heated room and directed his steps to his palatial home in Madison Square. Here he made all preparations for his intended trip. Soon after Vanderpew's arrival a cab was seen to stop at his door. Vanderpew descended the wide, white, highly polished marble steps, entered the waiting vehicle and gave a last glance at his father's beautiful mansion, surrounded with artistically arranged flower beds. The carriage, after a half hour's time, finally stop-ped in front of the Past Line Steamship Co. Vanderpew step-ped out, paid the cabby and, handing his suit case to the porter, crossed the gang plank. Soon he felt the movement of the great ship and he began to breathe easier. During the entire trip he remained in his state-room, partly on account of illness, but more especially that he might not encounter any of the government officers who might have decided that they likewise needed recuperation. Vander-pew consulted maps and catalogues to occupy his time. He de-liberated as to the best course to pursue. At last he decided to go to a little town in Germany by the name of Stoburg. "Here," he reasoned with himself, "I can be incognitio, free from molesta-tion, and it will be the last place that those sleuths will stick their noses." Accordingly when the ship was docked at Queenstown, he sought the next departing vessel for the continent, where he boarded a train for Leipsic. When he ultimately reached the station, night had already settled over the quiet town and many of the inhabitants had already obtained a few hours' sleep. Hav-ing refused the assistance of a cabman, Vanderpew trudged along over a well paved street in search of a hotel. Finally, after a painfully long walk he located one and going to the assigned apartment retired, weary, yet with a mind free from fear of the tieputies. THE MEKCUBr. 15 When he awoke the next morning, the sun was high in the heavens. After his necessary toilet had been performed ,he de-scended to the large room, which was used as a bar room, dining room and general parlor. Here he met the fat, cheerful, rosy-cheeked proprietor, who inquired about his welfare. "Oh, I feel fine, and I shall take advantage of this fine weather, and go walk-ing." Vanderpew strolled slowly down the street, idly looking into the shops. At last he found himself at the end of the paved street and at the beginning of a road. "I guess I'll keep right on," he murmured. So saying he stooped, picked up a stone, ex-amined it curiously, then resumed his walk. Soon he was in the midst of one of those renowned forests of Germany. The trees stood in parallel rows. The underbrush so common to American forests had been cleared away and at intervals were benches for • the comfort of the passerby. At the beginning of the forest the State Forester was directing his busy assistants to mark this or that tree which he deemed ready for the ax. After watching the operation so new to him, Vandepew resumed his walk. Gradu-ally the place became forsaken. The sun heated the aisles be-tween the tall cedar trees, while the stirring breeze prevented the heat from becoming too intense. The trees shaded the edges of the paths and the birds filled the air with their songs. In a meditative mood Vandepew strolled on and on. Suddenly he espied a girl sitting on a bench directly to his right. Her tall figure, with its broad shoulders, plump arms and gibson waist betrayed an American lineage, as also did her almond eyes and high pompadour. "Gee! what a beaut!" he muttered, "wonder if there's any wrong in a casual acquaintance. I guess she's Dutch, but I'll be darned if she doesn't look like the best Ameri-can beauty I've ever seen. Well, here goes." In the meanwhile he had approached her. He stopped, summoned courage, and then blurted out, "Sprechen sie Deuteh?" The girl raised her eyes from her book in surprise and asked, "Pardon me, but did you speak to me ?" "Er-er ye-e-s, that is to sayy—yes!" "Are you acquainted here?" he continued meekly. "Just a little," she answered, "you see I am staying at the Hotel and am out for pastime." "How miraculous! I should say how delightful! I am also a guest at the same place. How would you like to 16 THE MERCURY. have a companion in the indulgence?" "Well, I suppose that since we are both Americans, it will not matter if we don't have a formal introduction, just this once. Do you think it will ?Oh, no," he quickly answered, sliding his arm around her slender waist, "of course not." We are co-admirers of nature." "Oh well," he continued, "I shall introduce myself and you can tell me who you are and we will be over Mrs. Grundy's objections. My name is Henry Griswald Desmond Vanclerpew of New York City, twenty-five years of age, secretary of The Slicem Packing Co., millionaire, a free and accepted Mason of the thirty-second degree, Knight Templar, a lover of sports and an admirer of Kipling, et cetera, and you? "Well, Desmond, it is strange you do not remember your old sweetheart, Inda Audrey Meredith, the possessor of nineteen American summers and two German winters, the maker of your twenty odd cushions, also your old yacht mate." "Audrey! How changed! Let's do now what we had plan-ned before your trip abroad. Will you dear?" Their lips met in common consent and silence prevailed. THE WORLD IS OVER-ORGANIZED. ROT V. DERR, '10. I HE inherent meaning of the word "organization," is al-most as old as Time itself. The principles of organiza-tion form the basis of society and government. When-ever a number of people desire to establish a principle, foster an idea or promote an interest, they must first organize. Thus a system of work is laid; disorder and inequality are pre-vented; concentration of effort, and harmony prevail. But the question that concerns us for the present is, whether or not the tendency is toward too much organization. Never in the history of the world has there been so much or-ganization. This is true in Church, in State, in Industry, but especially in social and fraternal life. To be convinced of the growing tendency toward organization, we need only to look at THE MEHODIty. 17 the Church. The average modern city organization counts its organizations by the dozen. There are societies for the old, the middle-aged, the 3'oung; for the men and for the women, old and young. There are missionary organizations, temperance, social, charitable and sometimes individual organizations. That the aims and purpose of all these organizations are praiseworthy and right, is not denied. But the question is whether there is too much organization for the moral and spiritual force necessary to keep it in smooth running order. Is the machinery becoming too huge and unwieldly ? Are we going too far ? It is evident that to carry out successfully these different or-ganizations, their plans and methods of work, each one must be regulated by its system of officers, meetings and routine of work. The regime of just one organization to be executed with any de-gree of success demands a considerable outlay of time, money and energy. How can so many survive? Some must suffer. This accounts for the failure of so many organizations. Not because the aim of the society may not be worthy nor its plans commen-dable, but the expenditure of time and talent necessary to insure its success, is too much, considering the other important and more necessary organizations to which one may belong. One cause of over-organization is the attempt to execute a prin-ciple or policy that is already being enforced, only in a more general way. To be more clear, the tendency is to counteract every particular evil, or to promote every particular virtue by a corresponding organization with its whole system of work. To attack the vice, profanity, the Anti-profanity League is organized. The smoking of cigarettes is assailed by the Anti-cigarette Asso-ciation. Organizations of this nature exist without number. Certainly some of them are absolutely necessary and constitute the best way to fight a foe or promulgate a principle. They are sometimes more effective than an organization having a broad, genial scope. An example of this type would be the Anti-Saloon League, now working wonders by its sane principles and com-mon sense methods. The scope and mission of these organiza-tions vary. Let us ask the question. Is an organization justi-fiable whose purpose and aims are already covered by another greater, more inclusive and comprehensive organization? For example, does the desecration of the American Sabbath demand is THE MEKCUBT. an organization whoso purposes shall be to mitigate its abuse or to give the laborer his rest, and so on, when the State or the Church should properly regulate these matters. This is not per-haps a good concrete example, but it will suffice to illustrate the point in question. It must not be understood that organization is not essential to moral and social reform. The Society for the Prevention of Cruelty to Animals has its place; the Civic Asso-ciation for Public Improvement is certainly a good thing; Purity organizations, Peace organizations and Charity organizations— all may be productive of immense good. But it is the sub-di-visions of these ideas and principles into so many corresponding small organizations that are hurtful. The trouble is not in or-ganization but in excessive organization. Another field in which too many organizations are undouhtedly "responsible for the destruction of the real usefulness of their gen-eral principles, is that of the fraternal secret orders. These, too, like the church and reform organizations have multiplied with great rapidity in recent years. The principles of these various orders are mostly of a patriotic, fraternal, or charitable nature; their emblems are such words as these: Virtue, Liberty, Pa-triotism, Mercy, Charity or Fraternity. One especial feature of the majority of such orders, is the sickness and death benefits. This feature really forms the basis for the large membership. With some exceptions of course, there can hardly be any seri-ous charge brought against the principles of these secret orders. Here, too, the harmful results ensue from the fact that there are too many being organized. They can not compete with the in-surance companies and the already existing secret orders of an established reputation. Frequently men unite with as many as six or more of these orders. These societies like all other orga-nizations must have their regular meetings, whether weekly or monthly, to maintain interest. Evidently faithfulness in dis-charging duties and pledges necessitates neglect of other import-ant business or home relations. As a result of this complexity many a one drops out. Consequently for lack of membership and financial strength, many organizations of this type "go un-der," in common parlance. Hence there is almost absolute loss of the money paid in. This condition needs no further comment. The multiplication of secret fraternal orders without a very ., THE MERCURY. 19 strong, practical, financial basis, is bound to demonstrate the evil effects of over-organization. Tliere is an economic aspect to this problem of organization. And the disastrous effects of over-organization frequently find their causes in economic conditions. The financial side is espe-cially referred to. The carrying out of the principles of an or-ganization incurs more or less expense, depending upon its na-ture. If it is an association for moral, social or civic reform, or if a fraternal order, it must have its official newspaper organ, its corps of workers and representatives in the field. The exten-siveness of the various systems and processes of work vary. In any case the financial funds must be raised to insure the welfare and safety of the organization. Very frequently many must suffer and finally fail through lack of monetary resources. The newspapers representing church denominational interests and moral reform are constantly making strenuous appeals for in-creased subscription lists in order to maintain their existence. The demands upon the average man's poeketbook made by the innumerable organizations are great. Only the most practical, beneficial and important organizations can survive. The others eke out a miserable existence and become a parasite on society. It is pitiable to see an organization launch out with seemingly bright prospects and worthy ideals, soon to be overwhelmned by the more solid, sturdy ones already in existence. Yet this oc-curs somewhere nearly every day. Another feature of nearly all organizations is to hold conven-tions, assemblies and so forth. These may occur annually, bien-nially or in a few cases less often. It may on the surface seem of little value to refer to this fact. But the increase of all sorts of organizations has occasioned so many such gatherings that the. people at large are coming to view them with dissatisfaetiou'- Pree entertainment at even church assemblies is no longer pos-sible at many places. The demands upon good nature and hos-pitality become too excessive. This is but one phase of the man • agement of the convention prohlem. Too much needless organi-zation with its array of conventions and external manifestations, will soon find a complaining public. As stated at the outset the whole world is full of organiza-tions. It is impossible to enter detailedly into all the different I GETTYSBURG COLLEGE 1 f Gettysburg, Pa. LIBRARY 20 THE MEECUBY. fields and discuss this problem of over-organization. Thus fir I have pointed out the tendencies along certain lines and shown the evils thereof. Perhaps in other lines of activity the danger of over-organization is not yet to be feared. The organization in political life certainly cannot be ques-tioned. The safety and welfare of a nation depends largely upon the interest of the people in the government. The sub-divisions of our own country into parts ranging from the grand federal to the county, district or municipal, form the basis for the people's share in government. Let us observe conditions among the industries and professions. Every branch of industry is thoroughly organized, and has its official organs, its conventions, its officers, routine of work, and so forth—all to advance their representative interests. These include all trades and business professions, which are numbered by the hundreds. It would be useless to enumerate them. It is only by the above methods that they can further their interests. The conditions and needs of the age demand such organizations. Take for example, the great agricultural industry: possibly no industry has ever made such strides. The methods of farming are assuming a scientific coloring, through Experimental Sta-tions, State Agricultural Schools, Farmers' Institutes and other organizations. As yet organization does not seem to be produc-ing harmful results along this line of industry. And perhaps the same thing could be said of the other indus+ries and occupa-tions. In like manner the educational and professional fields are im-proving their methods of work. Jfot thus to organize and mutur ally assist each other by new plans and good ideas, would be a cause of selfishness. Hence it is not difficult to undertsand why every week has its record of assemblies of educators, medical men, and the other professions. The tendency along the educational line may perhaps need restraint, lest too many chatauquas over-flow us with methods of work and instruction, and confuse our better judgment. A similar tendency within the past few years is the idea .of reunions. Every day in the summer season is scheduled for some sort of a reunion, varying in extent from a church denominational affair to a Sunday School picnic. Again, THE MERCURT 21 we repeat, the motive and aim are right. But are we carrying the idea too far? To summarize briefly the content of our discussion, we first note that the opposition is not against organization in itself. Over-organization tends to despise rather than marshal concen-tration of effort; it is impossible to devote the required amount of time and money to many organizations, though all may be more or less worthy. Too often over-organization becomes a matter of formal externality and lacks moral or spiritual earnestness. We need but cite the methods of modern evangelism to impress this fact. In conclusion it can be said that the formation of an or-ganization whose purpose shall be to prevent the formation of useless organizations, would be hailed as a great blessing to man-kind. WHAT IS SUCCESS. E. W. HARNER, '12. UCCESS, as generally defined, means the attainment of a proposed object. In this sense the man who makes it the object of his life to win a great fortune and does so, is successful, in that, he accomplishes what he has aimed for. This too, is the worldly conception of the subject. Hence, the man who starts in business, whatever his circumstances may be when he begins, and who, amasses a great fortune, is said to be successful. The politician who reaches out into-the political world and grasps the full glory of a politician, is said to be a successful man, in that he attains that which he has had in view. The young lawyer, who is admitted to the bar and performs his duties with great skill is looked upon by the world as being successful. But what is a successful life? It is not the amassing of wealth only, nor the attainment of high position, nor yet the win-ning of fame in one form or another. Life is made up of many-interests and the reaching of no one particular goal will neces-sarilv mean success. 22 THE MERCURY. "Wealth is not always a synonym of success." Many men whom the world delights to honor, attained their lofty heights of grandeur without ever acquiring anything of wealth. The truly successful are those who have achieved the greatest good in their respective callings, whether that success has brought them riches or not. Honor and fame are not requisites to success. Many men have reached positions of wealth, of high honor and fame, and yet their lives in the true sense have been failures. "Honor and Fame, from no conditions rise, Act well your part, there, all the honor lies." What, then, is true success ? No better answer could be given than that success is the faithful performance of all the duties of life that devolve upon us. God brings every human being into the world for a purpose, and he who comes the nearest to the ful-filment of that purpose is successful, whether he dies rich or poor, occupies a high or humble position, whether his name be known or unknown to the world. The successful are those who can surmount all difficulties, who can govern their own lives and Avho can say to the devil when tempted, "Get thee behind me Sa-tan." Men of great physical strength or those who are great in battle are not always successful, but those who are the architects of their own fortunes, and whose lives are full of kind deeds and noble acts. "It calls for something more than brawn, or muscle to overcome, An enemy that marches not with banner, plume or drum, A foe forever lurking nigh in silent, stealthy tread, Forever near thy board by day, at night thy bed. All honor, then, to that brave heart, though poor or rich he be, Who struggles with his baser part who conquers and is free. He may not wear a hero's crown nor fill a hero's grave, But truth will place his name among the bravest of the brave." THE MERCURY. 23 OUR SYMBOL—OUR IDEAL. RALPH E. RUDISILL, 'lO.* N all ages the achievements of man and his aspirations have been represented in symbols. Eaces have disap-peared and no record remains of their rise or fall, but by their symbols we know their history. The mono-liths of the Assyrians and the pyramids of the Egyptians tell their stories of forgotten civilization. They teach us sad lessons of the vanity of ambition; cruelty of arbitrary power, and the miseries of mankind. The Olympian Jupiter enthroned in the Parthenon expressed in ivory and gold the awful majesty of the Greek idea of the King of the Gods; the bronze statue of Minerva on the Acropolis was a magnificent symbol of the protection of the patron Goddess of Athens to the mariners who steer their ships by her helmet and spear. But these are all dwarfs in com-parison to our symbol. Greater than the monument in St. Paul's Cathedral commemorating the victories of Wellington upon land; greater than the monuments upon this very battlefield where lay buried the shackles of nearly four millions of men. Greater than these is our symbol—the fruit of political equality, of intelligence and virtue, of private sovereignty and public duty: it is the free, true, harmonious man of America. America. Ah! what a name! To-day we stand a nation that has uprooted slavery; a nation that has crushed anarchy; a nation that has overcome bankruptcy. How we rejoice in our principles of government! How they represent to the world the best results of liberty. De-mocracy is our nation's symbol. Manhood is the symbol of our people. Manhood is the Gibraltar of our Eepublic. Manhood, that which no ancient nation has ever fostered. Walk thoughtfully, kind friends, among the nations of to-day. You are tramping upon the fallen graves of centuries. Why have they gone? They died, not of old age but from the results of injustice and wrong. They died for want of manhood. Na-tional power is nothing. Universities are nothing. Colleges are nothing without manhood. Can America be added to this long list of republics. Can she thus betray herself ? Assuredly not. 'Winner of Junior Oratorical contest. 24 THE MEKCUBY. Search the creation round and where can you find a country that represents so sublime a view as America in equality. What noble institutions! What a comprehensive policy! What a wise equalization of every political advantage! ISTo fairer prospect of success could be presented. This is a land where competition is free. This is a republic which Mammon shall not rule. This is a nation where anarchy shall not sway. Equal rights and common opportunities have been the spurs of ambition and the motors of success. The American asks for a fair field and he becomes a Eoosevelt or a Lincoln. "Our only path is duty, our lamp is truth, our goal is victory." Who, then, are the truest Americans of our country to-day? Not the man who allows the glitter of gold to blind him; not the man who stands back and sees the liberty and happiness of thou-sands of women and children sacrificed upon the altars of Mam-mon, not he who corrupts the legislature. But he who has chosen a high ideal. Our country's appeal to-day goes forth to the humblest citizen. She has thrust upon everyone the most sacred privilege that she can give to man,—the privilege of sharing in the government and guarding her welfare. She asks of him in return to live a heroic life. No victory can be lasting, no reform can be permanent, unless the citizen back of it is just and virtu-ous. For the noblest ideal we look to Him above. He it was who taught this principle of equality. Was it not He who taught that man is worth more than money. Was it not this ideal that builded the foundations of free government as broad and as deep as this continent. Was it not this that stayed the tide on this heroic field. Such must be the active ideal of the American to-day. "Eight is right—since God is God, And right the day must win. To doubt would be disloyalty, To falter, would be sin." As Antaeus in battle renewed his strength whenever he touched his Mother Earth, so shall this Eepublic live, as long as its citi-zens follow and imitate the examples of our makers of the con-stitution and the Prince of Peace. THE MERCURY. 25 Assuredly we have reason to look into the future with hope. A hope not built upon the shadow of a glorious past, but rather upon the integrity of the average American citizen. A hope built upon the principles of equality and justice. May our citizens march clown the ages with the symbol of liberty and with the Bible for their guide in morals and conduct, let them as they lead the grand procession to that land beyond where shall be the union of all mankind, exclaim: "Forever float that standard sheet, Where breathes the foevbut falls before us, With freedom's soil beneath our feet And freedom's banner streaming o'er us." AN INDIAN SOLILOQUY. 1911. T was a beautiful night, such as is seldom seen, even in the warm summer months, in the valley of the majestic Susquehanna. The sun had set over an hour ago with a clear sky and the western horizon, formed by the dis-tant mountain tops, was still a shade brighter than the rest of the heavenly dome. Not a zephyr was stirring, not even on tha bosom of the broad river, whose surface was as calm and placid as a sea of glass. One by one the stars were beginning to peep from the heavens and smile upon the drowsy earth. Far away in the east, over the top of the mountain like a great silver ball sus-pended from the lofty home of the gods, hung the moon in all her beauty, shedding upon the earth a soft mellow light. To add to the beauty of the scene, far to the north could be heard the soft rippling of the stream, as it rushed between the rocks at the falls. The water-gods seemed to be doing their best to excel all na-ture, and to the ear of the silent listener, the noise of the waters bore something of the divine in nature. Such was the scene be- 26 THE MERCURY. fore Splashing Water as he lay upon the ground, before the old wigwam. Splashing Water was the son of the chief of the Wiconisco In-dians. Long ago his father's braves had intruded upon the hunt-ing grounds of the great Susquehannas, who claimed all the land bordering upon the great river which still bears their name. The Susquehannas resented the intrusion, but Splashing Water's father, after counselling with all his warriors, decided to make good his claim with the arrow and the tomahawk. Preparations for war were made and one dark night when all was ready, the Wiconisco braves stole forth from their camp to meet the Susque-hannas in deadly conflict. Early in the morning, long before the face of the Great Spirit began to light up the eastern sky, the battle was fought. The Wiconiscos were defeated. Twenty of their braves fell by the arrows of the enemy, but by far the great-est loss to the whole tribe was that of Splashing Water. Splash-ing Water, the pride of the camp, was captured and taken far away to the great camp of the Susquehannas on the Island of the Bald Eagle. That was many moons ago and tonight as he lay before the wigwam of his guard, he pictured to himself the sight of his father's camp. "It is true," thought he, "this camp is much bigger and this tribe is much stronger than my father's, and then too, they have the Great Eiver, but still I would rather be home on the great mountain." "What are they doing at home," he wondered, "perhaps they are planning how to come and free me from these awful men." He then pictured his father's camp. There were the wigwams of the braves arranged in order around the clear, cool spring and the great trees casting their soft shadows over the ground. There were the camp-fires, just dying out and around them lay the forms of many sleeping warriors. "How fine it would be to be there," thought he. Here he glanced around and noticed that the fires of his cap-tors were also dying out. Here and there among the wigwams the form of a dusky warrior moved about, but otherwise all was quiet, responding to the beautiful night the Great Spirit had given. "A little longer," thought Splashing Water," and they will all be asleep. Then why can't I escape?" He decided to THE MERCURY. 27 wait, for he saw that his guard, who was lying near him, was be-ginning to doze. In about an hour everything was quiet. Not a moving figure could be seen, and Splashing Water decided that now was the time to make a dash for home. Cautiously raising himself, he crept to the entrance of his guard's wigwam. All was still within. He crept a few steps farther and felt about for the bow and quiver of his guard. He grasped the bow in his hand and quietly hung the quiver over his shoulder. Peering out of the entrance, he made sure that the track was clear, then slowly crept forth in the direction of the shore, stopping every few paces, and straining every nerve to hear the faintest sound of alarm. But not a sound did he hear. Finally he arrived in the clump of willow trees overhang-ing the shore, under whose protection the bark canoes of his cap-tors were moored. Quietly creeping into the nearest one he grasped a pole and gently pushed it from the shore. When the boat was far enough from shore to be controlled by the current, he lay flat on the bottom of it and allowed it to drift down stream, in order that he might not make the least noise. When he had drifted for some time, he arose to his feet, grasped the pole and pushed the frail canoe to the shore with great speed. "Good-bye to the Island of the Bald Eagle," thought Splashing Water as he leaped upon the shore and plunged forward under cover of the thick forest. He traveled all night, and at the first signs of dawn drew near to the camp of his father. Great was the rejoicing as the fires of the tribe were kindled, amid the talk and laughter of the braves and squaws, when into the camp strode the athletic form of Splashing Water, the pride of the Wiconiscos. I H E HE RC U RV Entered at the Postoffice at Gettysburg as second-class Matter. VOL. XVII GETTYSBURG, PA., OCTOBER, 1909 No. 5 Editor in-Chief SAMUEL FAUSOLD, 'IO. Exchange Editor G. E. BOWERSOX, 'io Business Manager PAUL S. MILLER, 'IO Ass't Bus. Managers ROY R. ALLEN, 'II RUFUS N. WENRICK, 'II Assistant Editor RALPH E. RUDISILL, 'IO Associate Editors E. J. BOWMAN, 'II C. M. DAVIS, 'II Advisory Board PROF. G. F. SANDERS, A. M. PROF. P. M. BIKLE, PH. D. PROF. C. J. GRIMM, PH. D. Published each month, from October to June inclusive, by the joint literary Societies of Pennsylvania (Gettysburg) College. Subscription price, one dollar a year in advance ; single copies 15 cents. Notice to discontinue sending THE MERCURY to any address must be ac-companied by all arrearages. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE MERCURY, GETTYSBURG, PA. EDITORIALS. IN this, the first number of the MEBCUEY, since the opening of college, we take the opportunity of impressing upon the student body the importance of the liter-ary societies. The literary so-cieties hold out to every man at Gettysburg a golden opportunity for self-development. True it is, the class room is the place for in-tellectual training, but the liter-ary societies are a most useful adjunct for the training of a dif- THE MERCURY. ferent sort, though of no less importance, is here received. No col-lege man who cannot express his thoughts to the best possible advantage, measures up to the standard which the world sets up for him. To meet this demand for correct expression of thought is the purpose of the literary societies. For certain reasons, how-ever, during the past year, the college community has been very indifferent to literary work. The various phases of college life were emphasized to such a degree, that apparently the work of the societies was excluded and consequently literary spirit was very low. Now at the opening of the new collegiate year let us firmly resolve that this shall not be the case in the future. Let us go to work and strive to raise the standard up to its old mark. To the new men, we would say, join a literary society early in your course. We do not presume to dictate which society you should join. Each one of the societies needs you, and your so-ciety will be for you just what you help to make it. But what-ever else you do, join one of the literary societies. However, when you have joined, fall to work. No society will do you any good whatever, unless you work for it. Let us all, both old men and new, work for the glory of Phrena and Philo and strive to make this a banner year in literary work at Gettysburg. IT is a terrible thought that the "very glory of our civilization is the danger of our times." In the utilization of all the agencies of nature in every line of development, in the multiplication of the sources of wealth and prosperity, this country is unparalleled, and yet every element of progress carries with it the agencies of destruction. Along with the best of benefits march dangerous evils. For "vice and immorality sweep over this land like black clouds." Simply turn to the politicians of New York and we see them attacking the Governor, thus making it hard for young men to do right and easy for them to do wrong. After we have been launched into the world to win our way as best we can, the State takes no further action than to provide for a policeman to arrest us if we go astray. And then there is before us the saloon, pool-room and gambling den to invite us as participants. We have to but ask ourselves, how many men have fallen to such a degradation and answer by referring to Sing Sing where 30 THE MERCURY. seventy per cent, of the prisoners are college and university grad-uates. Why have such men of splendid opportunities fallen to such a state? We find it is because they have never endeavored to cultivate their morals or to strive for manliness. It seems to be the tendency of college men to be pusillanimous and discourage rather than encourage the aspirants to an exalted character, to taunt him with assertions hard for a sensitive boy to bear, as to his rusticity and state of being unsophisticated. How often does one learn too late that liberty with friends causes ruin, that in-dulgence is only to burst the restraints of the Ten Command-ments, the Golden Eule and the teachings of home. In this day of twentieth century hustle—in this CULTURE age Qj! fgygj-igh haste, culture has trouble to hold its own. Culture which means a liberal education, broad-minded-ness and refinement, is rivalled by our modern all-pervading lust for gold. Disregarding morality and final destin\r, what shall you do? Shall you spend your life in hot pursuit of the almighty dollar or seek those indefinable yet so easily recognized qualities, the sum total of which constitutes culture. This is the question so often confronting the young man just out of High School. He necessarily ponders, "Shall I take a purely technical course preparing me for one line of work or shall I take a general college course with the view of developing the all-around man. The temptation to follow the first alternative is hard to over-come. This fact is exemplified in men in the business world who are experts in their own departments of work, yet are lamentably ignorant as to all other subjects. These men do not have a true sense of values. They do not have the right perspective of life. They too often spend their whole lives in the pursuit of dollars for the dollar's sake and cannot enjoy what we call the higher things, because of lack of culture. As an illustration, these one-sided men can not enjoy music because they do not understand music. This fact fortifies the truism that a man gets out of a thing what he puts in it. TUP: MERCURY. 31 A man should be true to himself. If a man is true to himself, he will find time to develop his aesthetic and moral natures. Thus he can enjoy life in the full and besides the busy hours spent in attaining a livelihood can snatch a few moments from his busy life to enjoy nature and all her beauties. No matter what your profession will be, build upon the solid foundation of a collegiate course. This will insure knowledge, efficiency and cul-ture. DON'T forget the Bloomhardt literary prizes to be awarded next spring. These prizes will be awarded on the basis of literary merit. Get busy! Use your literary talent. Thus help your-self and immediately help us retain the high standard of the MERCURY. STUDENTS patronize our advertisers! The MERCURY adver-tisers are friends of the college and of you. Show your appre-ciation by helping them, even as they help us. A BOOK REVIEWS. HE Testing of Diana Mallory, by Mrs. Humphrey Ward. —Philo. Here is an interesting picture of English life. The authoress depicts the political and social life of England as few novelists can. We are led by easy stages to a realization of England's greatness as an empire and learn something of the domestic problems which concern her. To be sure, a love tale is the binding thread of the story. Diana Mallory is a true heroine. We love her from start to finish— sympathize with her in her troubles and rejoice with her in her joys. The other characters of the story are representative of every phase of English life. The Englishman in his favorite past-time—hunting—is seen hot on the chase and the parliamen-tarian playing with might and main the uncertain but always in- 32 THE MERCURY. teresting game of politics engages our rapt attention. Incident-ally we are given a picture of beautiful Italy and interesting glimpses of India and other parts of the world are obtained. The Diva's Ruby, by P. Marion Crawford. . Philo-—is a narra-tion of the winning of Diva, an English primadonna, by Win. Van Torp, an American cowboy millionaire. The scene is laid chiefly upon the continent and in London. However we are first introduced to a little Tartar city in Central Asia from which comes the ruby which gives the book its title. The book portrays the moving of that master passion, love, showing the terrible con-flict which takes place in the hearts of both men and women, the conflict between true love and the obligations of honor. The characters are of a high type except where the oriental thirst for revenge betrays itself in the person of Baraka. The plot is com-plex in that it centers about three characters instead of the or-dinary one or two. The style is clear but retarded by unimport-ant details. Moreover the language used by the various charac-ters is not altogether in harmony with themselves as the writer portrays them. We find very little difference between the con-versation of the learned Greek scholar, Logotheti, and the rough, uncultured American financier, Van Torp. All things consid-ered, it deserves to stand among the modern works of fiction. PATRONIZE OUR ADVERTISERS. I•N this Drama of Tour Year's Course, Play your part without dad's horse ; This to do is up to you With just a little tact between each yearly act, In some domain take a stroll And sell ALUMINUM for next year's Role (roll). Every summer hundreds of students raake BIG MONEY selling Aluminum Cooking Uteusils. For particulars address LOUIS HETZEL, Gettysburg College, GETTVSBURB, PA. THE STEWART & STEEN CO., COLLEGE ENGRAVERS, 1024 Arch Street, PHILADELPHIA. MAKERS OF INVITATIONS, PROGRAMS, MENUS, VISITING CARDS, DANCE CARDS, MONOGRAMS, CLASS AND FRATERNITY STATIONERY. P. S. MILLER, 'TO, Representative, Who has a full line of samples. kl^H, EDUCATION The times an 1 the Schools demand that the best things shall be done and in the best manner. Watermans@)FountamPen accomplishes everything that can be required of a good writing in-strument. Made to last for years of service and give its owner the satisfaction which comes with owning "the best." W From all dealers. The Globe trade-mark is our guarantee *~—^-^ school SI. Bo.lon 209 Sl.lc Si ChU."> Q V 742 Morkel Si-. San Franci*co. 1.10 5t. Jemci Si. Montreal 12 Cold«n L*n«. London GR. do Hono^-e Paris PATRONIZE OUR ADVERTISERS. FUfJJVTTU^E Mattresses, Bed Springs, Iron Beds, Picture Frames, Repair Work done promptly. Under-taking a specialty. - Telephone No. 97. H. B. BENDER. 37 Baltimore Street, Gettysburg, Pa EDGAR C. TAWNEY BAKER West Middle Street. J. B. WINEMAN, DEALER IN CHOICE FAMILY GROCERIES, PROVISIONS AND FRUITS, BOARDING CLUBS A SPECIALTY. L. WEIGAND, DEALER IN FRESH AND CURED MEATS OF ALL KINDS-Boarding Clubs a Specialty. Sou^p's f^estaupant, No. 7 Chambersburg Street. J PATRONIZE OUR ADVERTISERS. EMIL ZOTHE, College Emblems, Engraver, Designer and Manufacturing Jeweler, 722 Chestnut St, Philadelphia. Specialties: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, Stick Pins and Athletic Prizes. All Goods ordered through G. F. Kieffer. Charles S. Mumper, DEADER IN FURNITURE, PICTURE FRAMES OF ALL SORTS REPAIR WORK DONE PROMPTLY I will also BUY or EXCHANGE any SECOND-HAND FURNITURE No. 4 Chambersburg street, Gettysburg, Pa. OHLER BRO.'S RESTAURANT, First National Bank Bld'g. The place to eat the best Ice Cream. QUICK LUNCH and Oysters in season. D. J. Swartz, DEALER IN COUNTRY PRODUCE, GROCERIES, CIGARS AND TOBACCO. GETTYSBURG. J. i MUMPER Your Photographer, If not, why not? 41 Baltimore St., Gettysburg. FLEMMING X BAIR'S LIVERY, Baltimore Street, First Square, Gettysburg-, Pa. Competent Guides for all parts of the Battlefield. Arrange-ments by telegram or letter. Lock Bock 257. PATRONIZE OUR ADVERTISERS. WINDSOR HOTEL, W. T. BEDBAKEE, Manager. Midway between Broad St. Station and Beading Terminal on Filbert St. A convenient and homelike place to stay while in the city shopping. An excellent restaurant where good service combines with low prices. BOOMS $1.00 PEE DAY AND UP. The only moderate priced hotel of reputation and consequence in PHILADELPHIA. The Modern Steam Laundry . . OF YORK . . Offers the COLLEGE STUDENTS first-class work at Special Low Prices. E. C. STOUPFER, Local Agt. C. D. SMITH, Prop. The Baltimore Medical College Preliminary Fall Course begins September ist. Regular Winter Course begins September 20th. Liberal teaching facilities ; Modern college buildings ; Comfortable lecture hall and amphitheatres ; Large and complete equipped laboratories; Capacious hospital and dispensary; Lying-in department for teaching clinical obstetrics ; Large clinics. Send for catalogue. Address DAVID STREETT, M. D., Dean, N. E. Cor. Madison St., and Linden Ave., Baltimore, Md. COMPILER IMPRINT ON JOB WORK MEANS TASTY WORK CAREFULLY DONE. MENU CARDS WINDOW POSTERS LETTER HEADS ENVELOPES DANCE CARDS TICKETS Programs of all kinds. Everything the College Man wants in Paper and Ink. Specially designed work. Latest Effects in Paper, done in Colors along lines of College Men's Associations. Catalog and Book work. The Gettysbutg Compiler will keep old and new students in touch with town and college life.

THE GETTYSBURG MERCURY The Literary Journal of Pennsylvania College Entered at the Postofice at Gettysburg as second-class matter VOL. X GETTYSBURG, PA., OCTOBER, 1901 No. 5 TABLE OF CONTENTS Nature's Chain, . 137 The Survival of the Fittest, . . . .138 Man Was Not Made to Mourn, . . . 143 Some Important Deductions from a Comparative Study of My-thologies, . . . . . . 147 The Thunder Storm, . 1SS Editorial, . . 157 Resolutions of Respect, . . . . 158 Oration: The Character of Our Early American Forefathers, . 159 James Russell Eowell, . 165 Exchanges, . . . . . 170 NATURE'S CHAIN [From the "Essay on Man"] Look 'round our world; behold the chain of love Combining- all below and all above, See plastic nature working- to this end, The single atoms each to other tend, Attract, attracted to, the next in place, Formed and impelled its neighbor to embrace. See matter next, with various life endued, Press to one center still, the general good. See dying vegetables life sustain, See life dissolving, vegetate again; All forms that perish other forms supply (By turns we catch the vital breath, and die); Eike bubbles on the sea of matter borne, They rise, they break, and to that sea return. Nothing is foreign; parts relate to whole; One all-extending, all-preserving Soul Connects each being, greatest with the least; Made beast in aid of man, and man of beast; All served, all serving; nothing stands alone ; The chain holds on, and where it ends, unknown. —POPE. ^•jataut HHOMIHIHHBBHHHmBIBH 138 77/^ GETTYSBURG MERCURY THE SURVIVAL OF TME FITTEST D. C. BURNITE, '01 [dies Prize Essay—First Prize] "Ivives of great men all remind us We can make our lives sublime." —Longfellow. TV/fANKIND is like the face of a mountainous country. As we -*■'*■ view the human landscape, here and there, like peaks which rise above the plain and rear their snow-crowned heads among the clouds, appear, in bold contrast to the ordinary level of their fel-lows, the mighty men whose lives are the pages of history. And as we contemplate these epoch makers, there wells up in us, and quite naturally, too, a strong spirit of emulation. We admire them and would be like them. Of course, not every one of us can be a Napoleon, or a Wash-ington, or a Franklin, or a Grant; but each has abundant chances of becoming a less conspicuous, but yet quite prominent, feature in the plane of humanity. And it is the existence of such chances that prompts the youth of today to ask himself and others how best to pursue success. Geologists tell us that peaks owe their existence to their dur-able qualities. The surrounding material, by the action of aqueous erosion, has been carried away, leaving these tall projections which have been able to resist for ages the frictional action of water. Upon this same principle rests the success of the "makers of his-tory." Certain things in their make-up have enabled them to stand firm against the attrition of such circumstances as have swept their less sturdy fellows into the "realm of innocuous des-uetude." Their success is the result of the operation of the prin-ciple of the survival of the fittest. Ever since the world began, the principles and causes which have resulted in such changes as have been mentioned have al-ways been the same, and are the same, as those in operation to-day. And this is true of human affairs; so that the young man must realize that the same principles and causes which determined the success of great men, still operate. Ere he can resist the downward pressure of the busy, indifferent world about him, and, as Greely says, "bulge out over the top, where he is sure to be seen," it is necessary that he follows the same plan to secure suc-cess as that which has enabled others before him to become emi- THE GETTYSBURG MERCURY 139 nent. Just as they have survived innumerable discouragements and scaled the heights of fame because they have made themselves the fittest, so must the youth, in order to reach a high place, develop in himself those things which will render him, too, fit to combat opposing forces. And what are the elements of that fitness which has led to the success of men? Rvery person expects to be or do something, some day; that is, all have purposes. Yet most of these are more or less vague. But what we who would get on in the world must have, are defi-nite purposes. A race without a fixed goal is nothing. Without a definite end to strive for, life is a mere "struggle for existence," and existence is all we get. But life is more than this. The fu-ture holds out many prizes to each of us, to be won only by those who decide definitely for what prize they shall strive. The trav-eller must know, if not to what distance he desires to go, at least what is the bearing of the course he wants to pursue, or he may travel in a circle. If we want to move from our present positions, we must have purposes which, though they are not necessarily limited in extent, yet in direction must be definite. Napoleon, at the very outstart of his brilliant career, aimed at the rulership of the French nation. Lincoln had a definite intention, formed early in life, to do good to others. And how signally he suc-ceeded when he liberated those millions of sufferers! And to rise as these men did, we too must adopt this important element of their fitness,—a definiteness of purpose. Besides the fact that great men have had definite intentions, we observe that they all show elements of fitness in the characters they possessed. All the truly great—and we mean by truly great, not a Nero or Lord Byron, but those whom the good admire,— have been men of high morality. And the more elevated their moral traits, the more we admire them. High moral qualities are a part of the equipment which has bsought them, and will bring us, success. As a possessor of such characteristics, "Old Abe" stands pre-eminent,— a veritable personification of honesty; an honesty which did not allow him to support the unjust, though legal, side of a question; an honesty which made him lose in purse, but gain in esteem, till as a result of this quality he attained a world-wide re-spect, which will last as long as man and memory exist. Lincoln's is real fame, and the young man can do nothing better than adopt 140 THE GETTYSBURG MERCURY \ I in his character the prime element which brought renown to "Honest Old Abe." True courtesy is a moral quality, based upon thoughtfulness and consideration for others. Men must be gentlemen, if they want to make progress. Great men are not always polished models ot etiquette, but courtesy has always been a mark of their fitness to occupy the positions at which they have aimed. ' 'Jeffersonian simplicity" did not hinder the third President from reaching the place to which he was helped by Jeffersonian courtesy. Eet us avoid error, and imitate in ourselves this essential quality of fit-ness to advance. Impure and intemperate habits invariably destroy all chances of complete success. Neither Burns nor Poe have secured all the glory which steadier lives would have brought. Irregular habits undermine and weaken all the qualities of body, mind, and spirit, and under their influence complete triumph is impossible. Better adopt the kind of habits which rendered long and useful the lives of Greely, Bismarck, and Gladstone. Their temperate lives are models from which men may safely mould their conduct and there-by place themselves among the fittest to survive. Morality is admirable, but when heightened by the influence of Christian principles, it becomes sublime. Men like Luther and Washington, who have worked under the rule of Christianity, stand at the very summit of human esteem. Elijah Morse once said: "Young man, a good character; yes, and a clean, religious life, are the foundation stones for success." But the moral and religious traits we have spoken of are not all that bring success. It is true that they are the "foundation stones," but upon these there has always been built a structure of other materials, which have made their possessors able to sur-vive opposing forces. The extremely pious are not always re-membered, but those whomwe admire most and shall never for-get have linked their piety, as we should do, with other things essential to render them fittest to endure. L,et us speak also of these. Josh Billings says- "Energy is what wins. Many men fail to reach the mark because the powder in them is not proportional to the bullet." Men must have "vim," or they fail to remove what to them seem insurmountable obstacles. The Alps were no barrier to the vigor of Bonaparte. Neither must the young man THE GETTYSBURG MERCURY 141 of to-day lack this same sort of energy. It will enable him to sur-vive in the conflict with whatever comes between him and victory. The life of the man who would "fight it out on this line, if it takes all summer," testifies that the aspirant must try to imitate that in Grant which, in vulgar parlance, we call' 'sticktoitiveness.'' He must have a spirit of assiduity. Pluck cannot get along with-out Plod. Those who have become eminent have done so because they have hung to their purpose till triumph has crowned their persistence. Sir Isaac Newton, although met by what would seem to most men an impassable barrier, worked on for thirteen years before he was able to give the world the correct theory of gravity. The pursuit of success is up-hill work and a halt on the slope is fatal. Not one of the world's great men would have been able to survive the friction of ever-appearing hindrances, without this quality of persistency. Neither can any others who lack it hope to appear among the fittest. "Eternal vigilance is the price of success." It was on this principle that Mark Twain worked while becoming famous as a Mississippi River pilot, and later, while rising to his present lit-erary status. He himself testifies to the importance of this trait, when he gives this advice: "I say, young man, put all your eggs in one basket, and then watch that basket \" We must "Stop, look and listen !" for the multifarious dangers we are liable to en-counter. It was the "Father of the New York Tribune" who turned failure into success by following the principle he himself puts forth in these words: "Do the very best you can where you are!" Concentration and thoroughness have marked the lives of those we desire to emulate. We have all made a practice of doing one thing at a time, and doing that well. It was John Wanamaker who once wheeled the delivery barrow of a dry-goods firm through the streets of Philadelphia; and he did it well, too. Concentrated effort in one direction led him finally to make for us an excellent Post-Master-General. And we also can follow his plan and rise. Close attention to little things enabled Watt to notice and use the principle he saw in the movement of his mother's tea-kettle as the means whereby his steam-engine could be impelled. It is of little things the big are made. Nothing we see or experience is too small to receive attention. Andrew Carnegie knows all the details of his immense business,—none too small to be important \ i ■ I i 142 THE GETTYSBURG MERCURY to him. Nor must the youth who would succeed act differently from those whose fitness to rise included attention to little things. The best recommendation for the importance of a good educa-tion comes from those who have never had this advantage. Lin-coln's life-long regret was that he had not had a college education, and it limited his powers in many directions. However, self-taught men like he was have managed to climb the steep and reach the level of greatness without it. But just as one member of the body becomes stronger when its mate is injured, so such men, in the absence of higher education, have developed a substitute in the shape of great common sense. This we must have, or our fit-ness to survive the impositions of more shrewd men is impaired All these principles, and many, many others under which great men have worked, we must adopt if we want to aim at true great-ness. However, all cannot reach the topmost places. But an honest attempt to make the conditions in our lives conform to those manifested in the lives of successful men, will, at least, en-able us to rise far above mediocrity. Just as mountain peaks are formed of material most suitable to stand the wear and tear of ages, so must we young men be made of such stuff as will help us to throw off, without injury, those things which would keep us down, and rise till we attract the no-tice and elicit the worthy commendation of our fellows. Yet, let us not forget that the principle of the survival of the fittest extends farther than we have mentioned. For, away back, twenty centuries ago, there appeared a Great Man, a Model such as we find nowhere among the thousands of earthly great. He is the fittest and His survival is everlasting. Would we survive all the ills of this life, would we be classed among the truly fit, would we attain to higher praise than men can give,—heavenly praise ? Ifso, let us emulate him, the Model of all models, the Ideal! Then can we be like Him and join Him in the eternal survival of the fittest. "How void of reason are our hopes and fears 1 What in the conduct of our life appears So well designed, so luckily begun, But when we have our wish, we wish undone." DRYDHN. THE GETTYSBURG MERCURY 143 MAN WAS NOT MADE TO MOURN J. B. BAKER, '01 [Gies Prize Essay—Second Prize] OOBERT BURNS is the author of a varied and numerous array A * of beautiful poems. As a song writer he is the world's greatest. As rusticity's artist he ranks well with Shakespeare. His heart was great and his genius commensurate, winging its way to loftiest heights and recognizing the meanest things. He has been called the most directly inspired of all the poets. While the fame of other immortals rests upon the matured product of a life study, his finds its basis in the product of an hour. He goes out into the couutr)', disturbs a field mouse and ad-dresses it on the spot in quaint poetic style. A limping hare, a bank of flowers, a winding brook, a chilly blast, a neighbor's weal, a neighbor's woe, all appealed to his sensitive nature and won immediate response in verse. Such an one, however great he be, is in danger. Second thoughts, even in a Shakespeare, are preferable and it is neither a reflection upon the author nor a mark of conceit upon anyone to deferentially differ from him in a passing thought or hastily written verse. Burns said, "Man was made to Mourn.'.' The poem is sub-lime in its pathos but false, we believe, in sentiment. It shows the leaden sky but not the bow of promise. To study the end to which man was made we must ask time to turn backward in her flight for a moment or two and bring up the past. Oliver Wendell Holmes said we ought to begin a man's biog-raphy one hundred years before he is born. We would begin with generic man already when the idea of his creation was first formulated in the Divine Mind, for the idea of creation and the object of existence must have been coeval. They are concomitant notions and of a twin birth. What then was the mood of that pregnant mind at the event-ful date ? That question answered and our query is practically solved, for created things invariably bear the marks of their Creator. The readers of the world know the character and object of a literary production of a known author, before they open the book. They would not expect the sweet placid flow of an Irving from I I 144 THE GETTYSBURG MERCURY the rough and rugged Cooper. Nor would they hope to hear the strains of Whittier coming from Virgil's lyre. Neither could have produced the works of the other. Their gems, in prose and song, were merely the externalization of their own minds and they could not have written otherwise because they could not have externalized that which had not already had an anterior internal existence. Precisely so, in our crude, fragmentary, symbolic fashion must we conceive of the Alpha of all reality. We are wooed to believe that everything in this central universe bears marks of kinship with Him, and particularly do we believe it to be true of man. We are like Him. Is He glad or is He sad? Does He mourn? That is the question upon the solution of which depends the pur-posed end of man's existence. To attempt an answer to a question like that, however, involv-ing as it does, eons of time and a Being unfathomable, might ap-pear a bit presumptuous, but a little reflection will prove the con-trary. We cannot escape it. The question abides with us through every period of our rational life. It presses upon us as atmos-pheric air upon our frames. It fills the human mind as star dust fills the sky. We must think of God, but without attributes that is impossible. What then are the qualities discoverable in his na-ture to give us an antecedent probability that man was made to mourn? Those qualities discoverable by us and those recognized by ages before us are wisdom, power and goodness and these in an unlimited degree. The gradual unfolding of orderly arrangement, hitherto unknown, reveals the wisdom. The spangled robe of night reveals the power. While the goodness, as for it, it shines from His very nature as light from the noon-day sun. How One possessed at once of Omniscience, Omnipotence and Infinite Benevolence could ever be sad and in mourning is beyond the grasp of human reason. Mourning implies regret at something that has happened and surely nothing could grieve Him who had the ability and fore-sight to avert the offending cause. Mourning is incompatible with the idea of Divinity as held by the majority of men to-day. But some are disposed to call these qualities into question. Not a few thinkers of eminent ability and indubitable integrity find themselves unable to predicate them of Him. I | El l SOME IMPORTANT DEDUCTIONS FROM A COMPARATIVE STUDY OF MYTHOLOGIES C M. A. STINE, '01 [Gies Prize Essay—Third Prize] THE meaning of the word mythology is, literally, a treatise of *■ myths, or a writing composed of a number of fables. The term is applicable to the writings descriptive of ancient systems of religious beliefs, their various deities, and the attributes and the relations of these deities. Just as the child peoples the world about it with fairies both good and evil in their intentions toward human beings, so in a somewhat similar manner, the early races personified the phenom-ena of nature and sought to render intelligible the workings of nature thrust upon them for explanation, and which were to them otherwise inexplicable. Out of these explanations arose the vast bodies of legends descriptive of the various deities, their origin, adventures, attributes and relations. These personifications of nature with their body of attendant prerogatives arose from two principal causes: the necessity of pro-viding a cause for an observed effect, and the necessity of supply-ing a want felt in every human soul. Every human soul feels the need of a deity upon which to rest its faith and to whom it may look for aid. Whether the production is evolved by the human soul without a divine revelation does not concern us at present. To arrive at some explanation of the nature of the world, and the operation of those natural laws otherwise unintelligible, as well as of his own genesis, man invented the host of gods and demi-gods. The higher attributes ascribed to the divinities—their more purely spiritual qualities, arose out of man's need. Man is con- 148 THE GETTYSBURG MERCURY scious of those forces which we call good and evil. He realizes the constant antagonism between the two, and the ethical super-iority of the former. He feels that according to his sense of jus-tice good should be rewarded and evil punished; yet his experience teaches him that such is not always the case. Hence there arises a feeling of the need of some force which may be supernatural, and which will reconcile the apparent contradictions, and fill the hiatus which is felt to exist. Thus there is the necessity of a god and a future existence. The study of ancient mythology with a comparison of the dif-ferent systems, serves a number of purposes. We gain a knowl-edge of the varying degrees of complexity of the different systems of belief, the height of their spiritual conceptions, and their degree of knowledge of the true God—that is their relation to Monothe-ism, the resemblance of the different creeds in the attributes as-cribed to the different divinities, and the similarity in their names. First. We may judge of the character and location of the people—whether agricultural, pastoral, commercial, peaceful or warlike, inland or maritime; and as to the climatic conditions, and natural features of the territory occupied. Secondly. We may judge as to the degree of civilization at-tained. An enumeration of what is included in the term civil-ization may be in place. By civilization we mean the knowledge of the arts and sciences, mechanical and political; also the degree of purity of religious conception. Upon the true or erroneous ideas of God depends man's treatment of his fellow-man, his real-ization of the principles of universal brotherhood, and divine fatherhood, and all the altruistic impulses. There is certainly but little civilization where these latter are lacking, and upon the extent of the realization and adoption of these principles depends the greater or less degree of excellence to which a civilization may lay claim. Thirdly. A comparison of these systems affords a means whereby the knowledge of the common origin of various branches of the human family may be gained. In our consideration of ancient mythology, the chief form of belief to which we wish to devote our attention is that held by the Indo-Germanic family. The systems of mythology which we shall briefly study, are those of the Greeks, latins, Norse and THE GETTYSBURG MERCURY 149 Old Germans, Hindoos and Egyptians, as affording the best illus-tration of the principles enumerated. The system of mythology held and constructed by the Greeks is the one of which the most complete knowledge is attainable, excepting perhaps that of the Latins. But the resemblance be-tween these two is close, and the Greek may be taken as typical. Upon these, therefore, we shall base our conclusions. A study of Greek mythology reveals the following as to the character of the people, their location, and the climatic conditions of the territory occupied. The Greeks were an imaginative people, judging from the vast collection of myths relating to their deities, their doings among men. Every tree, blade of grass, fountain, streamlet and river; every breeze that blew and every raging storm, had its own particular presiding spirit. Gods, demigods, nymphs, satyrs, dryads and hamadryads are multiplied without number. The stories of the gods based upon nature, are given a vast body of detail, and an amount of local coloring which displays the workings of a national imagination of great activity and scope. The race seems also to have been somewhat mercurial in tem-perament. All of the earlier races are susceptible to changes in the seasons, and to the alternations of day and night, but the Greeks were particularly so. The approach of spring was heralded with the most extravagant rejoicings and sacrifices to various gods, especially to Dionysos. From the character of the deities worshiped they must have been a people engaged in pastoral, agricultural and commercial pursuits. We arrive at this conclusion because the people wor-shiped deities who were presumed to have the care of shepherds and their flocks, of farmers and their harvests, and of sailors. Some of the gods are themselves shepherds. Apollo is so repre-sented, although his flock is made up of the clouds in the fields of ether. Demeter is the goddess of the harvests. Hermes is the guardian of the sailor. The Greeks were extremely careful to preserve the favor of their gods, and maintained their sanctity to the last of their na-tional existence. They are extremely afraid of offending their deities, and must have been an exceedingly pious people. But all their piety did little for their morals. In all their business trans-actions we have evidence that they were a lying and a tricky I ; 'f. 150 THE GETTYSBURG MERCURY i people. Hermes, the god of liars, the protector of the knave, was greatly venerated. From what we have already said we would infer that the land of the Greeks was suitable for the pasturing of flocks and for the cultivation of the vine. Wewouldalso infer thatit was contiguous to the ocean. It must also have been alandsubject to the change of the seasons, for we have already seen that the festivals com-memorating the change of times and seasons, formed a part of his worship. That he made much of physical excellence is evident from the fact that he prayed often to a god whose chiefprerogativewasthe care of the athlete. Mythology and history are heartily agreed upon this point. He was evidently highly intellectual and capable of abstract thought; for he worshiped a goddess who was the personification of mind and intellectuality. Her attributes are those of mind and she is above the physical desires and passions that enslave. From this recounting of the physical enviroment and the in-tellectual attainment of the Greek we can readily determine the degree of civilization attained. We admit right here that myth-ology is not our only source of information, but we do maintain that we can determine the degree of civilization from the mythol-ogy of the people. Because the Greek engaged in commerce he came in contact with other nations, and thus acquired a knowledge of their arts and sciences. The Greek had his organized household, and was far in ad-vance of the wandering tribe; but not one of his deities is repre-sented as presiding over domestic life. The L,atins with their Lares and Penates, seem to come much nearer to the conception of our modern home. The number of muses presiding over the various forms of lit-erary composition, and the completeness of attributes, together with the veneration in which they were held, indicate literature to have been one of the chief pursuits of the people. The high degree of excellence attained in this respect confirms our position. The degree of his intellectuality is evinced in his conception of the goddess Athene. Then, too, if there had been no artists and sculptors there would have been no deities to inspire that class of men. The same may be said of government and the deities that preside over magistrates. ta THE GETTYSBURG MERCURY 151 The worship of a deity supposed to aid in the right government of a state, and to have the oversight of the fulfillment of the ends of justice presupposes a well organized system of government. All this is indicative of the degree of civilization of a people. But all these things are the mere externalities, the polish of civilization rather than the vital principle. Civilization of the heart, that is purity of life and worship, are the fundamental prin-ciples of civilization, and these are attained or not attained accord-ing to the character of the conception of the one true God. It is uncertain in how far the Greek attained to the idea of one God. Very high attributes and lofty conceptions were had by the Greeks, of divinity. This is plainly shown by attributes assigned to their different divinites. In a few cases Zeus is represented as exercis-ing a sort of supreme power over the other gods, which somewhat approaches the conception of the Bible of God and the angels as ministering spirits. As already stated, the Greek was pious in the extreme. His life was one of constant anxiety lest he offend, voluntary or involuntary, some one ofhis numerous deities. The names he applies to his deities are not those which would be ap-plied by a loving creature to a gracious Creator. In Aeschylus we find the words: "Zeus, wherever thou art, by whatever name it please thee to be named, I call on thee and pray." The Greeks made a constant effort to flatter and propitiate the gods, who were regarded as enemies of human happiness. Prob-ably the only god whom the Greeks truly loved was Dionysos. He was thought to rejoice in the happiness of men, and to his worship, in the festivals, the Greek surrendered himself with de-light. He was probably the only deity whom they worshipped from motives of affection rather than fear. Whilst many of the stories related of the various deities are incompatible with our conception of God; it must nevertheless be remembered that many of these stories are mere allegories created to typify and explain analogous happenings in nature. Thus they lose their revolting character. For a long time this was remem-bered by the worshipper himself, but it is feared that in later national history the Greek often gave himself up to excesses under the impression of divine sanction. Whilst many of the stories of the deities are revolting, many are very beautiful, and come close to the Christian conception of right conduct. Therefore there must i 152 THE GETTYSBURG MERCURY 1 i have existed a high ethical conception in the souls of many. But these conceptions are, after all, the exception and not the rule. The Greek's conception of life was largely fatalistic. Ananka, Necessity, loomed as a vast incontrovertible force from whose decrees there could be no escape. When a crime of any sort was committed the Erynys dogged the unhappy perpetrator with an awful insistence, and at some time, sooner or later, the crime was avenged. The conception of the hereafter as imagined by the Greek was gloom}' in the extreme. The spirit of the ordinary mortal passed at death to a domain of dimmest twilight, to the land of Hades. Here the shadow of the body lived an existence surrounded by in-tangible spectres, in the gloom of the mighty underworld. Only the souls of heroes and those semi-divine beings who were espe-cially, favored of the gods attained the happiness of the sunlit Elysian fields. The soul of the criminal passed to a region beneath Hades, to Tartaros, a place of torment and woe. The immortality of the soul held no joy to the mind of the Greek. His mythology gives us no reason to believe that he had the slightest conception of a hereafter portrayed in the bible. This affords us a complete understanding of the Greek mind. Polished in intellect, beautiful in body, in many ways possessing a refined nature, yet in this one essential the civilization of the Greek fell short. Self-sacrifice and unselfish devotion, whilst here and there in his mythology dimly hinted at, yet to the mass of the nation unknown, never animated the every-day life of the Greek. Thus in this cursory glance at the Greek nature we have pointed out the application of the first two principles enunciated at the beginning of this paper; but these same principles are equally well illustrated in the mythology of other peoples. Whilst our knowledge of the Norse and old German Mythol-ogies is much less complete, since the people were not literary, and preserved their traditions largely in memory and not in books, yet this mythology upon examination, is found to yield the same results as the Grecian. The conception of the god Odin for in-stance, shows the same conformity and coloring which that of the Greek Zeus exhibits. We cannot in this article enter into a de-tailed description of the mythology of the Latins, the Norse and old German, the Hindoo and the Egyptian, yet they all equally THE GETTYSBURG MERCURY 153 well serve to show the condition of the peoples who originated them. Let us now pass to the third fact, namely, that by a considera-tion of the mythologies of the peoples a knowledge of their common origin is obtained. No student of mythology will deny that in all the religious beliefs of the different nations there is a certain similarity. The Aztec system with the great god at the head and with its crowd of lesser deities, the North American Indians' conception of the Great Spirit with the host of lesser deities, in common with the nations of the Indo-Germanic family, had a degree of resemblance in the wider facts of their mythologies. The consideration of the conceptions of belief and worship of all the peoples and nations we have studied drives us to the conclusion that these peoples had a common origin. Let us glance at a few of the more marked resemblances which appear. Odin of the Norse, Zeus of the Greeks, Jupiter of the Latins, and Atmer of the Hin-doo- Brahmin systems are all alike personifications of the life-giv-ing properties of the air of heaven. The Egyptian system seems to be much farther advanced at the period with which our record begins, than the other systems enumerated. In fact it had reached a more metaphysical development. Consequently there is greater difficulty in the comparison of the Egyptian conception with the others, but in this system we notice the same overlapping of the attributes of one deity with those of another, and in some degree, an identity of attributes. Zeus is the father of the muses and Odin is the father of Saga, the goddess of poetry. Thor or Donar, another Norse divinity, is the god of thunder. As the god of thunder he resembles Zeus, and as the thunder bolts of Zeus were forged by the smith-god Hephaestus, who dwelt below ground, so the hammer of Thor was forged by the dwarves (Zwerge), or black elves who dwelt within the earth. Thor and Odin are identified with one another much the same as Vishnu and Indra in the Hindoo system. Thor and Vishnu go on foot to the councils of the gods. Vishnu is represented as traversing heaven in three strides. The Norse god, Tyr, is a personification of the brightness of the heavens. He is also named Zui and Saxuot. Here there appears a striking resemblance in names. Zui is iden-tical with the root meaning to shine. Sanscrit, Dyaus, the Greek Zeus, the Latin, Deus. Among the Vedic gods, Dyaus is the god of the shining heavens in the same way as Zeus of the Greeks. 154 THE GETTYSBURG MERCURY Dyaus-pater is the same as Jupiter, the dy being displaced by the J in the L,atin. Indra, of the Hindoos, who hurls the thunder-bolts, and is "the cloud compeller," corresponds in these func-tions with Zeus and Thor. His beard of lightning is the red beard of Thor. The goddess Ushas is the goddess of dawn among the Vedic deities. She corresponds to the Greek Eos. We notice the striking similarity between the two words, indicating deriva-tion from a common root. Thus we might go on multiplying in-stances and giving examples of this similarity. The attributes of the Egyptian deities are to a large extent interchangeable with those of the Greeks and the Norse. The Egyptian conceptions are arrived at by the same personifications of the powers of nature, and in their attributes represent the same mingling of the mater-ial with the spiritual, as do the Grecian, I,atin, Norse and Hindoo. They all represent the occurrences of nature under similar anal-ogies of deeds performed by the divinities. Their names have similar physical meanings. For in the resemblance thus illus-trated and existing to a much greater degree than we can stop to point out, we derived unquestionable proof of identity in the origin of these peoples. It is probable from the very close simil-arity of the I^atin and the Greek systems, that these two nations were less widely separated after the first division than were the other nations, or else that the separation of these two branches took place at some time after the original body had divided and migrated to different points of the compass. From this hasty glance at a few of the ancient systems ot mythology and a review of a number of their points ofresemblance, we obtain an idea of the vast importance which this study may assume. In conclusion we must remark what is palpable to every stu-dent of mythology, that the Christian religion could never have been evolved out of these systems. In its sweet simplicity, its purity and truth, it over-reaches all others in their utmost stretch. Of a truth there is no god but God, and no revelation but the bible. There is a majesty in simplicity which is far above the quaint-ness of wit.—Pope. THE GETTYSBURG MERCURY 155 THE THUNDER STORM C. W. WEISER, '01 [Gies Prize Essay—Honorable Mention] Upon a sultry August noon The scorching sun came beating down, And all was wrapt in smoky haze Swelt'ring 'neath the withering rays. Above the rugged mountain brink Arose a cloud as black as ink; Dark and motionless it loomed, As if the peak itself were doomed To bear the threat'ning, murky mass, Towering o'er the narrow pass. Then arose a sullen roar, A sudden rush and down it bore Along its path, As tho' in wrath It meant to take, To bend, or break; Destruction carry, Doom, or harry. Now on its course, In mutterings hoarse, It came with rumble Loud, and grumble. A peal, a mutter, A flash and flutter, And on it swept with dire confusion, And in its wake in swift profusion Came other clouds as swift, now dark, Then livid with old Vulcan's spark. Thro' the whirling and the roar Now the rain began to pour In torrents loud upon the roof, And the pine-tree tops aloof, Dashing 'gainst the shanty walls In a way that most appalls, Beating loudly oh the pane Were the dashing drops of rain. Flash of lightning Heavens bright'ning, Peals of thunder Fill with wonder. Crash ! we hear the loud report, Crash ! returns the dread retort. Heavens lighten, splinters flying 156 THE GETTYSBURG MERCURY From the mighty trees outlying ! Crash ! Flash ! Flash ! Crash I Rumble ! Roar! Crash ! Flash ! Hurling death and doom, destruction— Crash ! Flash ! in loud convulsion— Upon the forest, peaks disheveled, Rain-tossed, sighing, lowly leveled; Filling all with consternation At this freak of old creation. Flash !—growing dimmer its existence. Crash !—a pealing now in distance. Rumble, rumble, roar and rumble, Mutterings dull and muffled grumble; Rumble, rumble, rumble, roar, Down the dell, the mountains o'er. Gently now the rain is pattering, On the roof and windows clattering, While below the brook is gushing, Muddy wild and roaring, rushing. Clouds are flying, sky is clearing, The storm has passed, and sun appearing Smiles upon the world again Thro' the crystal drops of rain. i A populous solitude of bees and birds, And fairy-form'd and many colored things, Who worship him with notes more sweet than words, And innocently open their glad wings. Fearless and full of life, the gushing springs And fall of lofty fountains, and the bend Of stirring branches, and the bud which brings The swiftest thought of beauty, here extend, Mingling and made by love unto one mighty end. —BYRON. THE GETTYSBURG MERCURY Entered at the Postoffice at Gettysburg as second-class matter Voi,. X GETTYSBURG, PA., OCTOBER, 1901 No. 5 E. C. RUBY, '02, Editor-in- Chief R. ST. CLAIR POFFENBARGER,' 02, Business Manager J. F. NEWMAN, '02, Exchange Editor Assistant Editors Miss ANNIE M. SWARTZ, '02 A. B. RICHARD, '02 Advisory Board PROF. J. A. HIMES, A. M., LIT. D. PROF. G. D. STAHLEY, M. D. PROF. J. W. RICHARD, D. D. Assistant Business Manager CURTIS E. COOK, '03 Published eacli month, from October to June inclusive, by the joint literary societies of Pennsylvania (Gettysburg) College. Subscription price, One Dollar a year in advance; single copies Fifteen Cents. Notice to discontinue sending the MERCURY to any address must be accompanied by all arrearages. Students, Professors, and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE GETTYSBURG MERCURY, GETTYSBURG, PA. EDITORIAL '"pHIS issue of the MERCURY is made up largely of essaj's which *■ were in the Gies Prize Contest last year. Had it not been for this supply the editor might have had considerable difficulty in finding enough material for this number. We are looking for-ward to the future of our literary publication with a great deal of hope and firmly believe that our hope can be realized. We cer-tainly have among our fellow-students many who possess consid-erable literary talent, and others who desire the opportunity for development in the literary field. To such we would suggest that they should not neglect the opportunity which the MERCURY ex-tends to them. We shall be glad to have all who are interested in literary work place into our hands any manuscripts for publi-cation. We shall carefully examine them and always exercise 158 THE GETTYSBURG MERCURY I i our best judgment in the selections we make for presentation to the public. Fellow-students, it will depend largely upon the in-terest which you take in this work whether our hopes for the suc-cess of the MERCURY shall be realized or not. Let us not forget that this is a matter which pertains to the institution and not to any particular individual. By doing our duty towards this pub-lication we are making it a true index of the work that is being done in the literary departments ot our Alma Mater. RESOLUTIONS OP RESPECT CLASS VV7HEREAS, God in his divine wisdom has seen fit to sum- " mon from our midst to his eternal home one whom we most highly esteemed as a classmate and companion, Theodore Frank McAllister, Therefore, at a meeting of the class of '03, Pennsylvania Col-lege, September 7th, 1901, be it unanimously Resolved, That by this untimely visitation of Divine Providence we have lost one of the most worthy members of the class, one whose Christian character was such as to call forth universal ad-miration, whose amiable disposition gained the friendship of all whom he met, whose abilities as a student pointed to a most use-ful career; and also Resolved, That though we be saddened by this bereavement in the midst of our collegiate course, we humbly submit to the will of Him, who knoweth and doeth better than we, believing that our loss is his gain; and also Resolved, That by his death, by its great effect upon us, we have been led to a greater seriousness in the work of life; and also Resolved, That we extend to the family in its bereavement our sincere sympathy, and pray that God and Saviour, who has borne our griefs and carried our sorrows, to comfort them in their afflic-tion, and also Resolved, That a copy of these resolutions be sent to the sorrow-ing family, and to the college journals and town papers. DAVID S. WEIMER, ROSE E. PLANK, EDWARD B. HAY. THE GETTYSBURG MERCURY Y. M. C. A. 159 WHEREAS, it has pleased Almighty God in his all-wise provi-dence to remove from our association our friend and faithful co-worker, T. Frank McAllister, be it Resolved, That in his death the association has lost a member whose manly virtue and consistent Christian life were a help and inspiration to all, and be it Resolved, That the college has lost a faithful student and an en-thusiastic man in all college affairs, one who lived for the better-ment of his fellows and was happiest when promoting their wel-fare, and be it Resolved, That these resolutions be published in the town and college papers. WILBUR H. FLECK, FRANK DAYMAN, F. GARMAN MASTERS, Committee. nMHMWMHIWiill^HflUllil IHl|i|IMBillililll|H|IH 1v t jj 1 111 J GQgj ORATION: THE CHARACTER OP OUR EARLY AMERICAN FOREFATHERS P. H. R. MULLEN, '01 "PAR from me and my friends be such frigid philosophy as may ■*• conduct us indifferent, and unmoved, over any ground which has been dignified by wisdom, bravery or virtue. That man is little to be admired whose patriotism would not gain force on the plain of Marathon, or whose piety would not grow warmer among the ruins of Ionia." These noble words from the pen of Dr. Johnson express a sen-timent that ought to find a response in the heart of every Ameri-can citizen. We cannot visit the spots forever hallowed by the valorous deeds of enduring worth, wrought by the makers of our early history, without a sense of gratitude and profound reverence. To dwell upon such a theme without a thrill of emotion, would augur a spirit undeserving of the great legacy bequeathed to us by those venerable personages of the past. If the Greek could boast of an illustrious ancestry we can boast more; if the Roman could linger at the forum to hear the orators lavish their loftiest flights of eloquence upon the rising glory of the "eternal city," we may declare with great emphasis that its ■ 160 THE GETTYSBURG MERCURY splendor grows dim before the rising sun of our national glory, as the moon pales with the advancing day. No other nation has had such a beginning. The early history of every other great nation has a vague outline that marks its transition from lawlessness and barbarism to civilization, but America, comparatively speaking, sprung into being full grown, as "Athena from the brow of Zeus." We are alone among the nations of the earth in having such colossal founders. We need only mention the Pilgrim Fathers, and there is suggested a host of associations. At what a critical period in the world's history did they appear! They shattered the power of a dominant ecclesiasticism and gave to the world re-ligious freedom. We see them committing themselves in a frail bark to a "cruel, crawling sea," uncertain whether they should not all begin their long sleep, and fill a "wandering grave" beneath its restless bil-lows, before they should set foot on American soil. But, guided by their adored Jehovah, through the trackless waters, they at length disembark upon a rock on a desolate shore, and we hear their com-mingled prayers of gratitude break the monotonous voice of the sea. From this rock they go forth to sow the seeds of a mighty nation. We hear the blows of their axes against the primeval forest, ringing out on the frosty air like the pealing of liberty bells. In the light of their burning villages we see a band of savages danc-ing in taunting glee. With unabated zeal they resurrect another village from the ashes. From a miserly soil is forced, by untiring energy, a comfortable livelihood, and the "wilderness blossoms as the rose." A noted statesman has fittingly said: "We shall not stand unmoved on the shore of Plymouth while the sea con-tinues to wash it, nor will our brethren in future time forget the place of the nation's establishment till their river shall cease to flow by it. No vigor of youth, no maturity of age will lead the nation to forget the spots where its infancy was cradled and de-fended." The years of our nation's infancy were truly the most "sad and sublime'' in history. We have dwelt at some length upon the achievements of the Pilgrim Fathers because their deeds are the best interpreters of their character. It is a noteworthy fact, much to the credit of the Pilgrims, that they were the first colonists with sufficient "staying power" THE GETTYSBURG MERCURY 161 to establish a permanent colony in North America. Repeated efforts had been made in Mexico and in Florida, by the Spaniards, but those colonists had as often retreated in the face of unexpected difficulties, without accomplishing anything except the squander-ing of the resources of the borne government. France, likewise, had been unsuccessful for several reasons, chiefly because of the temper of her colonists. Several companies of English colonists also had attempted to take up land in the New World, but had repeatedly failed. It remained for the Pilgrims to be the honored founders of our great Republic, and their final success is fraught with great significance. They were constituted of ' 'sterner stuff'' than their predecessors and had an unchangeable purpose to prod their spirits in the presence of discouragement. To them physical pain was decidedly preferable to spiritual bondage, and they suffered on, unflinchingly, uncomplainingly, to the bitter end. "Religious Liberty" were the two words emblazoned upon the banner of the Pilgrims, and many times were those words des-tined to be written in blood before that banner was to be free from assault. They had, however, one harbor to which they repaired in every time of storm, one fortress in time of danger, one harbinger of hope in time of gloom, one source of truth amid the duplicity of oppressive and corrupt governors—the Bible, from which they received iron into their blood. This book was the Pilgrim's hope, his song, his prayer, his guide. The Old Testament, with its honor roll of immortal heroes, furnished the Pilgrims an ideal for their conduct in persecution and trial. The New Testament was the eternal pledge of final victory, an unfailing reward, an un-fading crown. The Puritans were characterized by a total lack of effeminacy. Their character was sturdy and masculine. No amusements were tolerated that had a tendency to destroy the severity and intensity of life. Severely religious, strict to a degree of intolerance, sternly resolute, stubbornly persistent, implicitly obedient to the dictates of conscience, the Puritans exhibit a massiveness and rugged grandeur of character that has never been surpassed. They were men of unblemished integrity, as distinguished for private pur-ity as for public virtue.'' We have never contemplated a group of men whose faults were so few, whose virtues so many, whose honor was so stainless, whose characters were so untarnished, as Stationery, Blank Books, Amateur Pho-tographic Supplies, Etc., Etc. BALTIMORE ST. R. fi. GULP PAPER HANGER, Second Square, York Street. COLLEGE EMBLEMS. EMIL ZOTHE, ENGRAVER. DESIGNER AND MANUFACTURING JEWELER. 19 S. NINTH ST. PHILADELPHIA SPECIALTIES: Masonic Marks, Society- Badges, College Buttons, Pins, Scarf Pins, Stick Pins and Athletic Prizes. All Goods ordered through A. N. Beau. A. G Miller Job Printer Students' Trade Solicited Best of Work Guaranteed Meneely Bell Co. TROY, N. Y. MANUFACTURERS OF SUPERIOR BELLS The 2000 pound bell now ringing-in the tower of Pennsylvania Col-lege was manufactured at this foundry. PATRONIZE OUR ADVERTISERS. The Pleased Customer Is not a stranger in our establish-ment— he's right at home, you'll see him -when you call. We have the materials to please fastidious men. Jf. D. LIPPY, Merchant Tailor 39 Chambersburg- St., Gettysburg, Pa. L Try My Choice Line of , High-Grade Chocolates ¥¥ at 40c per lb. Always fresh at CHAS. H. McCLEARY Carlisle St., Opposite W. M. R. R. ^ Also Foreign and Domestic Fruits p Always on Hand. L. D. Miller, GROCER Confectioner and Fruiterer. Ice Cream and Oysters in Season. 19 Main St. GETTYSBURG City Hotel Main St. Gettysburg. Free 'Bus to and from all Trains Thirty seconds' walk from either depot Dinner with drive over field with four or more, $1.35 Rates $1.50 to $2.00 per day John E. Hughes, Prop. Capitol Cits Cafe Cor. Fourth and Market Sts. HARRISBURG, PA. First-Class Rooms Furnished. Special Rates to Private Parties. Open Day and Nig-ht. European Plan. Lunch of All Kinds to Order at the Restaurant. ALDINQER'S CAPITOL CITY CAFE. POPULAR PRICES F. Mark Bream, Dealer in Fancy and Staple Groceries Telephone 29 Carlisle St., QETTYSBURQ, PA. .Photographer. No. 3 Main St., GETTYSBURG, PENNA. Our new effects in Portraiture are equal to photos made anywhere, and at any price. - J PATRONIZE OUR ADVERTISERS Manufacturers of High Grade Fraternity Emblems Fraternity Jewelry Fraternity Novelties Fraternity Stationery Fraternity Invitations Fraternity Announcements Fraternity Programs . Special Designs on Application. 140-142 Woodward Avenue DETROIT, MICH. Send for Catalogue and Price List MOTEL GETTYSBURG LIVERY GETTYSBURG, PA. LOING & HOLTZWORTM, Proprietors Apply at Office in the Motel for First-Class Guides and Teams THE BATTLEFIELD A SPECIALTY Qhe Bolton Market Square Ibarttsbura, ff>a. Large and Convenient Sample Rooms. Passenger and Baggage Elevator. Electric Cars to and from Depot. Electric Light and Steam Heat. J. M. & M. S. BUTTERWORTH, Proprietors Special Rates for Commer-cial Men "EZ 1ST IMMER CUT ET WAS ZU WISSEIN." These are the words of Goethe, the great German poet, and are as true in our day as when uttered. In these times of defective vision it is good to know something- about eyes. A great deal has been learned about the value of glasses and their application since Goethe lived. Spectacle wearers have increased by thousands, while at the same time, persons losing their eyesight have been greatly diminished. If your eyes trouble you in any way let me tell you the cause. Examination free and prices reasonable. We grind all our own lenses and fit the best lenses (no matter what anyone else has charged you) for $2.50 per pair and as cheap as SO cents per pair, or duplicate a broken lens if we have one-half or more of the old one, at a reasonable charge, returning same day received. .E. L. EGOLf. 807 and 809 INorth Third Street, MARRISBURG, PA. PATRONIZE OUR ADVERTISERS. II ^entpol }4otel, ELIAS FISSEL, Prop. (Formerly of Globe Hotel) Baltimore Street, Gettysburg, Pa. Two doors from Court House. MODERN IMPROVEMENTS. Steam Heat, Electric Light and Call Bells all through the House. Closets and Bath Rooms on Every Floor. Sefton & Flem-ming's Livery is connected with this Hotel. Good Teams and Competent Guides for the Battlefield. Charges Moderate, Satisfaction Guaranteed. Rates $1.50 Per Day. GET A SKATE ON And send all your Soiled Linen to the Gettysburg Steam Laundry R. R. LONG, Prop. Horace Partridge & Co., BOSTON, MASS. Fine Athletic Goods Headquarters for Foot Ball, Gym-nasium, Fencing and Track Supplies. Send for Illustrated Catalog-. 84 and 86 Franklin Street R.W. LENKER, Agent at Penna. College. JOHN M. MINNIGH, Confectionery, lee, .andlee Gream:o>^j Oysters Stewed and Fried. No. 17 BALTIMORE ST. The Leading Barber >Sf)op (Successor to C. C. Sefton) Having thoroughly remodeled the place is now ready to accommodate the public Barber Supplies a Specialty. .Baltimore Street. GETT*I5§IIIU}, PA. ESTABLISHED 1876 PENROSE MYERS, Watchmaker and Jeweler Gettysburg Souvenir Spoons, Col-lege Souvenir Spoons. NO. lO BALTIMORE ST., GETTYSBURG, PENNA. L. 1\. ALLEAVAH Manufacturers* Agent and Jobber of Hardware, Oils, Paints and Queensware. GETTYSBURG, PA. The Only Jobbing House in Adams County.

KEMAL'S INFIDELITY AND ITS INFLUENTIAL FACTOR IN ORHAN PAMUK'S THE MUSEUM OF INNOCENCE Ayu Setya Rahayu English Department, Language and Arts Faculty, State University of Surabaya cosmeticmiracle@yahoo.com Drs. Much. Khoiri M.Si. English Department, Language and Arts Faculty, State University of Surabaya much_choiri@yahoo.com Abstract Infidelity is defined as unfaithfulness of being unreliable or being attracted to someone other than one relationship partner. There are two types of infidelity, emotional and sexual infidelity. What constitutes an act of infidelity varies within cultures and depends on the type of relationship that exists between people.This study is aimed to present infidelity as experinced by Kemal as the main character in Orhan Pamuk's The Museum of Innocence, and to reveal the most influential factor of his infidelity.The study uses descriptive qualitative research with psychoanalitic approach. The object of the study is The Museum of Innocence by Orhan Pamuk, published in New York by vintage books in 2009. The data are in the form of quotation, fragments, and dialogues or monologues that indicated the thoughts and action concerning form of infidelity, and also its most influential factor. The data is analyzed by applying the theory of infidelity by Dirgosta and Barta, and also the most influential factor of it. This study also uses the theory of love and will by Rollo May to reveal his influential factor that lead to his infidelity based on the concept above and the quotation depicted in the novel.The result of this study shows thatKemal, the main character of this novel, commits both sexual and emotional infidelity. Initially, he becomes emotionally connected with someone outside of his relationship named Fusun. One way of looking at emotional infidelity is, that it is very dangerous, because it is not only takes away time and energy from his relationship, but it lead him to sexual infidelity and to the end of his engagement. Andthe main factors of Kemal's infidelity represented from this novel is he falls in love with someone else named Fusun. Actually, this novel is story of love of Kemal and Fusun, then his feeling of love that prompted him to take an action in certain direction which can realize his purpose of love. Because in love, there is definitely a will to unite with beloved people, then it gives rise a boost in his heart to betray his fiancee. Keywords: Infdelity, love, will, novel Abstrak Perselingkuhan didefinisikan sebagai ketidaksetiaan, diandalkan atau tertarik pada orang lain di luar dari pasangannya . Ada dua jenis perselingkuhan , perselingkuhan emosional dan seksual . Yang merupakan suatu tindakan perselingkuhan bervariasi dalam budaya dan tergantung pada jenis hubungan yang ada antara manusia. Penelitian ini bertujuan untuk menyajikan perselingkuhan yang di alami oleh Kemal sebagai sebagai tokoh utama dalam novel berjudul The Museum of Innocence karya Orhan Pamuk, dan untuk mengungkap faktor yang paling berpengaruh dalam perselingkuhannya.Penelitian ini menggunakan penelitian deskriptif kualitatif dengan pendekatan psikoanalisis . Objek penelitiaan ini adalah novel The Museum of Innocence karya Orhan Pamuk , yang diterbitkan di New York oleh vintage books tahun 2009 . Data tersebutdi peroleh dalam bentuk kutipan , fragmen , dan dialog atau monolog yang menunjukkan pemikiran dan tindakan mengenai bentuk perselingkuhan Kemal dan juga faktor yang paling berpengaruh. Data dianalisis dengan menerapkan teori perselingkuhan oleh Dirgosta dan Barta untuk mengungkapkan refleksi penggambaran perselingkuhan Kemal dan juga faktor yang paling berpengaruh. Penelitian ini juga menggunakan teori cinta dan keinginan oleh Rollo May untuk mengungkapkan faktor paling berpengaruh yang mengarah pada perselingkuhan yang didasarkan pada konsep di atas dan kutipan yang digambarkan dalam novel. Penelitian ini menunjukkan bahwa Kemal , tokoh utama dalam novel ini , melakukan perselingkuhan baik seksual mapun emosional . Awalnya , ia menjadi terhubung secara dengan seseorang di luar hubungannya, bernama Fusun . Salah satu cara untuk melihat perselingkuhan emosional adalah , bahwa sangat berbahaya , karena tidak hanya menghilangkan waktu dan energi dari hubungannya sebelumnya , namun membawanya ke perselingkuhan seksual, hingga merusak pertunangannya dengan Sibel. Dan faktor utama perselingkuhan oleh Kemal yang tergambar dalam novel ini adalah ia jatuh cinta dengan orang lain bernama Fusun . Sebenarnya , novel ini adalah kisah cinta Kemal dan Fusun , maka perasaannya cinta yang mendorongnya untuk mengambil tindakan dalam arah tertentu yang dapat mewujudkan tujuan cintanya . Karena di dalam cinta , pasti ada keinginan untuk bersatu dengan orang-orang yang di cintainya, kemudian memberikan dorongan dalam hatinya untuk mengkhianati tunangannya . Kata kunci: Infidelity, love, will, novel Introduction Within the context of intimate relationships, infidelity has been defined as a partner's violation of norms pertaining to the level of emotional or physical intimacy in which people engaged in outside the relationship (Drigotas & Barta, 2001:45). In the currentera,many strange phenomena appear and done by society. One of the interesting behavior in humansare donetoday is infidelity and that is very oftenaround environment. Not only household commit infidelity, but also in interpersonal relationship. The phenomenon of infidelity is dominant on the socioeconomic statu sof middle to top, especially in big cities. Moreover, the problem of infidelity is often atrigger forvarious cases of divorce or even murder. There are two kinds of infidelity that occurs in today's modern society, the emotional and sexual infidelity.Emotional infidelity in channeling emotional feeling for someone outside the relationship or marriage, whilesexual infidelity isi having sexual intercourse outside of relationship or marriage.The case of emotional infidelity begin when two beings of different sex, begin exchange of information, and the feelings that it was actually supposed to be feel just exclusive for partner. And started to be worse when there is no excitement and keep the distance with ypartner and began to yearn to talk to someone else, rather than the one romantic partners. The climax it will past the limit and begin to emerge the real problem in the relationship that shouldn't happen, that's secrets and lies. And when the lie begins,it will difficult to stop. Then, sexual infidelity is just waiting for the right moment. Talking about infidelity, nobody can remove it from the word "love", because if the lovethat isbuilt with the previous couple is strong and sturdy, then the affair could have been avoided. Love is a natural thingin human life. Love is a basic human emotion, but understanding how and why it happens is not necessarily easy. In fact, for a long time, many people suggested that love was simply something that they couldn't understand. Accoding to Erich Fromm, to love somebody is not just a strong feeling, but it is a decision, it is a judgement, and it is a promise,if love were only a feeling there would be no basis for the promise to love each other forever (McGee G. Mark, 1980:208).It means that if the love is just relying on feeling, without the underlying on bond and the sacred promise, as well as the commitment to be together forever, then that love won'tlast long. Psychologist Rollo May proposed that romantic love is made up of four elements: sex, eros, philia, and agape.In conclusion, adult personal relationships containing four forms of love, this relationship based on the sexual satisfaction, a desire for eternal unification and non egoistic concern for the welfare of others. But unfortunately, this kind of authentic love quite difficult to accomplish. At the same time, love hint of tenderness, passion, commitment, and devote themselves to the beloved personal interests, from there, love gives rise to will, the will is an impulse that comes from love, where lover have a will to unite with people they love (May, 1969: 146). In this case, if the love for partneris not strong enough to keep the relationship in order to survive and also the lack of commitment and promise, then sometime there will arise a feeling of love to others, and if the love is greater than the old partner, then the infidelity could happen. In literature like novel, many of whichraised issue of infidelity, where in novel, is related to the human's emotion and expression of feeling, Including ideas, motivation, and describe it by using language. Novel also has people or characters with their own personalities that can represent and act to carry issues that occur in the society. Morover, the dispositive of characters is described in outline only and the events described, contains a mental conflict, which resulted in a change of fortunes. A novel TheMuseum of Innocence by Orhan Pamuk has many sources in culture, love, social, combined into a variety of events and actions. The Museum of Innocence by Orhan Pamuk also depicts infidelity between a rich man and a poor shop girl, in the background of the Turkish city which at that time was experiencing modernization. These issues of infidelity in the background of love willbe discussed in more interesting and more complex from a variety of perspectives in one character. Orhan Pamuk was born in Istanbul in 1952 and grew up in a large family similar to those which he describes in his novelsCevdet Bey and His SonsandThe Black Book, in the wealthy westernised district of Nisantasi. As he writes in his autobiographical bookIstanbul, from his childhood until the age of 22 he devoted himself largely to painting and dreamed of becoming an artist. After graduating from the secular American Robert College in Istanbul, he studied architecture at Istanbul Technical University for three years, but abandoned the course when he gave up his ambition to become an architect and artist. He went on to graduate in journalism from Istanbul University, but never worked as a journalist. At the age of 23 Pamuk decided to become a novelist, and giving up everythingnelsenretreatednintonhisnflatnandnbeganntonwrite. His first novelCevdet Bey and His Sonswas published seven years later in 1982. The novel is the story of three generations of a wealthy Istanbul family living in Nisantasi, Pamuk's own home district. The novel was awarded both the Orhan Kemal and Milliyet literary prizes. The following year Pamuk published his novelThe Silent House, which in French translation won the 1991 Prix de la découverte européene.The White Castle(1985) about the frictions and friendship between a Venetian slave and an Ottoman scholar was published in English and many other languages from 1990 onwards, bringing Pamuk his first international fame. The same year Pamuk went to America, where he was a visiting scholar at Columbia University in New York from 1985 to 1988. It was there that he wrote most of his novelThe Black Book, in which the streets, past, chemistry and texture of Istanbul are described through the story of a lawyer seeking his missing wife. This novel was published in Turkey in 1990, and the French translation won the Prix France Culture.The Black Bookenlarged Pamuk's fame both in Turkey and internationally as an author at once popular and experimental, and able to write about past and present with the same intensity. In 1991 Pamuk's daughter Rüya was born. That year saw the production of a filmHidden Face, whose script by Pamuk was based on a one-page story inThe Black Book. His novelThe New Life, about young university students influenced by a mysterious book, was published in Turkey in 1994 and became one of the most widely read books in Turkish literature.My Name Is Red, about Ottoman and Persian artists and their ways of seeing and portraying the non-western world, told through a love story and family story, was published in 1998. This novel won the French Prix du meilleur livre étranger, the Italian Grinzane Cavour (2002) and the International IMPAC Dublin literary award (2003). From the mid-1990s Pamuk took a critical stance towards the Turkish state in articles about human rights and freedom of thought, although he took little interest in politics.Snow, which he describes as "my first and last political novel" was published in 2002. In this book set in the small city of Kars in northeastern Turkey he experimented with a new type of "political novel", telling the story of violence and tension between political Islamists, soldiers, secularists, and Kurdish and Turkish nationalists.Snowwas selected as one of the best 100 books of 2004 byThe New York Times. In 1999 a selection of his articles on literature and culture written for newspapers and magazines in Turkey and abroad, together with a selection of writings from his private notebooks, was published under the titleOther Colours. Pamuk's most recent book,Istanbul, is a poetical work that is hard to classify, combining the author's early memoirs up to the age of 22, and an essay about the city of Istanbul, illustrated with photographs from his own album, and pictures by western painters and Turkish photographers. Orhan Pamuk's books have been translated into 46 languages, including Georgian, Malayan, Czech, Danish, Japanese, Catalan, as well as English, German and French. Pamuk has been awarded The Peace Prize, considered the most prestigious award in Germany in the field of culture, in 2005. In the same year,Snowreceived the Le Prix Médicis étranger, the award for the best foreign novel in France. Again in 2005, Pamuk was honoured with the Richarda Huck Prize, awarded every three years since 1978 to personalities who "think independently and act bravely."In the same year, he was named among world's 100 intellectuals byProspectmagazine. In 2006,TIMEmagazine chose him as one of the 100 most influential persons of the world. In September 2006, he won the Le Prix Méditerranée étranger for his novelSnow.Pamuk is an honorary member of the American Academy of Arts and Letters, and holds an honorary doctorate from Tilburg University. He is an honorary member of the American Academy of Arts and Letters as well as the Chiese Academy for Social Sciences. Pamuk gives lectures once a year in Columbia University. Lastly, he received the 2006 Nobel Prize for Literature, becoming the second youngest person to receive the award in its history. Apart from three years in New York, Orhan Pamuk has spent all his life in the same streets and district of Istanbul, and he now lives in the building where he was raised. Pamuk has been writing novels for 30 yearsnandnneverndonenanynothernjobnexceptnwriting.(http://www.orhanpamuk.net/biography.aspx) The Museum of Innocenceis the latest Orhan Pamuk's novel, published on August, 2009.Pamuk has been working on the novel for many years and it has been hinted by himself in many interviews during this period. The story, which takes place in Istanbul between 1975 and today, is about obsessive love and the great questionof what is love. This colorful and fabulous novel will not only challenge the reader's thoughts about love, but also those about marriage, sex, passion, family, friendship, and happiness. The story begin with the apparent narrator named Kemal who is engaged to be married to Sibel. Kemal is a rich man when he by chance encounters a long-lost relation, Fusun, a young shopgirl whose beauty stirs all the passion denied him in a society where sex outside marriage is taboo. But Kemal, a young man with high passion has several times having sex with Sibel, and of course it is also more likely to do so with Fusun. Kemalwho really falls in love with Fusun,goes ahead anyway with his long-planned engagement to perfect partner Sibel, then Fusundisappears. Kemal finally breaks off with Sibel, finds Fusun, waits eight years for her to dump her husband (by going to her family's home some four times a week). In relationship, there will be many problems. The union of two different people, usually can cause contention and eventually lead to big problems. Feelings of love, affection, understanding, and accepting shortcomings of couple, is the very need in a relationship. Because according to psychologist Erich Fromm in his book The art of loving (2006:99) love is an essential of human need. That is, if theneed love is not fullfilled it will cause the problems.In this novel, Kemal who had been engaged to a woman with equal social class with him, women withwell education and from a wealthy family, it seems perfect to be his life partner. Kemal eventually leaveshis fiancée in order to pursue his dream to be unite with Fusun.The infidelity issues in the novel has the most significant cause,Kemal lack of affection to his fiancee, so that makes him fall in love with another woman. This novel begin at Istanbul in 1975. Kemal is a rich and engaged manBut when Kemal encounters Füsun, a poor beautiful shopgirl and a distant relation, he becomes enthralled. And once they violate the code of virginity, when sex before married considerd as taboo at that time.The firsttime hemetwithFusunwaswhenhe boughtjennycolon bag tohis fiancee, sibel, an upper-class beautiful girl. The city of Intanbul is captured by pamuk with a romantic touch, sturdy apartments of the rich man, once supported. The lovers met in Merhamet Apartments, in a flat abandoned by his mother. He dated his first secret meeting with Fusun to the spring of 1975. At that time, Pamuk initially planned Kemal to marry Sibel, a fashionable young woman with enlightened views of life, she goes without limits enlightened with Kemal. Love becomes the main motive, when someone can destroy virginity code. Fusun ends their relationship when she learns of Kemal's engagement with Sibel. But Kemal cannot forget her. It will take Kemal almost a year to find her again, a year of driving through every neighbourhood of the enormous city, months of heavy drinking in which he loses all interest in Sibel, even after they move in together. Sibel hopes to save him from what seems an inexplicable sadness, and learning the truth enrages her. To her, Füsun is just "a common shopgirl", a slut, even though they have each only slept with one man. Both sexual and emotional infidelity bound this novel. How kemal lie and keep his secret relationship to sibel, while he loves someone else and having sexual intercourse with Fusun. Psychologist Rollo May defines love into various types, such as sex, eros, philia, and agape. Sex is defined in category where someone loves another person just because of an underlying sexual appetite. Eros is defined as a lover which includes not only sexual intimacy, but also the feeling of love, attention, care so as to make the relationship last. Philia is defined as a sincere friendship, while gape is defined as selfless feeling or don't expecting reward (Jess Feist and Gregory J. Feist, 2009:58-59). In the case of Kemal in this novel, his love for Sibel does not meet all of four elements above, thus making their relationship is not too strong to survive. Then he finds Fusun, and feel the perfect love. In analyzing Kemal's infidelity and the most influential factor, it is used some related concept and one theory. In this thesis, the problem statement is divided into two. The first problem statement deals with how Kemal's infidelityreflected in this novel. While the second problem deals with the most influential factor of Kemal's infidelity. Those problems can be analysed by using the psychological approach as the base of the guide and theory. The first statement is how Kemal's infidelity reflected in The Museum of Innocence. This statement will use the concept of infidelity by American psycologyst, Dirgostra and Barta. This concept is united and merged with the bases of marital or extramarital relationship. There are two kinds of infidelity in this concept. The writer will analyses which kind of infidelity that Kemal uses through the quotations and monologues. Then the second statement is what is the most influential factor of Kemal's infidelity. This statement will also apply the concept of infidelity factor. Actually, the are a lot of infidelity factos, but the writer only use one factor that tha most represent based on quotation in this novel. The factor is love.So, ithe writer will use the theory of love and will that become the most influential factor of Kemal's infidelity. This concept is developed by existential psychologyst, Rollo May. It is about the unity between love and will, this circles of love and will is however affected to his infidelity. Methods Research methodolgy that used in this analysis here must be qualified as an applying in literary appreciation. The thesis is regarded as a descriptive-qualitative study and uses a library research.The data obtained to answer research question study. This study uses novel of Orhan Pamuk entitled The Museum of Innocence that published in 2009 as the data source of this study. The datas are in the form of direct and indirect speech of the characters, dialogues, epilogues and quotations which indicate and represent aspect of infidelity and love and will which is experienced by the main character. This thesis is using the library method in collecting the data. It does not use the statistic method. That is why it is not served in numbering or tables. Library research used an approach in analyzing this study. The kind of library research which is used here is intensive or closely reading to search quotations or phrases. It also used to analyze the literary elements both intrinsic and extrinsic. The references are taken from library and contributing ideas about this study from internet that support the idea of analyzing. Some steps of how the data is analyzed will be described as follows: Classification based on the statement of the problems. This classification is used to avoid the broad discussion. There are two classifications in this study. They are infidelity and The main factor that lead to his infidelity. Describing Kemal's infidelity which is stated from the quotations or statements by using theory of infidelity to be applied to the data. Describing the most influential factor of Kemal's infidelity which is stated from the quotations or statements by using theory of love and will to be applied to the data. RESULT How is the students' writing ability of SMP Muhammadiyah 5 in writing descriptive text after they being taugh by picture puzzle. Infidelity, is the main topic that will be analyzed. Many couples are under the misconception that infidelity only occurs when a man and a woman have sex together. Yet, there are other forms of infidelity such as emotional infidelity.Emotional infidelity may take on different forms, but in general it is the act of forming an emotional connection with someone outside of one's formal relationship. Kemal Brasmaci, the main character of the novel, born as a wealthy and well eucated instanbul family in Nisantasi. His fascinating live, ranging from being a socialite among A class people, and he prefers to live as a modern Turkish, in which at the time, Turkey was undergoing modernization with the influence of European culture. 30-year-old Kemal Basmaci, works as a bussinessman and lives in Merhamet Apartment which will be a silent witness to his secret love adventure with his distance relation, Fusun. Initially, Kemal is set to be engaged to a well educated and high socety girl named Sibel. Kemal first meetsFusun when he bought a Jenny Colon bag to Sibel in Sazalize boutique where Fusun works in. When he step up in Sazalize boutique, Kemal looks like very attentive to every detail in Fusun's clothes and shoes, her yellow skirt, her empty shoe over her long bare legs, her long till Dexterous fingers. Kemal begins to admire Fusun's beauty. Knowing that, because it was less than 10 years they had not met. There was a silence. I looked again into one of the pockets she had just pointed to inside the bag. Her beauty, or her skirt, which was in fact too short, or something else together, had unsettled me, and I couldn't act naturally. (Pamuk, 2009:6) Based on quotation above, Kemal gives the impression of a "darting" man by notices detail of what Fusun wear. Her skirts that look very short, her beauty, and anything else that can not be said. Actually, it does not really matter, but there is something rustled in Kemal's heart. It became the beginning of Kemal's interest feeling to Fusun. Moreover, Kemal also admittes that he can't act naturally when dealing with Fusun, he feels uneasy, but rather, look awkward in front of the opposite sex, there is definitely something special, something that raises passions and encouragement in his heart, even if it happens on the first time he meet. In this case, Kemal commits emotional infidelity by having eventual emotional connection, or a feeling of interest with someone other than one his romantic partner. Beside perform emotional infidelity, Kemal also perfor sexual infidelity has been defined as behaviour of a sexual nature carried out with someone other than one's primary partner.Usually, cheating involves people meeting face – to - face, and then engaging in physical intimacy. Beside having emotional infidelity with Fususn, he also comitted sexual infidelity, because the emotional affair can lead to phsycal affair. the intimate nature of the communication, plus the emotional investment made by the people involved, places an emotional infidelity become more intimate, and perform sexual intercourse, such as having sex kissing, touching, etc. The verry first page in this novel Tells about Kemal's happiest moment of his life. Having sexual intercourse with Fusun in his appartement. We felt the same coolness rising from the musty mattress on which we were making love, the way children play, happily forgetting everything else.(Pamuk, 2009:1) Based on quoatation above, it is clearly mentioned that Kemal comittes sexual infidelity by having sexual contact with Fusun, a woman other than his one romantic partner. In the firs page of this novel, Kemal explained clearly how and the steps of having sex with Fusun, and describes the atmosphere when they were in apartment when doing so. Because having sex is actually become a necessity. They look really enjoyed with the secret relationship, the way the kids played, happy to forget everything else seemed to describe what they both feel at that moment, as if they feel in pleasure without limits and make them forget themselves, forget about all the obstacles and problems that never happened, that there was only pleasure at that time. The second analysis is about The most influential factor of Kemal's infidelity. In this novel, Kemal Brasmaci a perfect gentleman, well educated, came from a wealthy, and respectable family in the city, is set to be married to perfect Sibel, who comes from an equal family as him. Many people assume if they are a perfect match. Kemal actually love Sibel, the woman who would soon be engaged to him. They both underwent a romantic date, having a harmonious family, came into exclusive places, even they both also have made love, although in that era, having sex outside of marriage is considered as taboo. Psychologist Rollo May argues that love is a pleasure, love is a pleasure to the presence of someone, as well as a confirmation of the value and development of the beloved person, just like themselves. Love is able to make a big motivation to someone, which raises the desire to realize the dream to be unite with someone they love. While Will of its own, generating an action to self directed, so that certain goals can be achieved. Kemal actually has already realized if what he has done is the most fatal mistake in his life, even he can not imagine how the devastation that can occur, as a result of these actions. But Still his love for Fusun become a big power that able to beat all obstacle. Kemal has been trying to forget Fusun, consider if he never loved Fusun. But, it can be covered by his feelings love that he could never lose, and always encouraged him to betray his old partner. Finally, Kemal continued to repeat the days of their togetherness, having sexual intercourse in his apartement. I am certain that the fire at the heart of my tale is the desire to relive those moment of love, and my attachment to those pleasure. For years, whenever I recalled those moments, seeking to understand the bond I still felt with her, images would from before my eyes, crowding out reason; for example, Fusun would be sitting on my lap, and I would have taken her large left breast into my moth. (Pamuk, 2009:53) From the quotation above, it is illustrated that Kemal feels her turmoil, that grows more fiery, he even wants to revive the her passion of making love with Fusun, because it is considered as a pleasure for him. Kemal is very attached, and no longer awkward in doing his pleasure in his secret relationship with Fusun. His tremendous sex desire to make love with Fusun, bring it into delusion when they're together. Kemal always be remembered while they are making love, for example when Fusun sits on his lap, and he holds the Fusun's left breast, then puts into his mouth. The thing that Kemal does based on description above is sexual infidelity, because he was having sex with a woman other than his partner. Kemal pleasure in making love with Fusun, is the Will of Kemal who loves Fusun. That is, the Kemal's impulse to commit sexual infidelity influenced by his love for Fusun. It was proved that Kemal has strong emotional ties to Fusun like people who really love his partner, even for many years, Kemal still remember the time they spent together, which can not be removed from his memory. Conclusions From overalls of this study, can be conclude that Kemal comitts infidelity, by having a relationship with Fusun, and violate her engagement to Sibel. In this novel, Kemal commits two types of infidelity, they are emotional and sexual infidelity. Kemal enjoying passionate sexual intercourse and perform a deep emotional attachment with Fusun. Kemal committs both infidelities at the same time. At first, Kemal perform emotional infidelity with Fusun, starting when he met with Fusun in Sanzalize boutique, where Fusun work, he began to admire Fusun, beauty, watching his every movement, pay attention to her clothes. From there, came a strange feeling inside Kemal's heart that he had not been aware of. But over time, that feeling grow stronger. Moreover, the two lovers are getting often met. Emotional Infidelity sounds fairly simple, but it is not as simple as that. Precisely emotional infidelity more dangerous than those who experienced only sexual infidelity. Because sometimes emotional infidelity could lead to a more intimate relationship, and over time will be difficultto integral, as experinced by kemal. As already described above, that emotional infidelity can lead to sexual infidelity, because the people who are already emotionally attached, will also certainly have the desire to have sexual intercourse.In this novel, Kemal also perform sexual activities that are engaged in with someone other than one 's partner. Activities that constitute sexual infidelity include all forms of physical intimacy, from kissing to sexual intercourse. Its pretty clearly described through the evidents in this novel, that Kemal and Fusun often make an appointment to meet at the apartment and Kemal to meet, it is like two people in a drunken romance.It has been shown clearly to the quotation analysis of the first statement problem that Kemal perform his first sexual infidelity, starting by giving a kiss, till make a love. Second conclusion is, actually there must bereasonsbehindKemal's infidelity. But themost crucial factor that is found based on the novel's quotation is his love for Fusun since the beginning of his meeting in a boutique. Initially, Kemal did not have any shortage in his relationship with Sibel, his fiancee.He admitts that he loves Sibel. Even though it is not described implicitlythe describtion of his love for Sibel, but it can be inferredeksplicitly that Kemal was not really love Sibel, it is proven when Kemal seems too easy to fall in love with someone else, and since then, his attention on sibel start to reduced, and even when his relationship with Fusun grows further, he decides to break his engagement with Sibel. People who really love their partner sincerely, certainly will not to do so. Love, which is built by Kemal and Fusun is very great anf strong, exceeding Kemal's love to Sibel, probably thi is because Kemal and Sibel's relationship came from matchmaking. Kemal who love Fusun, give birth to a Will for betraying his fiancee, Sibel. It means that the Will here, is an impulse to do something, without being influenced by the values of the good or bad.Those impulse can take him into a particular direction in which the desired goal can be realized. People who loves someone, like Kemal, definitely have a desire to be happy with Fusun, or want to united with her, So that it can give rise animpulse in his heart to betray his partner, so he could be much longer having relationship with Fusun, a person he love. Refference Drigotas, S.M., & Barta, W. 2001. The cheating heart:Scientific explorations of infidelity.New York: Guildford Press Feist, Jess and Feist, Gregory J. 2009.Teori Kepribadian:Theory of Personality. Terjemahan Sjahputri Smita Prahita. Jakarta:Salemba Humanika --- . 2009. Theories of Personality. Terjemahan Santoso Yudi. Jakarta:Pustaka Belajar Friedman S., Howard, Miriam W. Schustack.(2006). Kepribadian Teori Klasik dan Riset Modern. Jakarta:Erlangga Fromm, Erich, 2006. The Art of Loving.Seoul:Choun Publishing Co. Glass, S. P., & Wright, T. L. 2004. The relationship of extramarital sex, length of marriage,and sex differences on marital satisfaction and romanticism:Athanasiou's data reanalysed. Journal of Marriage and the Family May, R. 1967. Pshycology and the Human Dillema. Princeton, NJ:Van Nostrand McGee, Mark G. 1980. Introductory Psychology Reader. St. Paul: West Publishin CO. Pamuk, Orhan.2009. The Museum of Innocence. New York: Vintage Internet Source: http://www.orhanpamuk.net/biography.aspx

ORATORICAL NUMBER APRIL, 1901 CONTENTS April 35 The Significance of the Unin-tended 36 Our Democracy 41 The Dream of the Ages 43 The Man with the Hoe 47 War in the Light of the Twen-tieth Century SI International Arbitration to Sat-isfy National Honor 55 John Ruskin—The Man 58 Editorials 62 "The Reign of Law" 63 Exchanges 67 Advertisements 68 FAVOR THOSE WHO FAVOR US. For Fine- Printing go to Be X lo Wile Friipliil faff CARLISLE ST. GETTYSBURG, PA. C. B. Kitzmiller Dealer in Hats, Caps, Boots and Douglas Shoes GETTYSBURG, PA. R. M. Elliott Dealer in Hats, Caps, Shoes and. Gents' Furnishing Goods Corner Center Square and Carlisle Street GETTYSBURG, PA. EDGAR 5. MARTIN, ^CIGARS AND SMOKERS' ARTICLES ^p* ^y*j^ Chambersburz St., Gettysburg Leadership IN THE CLOTHING and MEN'S FURNISHING Business It is strictly here—everybody knows it. Testimony ? The stock itself. The pen suffi-ciently nimble to tell all the good points of our ::::::: FALL AMD WINTER. SUITS AND OVERCOATS has not been found. We will keep you dressed right up-to-date if you buy your Clothing and Furnishings here. : : : : STIINE McPherson Block- No. II BALTIMORE STREET WILLIAM H.HETF.ICK GETTYSBURG COLLEGE PA.UL K1ELFFER FRANKLIN &MARSHAL HOWARD E.SH1MER MUHLENBERG COLLEGE J . W. D OVNEY L E H1G H EDWARD E.KELLEY URSIWU5 THE GETTYSBURG MERCURY The Literary Journal of Pennsylvania College Entered at the Postojftce at Gettysburg as second-class matter VOL. X GETTYSBURG, PA., APRIL, 1901 No. 2 APRIL JOHN KEBLE Lessons sweet of spring returning, Welcome to the thoughtful heart! May I call ye sense or learning, Instinct pure, or heaven-taught art? Be your title what it may, Sweet and lengthening April day, While with you the soul is free, Ranging wild o'er hill and lee; Soft as Memnon's harp at morning, To the inward ear devout, Touched by light with heavenly warning, Your transporting chords ring out. Every leaf in every nook, Every wave in every brook, Chanting with a solemn voice Minds us of our better choice. Needs no show of mountain hoary, Winding shore or deepening glen, Where the landscape in its glory, Teaches truth to wandering men. Give true hearts but earth and sky, And some flowers to bloom and die, Homely scenes and simple views Lowly thoughts may best infuse. 36 THE GETTYSBURG MERCURY THE SIGNIFICANCE OF THE UNINTENDED PATTI. KIEFFER, of Franklin and Marshal [First Prize] '"PHERE is an Eastern fable of three princes contesting in arch- * ery for their father's kingdom. The youngest, regarded as a weakling, after an apparently poor effort, is unable to find his arrow. The elder brothers divide the kingdom, while he is left in ridicule to search for the lost missile. Hedoesso. Traveling many days in the direction of the shot, he comes upon his arrow imbedded in the door of a cavern, whither it has been wafted, mile after mile, by some unseen power. The door opens into the land of the genii, a realm of untold riches; and the youthful archer, now a mighty potentate, returns to receive adulation, where but a short time before he had met with but scorn and ridicule. The story of the princely archer is more than a fable; it is an allegory. The shot from his bow had an unintended and unex-pected result; a similar fate has attended men's efforts in all ages. For it is the universal experience that men aim at one thing and attain another. It has been always thus. Men work and labor and toil, and when it is all over and the work is done, behold, the result is other than that of the original intent. Men build better than they know. So true is this that there would seem to be a law by virtue of which it is characteristic of most of the great and genuine and lasting achievements of man, that they come in an unwonted, unintended and unexpected manner. Great is that which man has sought for and achieved; greater still is that which he has not sought for and has yet achieved. Great is the logic of man; the logic of events is greater. Indirection and unconscious-ness— these have attended the fruitful workings of human handi-craft, of human agency, and of human genius. The great discoveries—how have they come? In their blind-ness, men sought to read their fortunes in the stars, and out of astrology grew the noble science of astronomy. In the black kitchens men spend their lives in the search for the elixir of life, and out of alchemy, chemistry is born. The fall of an apple and the discovery of a universal law are inseparably linked. In the cathedral at Pisa a verger oils a lamp and leaves it swinging to and fro; a youth of eighteen sees it, ponders, and conceives the idea of measuring time. Indirection is the law. Men puzzle them- THE GETTYSBURG MERCURY 37 selves with problems for years; and then, suddenly, and in some unexpected manner the truth is imparted to some genius and the world moves on a step. New and untried ventures bring strange results. Columbus is sure that he is discovering a new route to the East; the floating seaweed that quells the mutiny on board his ships belongs to a new continent whose discovery renders his name immortal. To-day, four hundred years later, the powerful young nation which has grown up upon this continent has reached the Pacific and is look-ing beyond, and men stand with bated breath as they see her reach-ing across the great ocean to the East. The dream of the Genoese adventurer, after four centuries is about to receive some semblance of fulfillment in a manner of which he little dreamed. A protest against the sale of indulgences is a trifling matter; not so insignifi-cant is the splitting of the Roman Catholic Church and the de-stroying of the Papal supremacy. The little Mayflower bears a small band of men and women seeking religious freedom. After several centuries we look back to the spot upon which they landed, little dreaming of their mission, to see diverging therefrom the rays of light which have illuminated our nation ever since. That was Puritan light that made clear the pathway to Bunker Hill, to Yorktown, and to Appomattox. The colonies are now full grown and the mother country be-comes tyrannical. An unjust stamp tax is imposed and the colo-nists resist. The Boston Tea Party registers opposition to taxation without representation. But the colonists are still loyal. '' From one end of the colonies to the other," says Franklin, "no one is thinking of independence." Then, like a thunderbolt in a clear sky, a bold spirit, raised to a higher plane than his fellows, and catching the first glimpse of a new dawn, cries, "Give me liberty, or give me death!'' The cry of treason is the reply; but the events of a few swift years prove that he has caught a true vision. Resist-ance to a petty stamp tax inspired a revolution, threw off a yoke of oppression, and laid the foundation for the freest, most enlight-ened, most powerful republic in history—while men wondered. The world's battles in all times have been fought out upon forlorn hopes. Gideon sat by the wine-press when he received the call to arms. His three hundred put to flight the hosts of the Midianites. Wilberforce in England and Garrison in America go forth, like Hercules of old, to battle with the hydra-headed slave 33 THE GETTYSBURG MERCURY interests. In both continents it is one against a thousand. The one wins and both continents are freed. The world's schools present a strange picture. England's greatest preacher was an uneducated school usher. The temper-ance lecturer is picked out of the gutter. Buu3'an was an infidel. Lincoln was born in a slave state. Paul sat at the feet of Gama-liel. Moses was brought up in Egypt. The poet, the artist—he, too, knows the significance of the unintended. He calls it inspiration. Not a substitute for toil, for years of labor; but the final result comes not in the direct line of work. The painter in his studio sees his work fruitless for years; he is almost in despair; and then one night, as he is taking a moment's rest, in God's great out-of-doors perhaps, his reward comes. Gaspar Becana sits idle by the hearth when the long-awaited message, denied him at his work, is revealed to him in the flame. Years of toil, of unremitting labor; but at the supreme moment, no effort. Small wonder that Schiller exclaimed; "Since creation began All that mortals have wrought All that's God-like in man Comes—the flash of a thought." A scene from our nation's history. Thirty years of growing bitterness have kindled the flame of national discord, and the fiery characters proclaim that slavery is a crime. But at this moment the black slave is forgotten. It is a Federal fort off the southern coast, and it has been fired upon; the national troops have been attacked; states withdraw from the Union; brother takes arms against brother in the horrors of an internecine con-flict. Anti-slavery is swallowed up in a war for the preservation of the Union. Two short, swift years of war, and the voice of the commander-in-chief is heard throughout the land. The words he speaks are those of the Emancipation Proclamation. The slave is free, and that is accomplished by two years of war for another purpose in which thirty years of direct opposition failed. But there is no standing still. History is making. It is thirty years later and another crisis is reached. An oppressed people has lifted its appeal to the great American heart, whose pulsations, imperceptible at times, are none the less sure and true. The world's eyes are directed to Cuba, to the unprecedented ?pec-tacle of a great power wielding the sword in a war for the sake of THE GETTYSBURG MERCURY 39 humanity. But while the battle is on, what means this other sound, this note ol war from far across the sea? What mean these guns and sound of falling masonry? Has the electric impulse reached from Cuba half-way around the world? Yes. The American flag floats over Manila and the Philippines are ours. "But hold," the people cry, "tofree Cuba is our onhy aim. What have we to do with those far-off islands and a foreign race. New possessions are not part of our intent." Intent? If history can teach; if the experience of the past can furnish lessons for the present and future, this is the very seal and sign and token of the genuineness of your new duty that it was unintended. Then a voice cries, "So be it, America has burst her bonds!" "Imperi-alism!" is the reply and a new conflict is on. The final arbiter, the sovereign will of the people, must decide. But who can doubt the result? Stop our country's growth? Put an end to the national life? The ballot is cast; the people have echoed "So be it," and the seal of ratification is placed upon another great move-ment whose inception was unwitnessed by human eyes. Then, above the conflict of party and the war of words, one can all but hear the genius of the nation: "Here, O America, is thy duty. Whether thou wilt or no, here is thy mission. Thy path is clear. Here or nowhere is thy destiny, work it out therefrom, to the ends of liberty and humanity, of justice and order and peace." And what is the meaning of it all? Is man a creature of blind chance, his fate determined by every gust of wind that blows? Is history wrought out by luck? Are we to doubt the poet, doubt that "through the ages one increasing purpose runs?" Are man's work, his years of toil, his planning, his foresight, his God-given gift of reason—are all these to go for naught? The on-ward march of civilization answers No. The uplifting and better-ing of humanity answer No. The assent of man answers No. The unintended—unintended by whom? Who intended that the sun should shine by day and the moon by night? Who intended that the earth should yield up her fruits and the rain descend from Heaven? While man proposes, God disposes. Eeason,plan, method, purpose,—all these, could man, blind man, but see them. Yes, "there's a divinity that shapes our ends, rough-hew them how we will." It is a dark night at a time of crisis in our nation's history. The 40 THE GETTYSBURG MERCURY great captain lies dead at Washington by the hand of the assassin. In the great city of the commonwealth a mob is gathering and its mutterings are terrible in their foreboding. Old wounds gape afresh. The suspense is awful; what the morning will bring no one can tell. Suddenly, above the uproar of the crowd, like the clear note of a trumpet, a voice is heard. It is the voice of a man of the people. The words he speaks are few and simple: "God reigns!" Like the calming of a great storm upon the waters, the crowd disperses and the dawn ushers in a day of peace. May the echo of those words be endless in our country's career! God grant that down her path in times of peaceful well-being, in times of storm and stress, the words of her inspired patriot may ring in the ears of all her sons, "God reigns!" Yes, at her birth-throes He was with her; in the trying times of her infancy and youth He guided her; in her maturity he has blest her. And now, in the full plenitude of her powers, He has sent her a new mission. May He give her strength to fulfill it. May He give her people wis-dom and make her leaders to see the right path: And then, as we turn our eyes towards the future, with senses sharpened by patriotic fervor, we may catch the first glimpse of her shining forth supreme in that glorious company of nations when right shall have become might and the sense of human brotherhood filled all men's souls; and as we strain our ears to listen we may hear, mingled with the triumphal music of might and power, and rising far above it, the clear, pure note of a simple entreaty, the voice of the people lifted on high with that of the poet, to the ' 'God of our fathers, known of old Lord of our far-flung- battle line, Beneath whose awful hand we hold Dominion over palm and pine, Lord God of Hosts be with us yet Lest we forget! Lest we forget!" «9£, "While words of learned length and thundering sound Amazed the gazing rustics round; And still they gazed and still the wonder grew That one small head should carry all he knew." —GOLDSMITH. THE GETTYSBURG MERCURY 41 OUR DEMOCRACY WM. H. HETEICK, of Gettysburg [Second Prize] YV7E feel honored, as a people, in that good favor and for- " tune which makes us citizens of the American republic. We exult in the privileges which that citizenship affords. We rejoice in the liberty that gives us equal chances with all for the highest and noblest attainments in life. In short, we would be none but Americans. Were we Germans, we might challenge the world for a refor-mation. Were we Frenchmen, we might extol with pride the merits of an eventful revolution. Or, were we Englishmen, we might look with pleasure on a long line of illustrious rulers, or boast of universal dominion over the seas, or of lands on whose soil the sun never goes down. But we are Americans. We hold up but a century and a quarter of history, but where is its equal? Our part in the world movement was the founding of the people. To found the people. What an aim! To vindicate their honor! To make them free! Ours was the revolution on whose fate hung the human race. It was a conflict between man and king—a people in battle against the tyranny of the whole past. Here was born civil liberty that lifts the yoke of oppression from a subju-gated world. Ah! Here on our own battle-field was struck the blow that annihilated slavery, which for fifty centuries darkened civilization with inhuman crime. Our boast is not of territory. The sun sets every evening over our land, but it throws its golden light on a free and independent people, subject to none but their God, and held and maintained by a constitution that receives the approbation of the world. Our exultation is in the principles of our government; our joy in their beneficent results. Democracy is our nation's honor; manhood the integrity of our people. Manhood—the keystone in the arch of our republic. Manhood—that which Rome with all her strength could never develop, nor Greece, with all her depth of thought, conceive. MANHOOD, that gave Germany her refor-mation, but not strong enough to make her free; that once made England a republic, but too weak to give her equal rights. No! Europe could never develop it. The nearest she came to it was the Puritan and him she drove, exiled, beyond the sea. Away 42 THE GETTYSBURG MERCURY from custom and the iron grip of centuries; beyond the despotism of monarchs and aristocracies ; on the water-edge of-an unknown continent it found a home, and on that continent it established an ideal government for man, our own republic. We, the people of that republic, sit this day in our own purple, with no master but our conscience, our reason, and our God. Beneath us lies the dark past of conflict, breaking its troubled waters against the mountain of our democracy. The step to a throne has been taken and the destiny of man is sealed. We stand at last where kings have never stood; with no equal in the world; with tyranny at our feet and the eternal sunshine of progress on our heads. In our hands no diamond-studded sceptre; but an in-vincible ballot. On our heads the crown of an inalienable right. Here equality brings the triumph of humanity, the problem of the ages. We give man his rights and in less than two centuries he builds a nation. We make him his own master and he conquers his own self. We give him room for genius and he becomes a Garfield and a Lincoln. Accident and favor no more usurp the place of honor. The wreath of victory is placed on the man who can, be he the favored son of fortune or the poor, obscure peasant from the cabin-home. It is democracy—manhood crowned—that makes us truly great. To destroy that there must be a power greater than the people's and deeper than the soul's. To take away from the people their God-given rights is to make the world an enigma and the hope of man a dream. No! The people rise and with them the world. Creation moves towards its inevitable goal with our own democracy in the lead. One by one the nations fall in line, moving to no martial strain, but to the music of peace, goodwill to mankind. Yonder in the clear light of the future stands the cross of Christ, in which the kingdoms of this world become the kingdoms of the Lord, and around which shall gather the nations all, unfurling their banners "in the Parliament of Man, the Feder-ation of the World." «8^ "The object of oratory alone is not truth, but persuasion. —MaCaulay. THE GETTYSBURG MERCURY 43 THE DREAM OP THE AGES ARTHUR L. CROSSLEY, of Lafayette [Honorable Mention] 'T'HE centuries roll on and on. Nations come and go. But *■ great principles and truths never cease their onward progress. Slowly and quietly they make their way among the peoples, but surely as the eternal God from whom they spring. Such was the principle of religious liberty, forbidden and restrained by the pre-judices and customs of all the past, the first flame kindled in the heart of Luther, then spread throughout Germany and Europe to England and across the sea. Born of the theses nailed on the church at Wittenberg, grown among such convulsions of war and carnage as even Europe had never known before, the principle at last triumphed and the soul of man stood forth free to worship the God of its choice. Such was the growth of political freedom. We see the first faint gleamings of the dawn in early Greece and Rome. But the stormy clouds of the dark ages sweep before our gaze for a thou-sand years. With Magna Charta comes a rift in the darkness. Strong-hearted Englishmen rise in their might and Albion's Isle is free. But for a hundred years, continental Europe still lay in abject slavery at the feet of despots. Suddenly the terrible storm breaks on the vine-clad hills of France. The reign of terror is abroad in the land. Peasant and regal blood alike flow freely, and every brook and rill runs crimson to the sea. When at last the clouds are cleared away, the divine right of kings is a thing of the past, despotism is forever dead, and already we see across the waters the goddess of liberty, whose scepter shall rule the world. The work of the German monk is done. The task begun by Pym and Hampden is finished. The principles of religious and political freedom are proclaimed throughout the earth. But I think, perchance, I see another great principle at work among the peoples. I hear the great heart of humanity throbbing and beat-ing under its mighty impulse. Implanted in the breast of earliest man, it remained for the present age to see it take root and quicken into life. A spark kindled from the great altar of Truth, it has lain smouldering in the human heart through all the centuries. But the great social principle is at work in the world to-day as never before. It is the great force which is to-day shaping the 44 THE GETTYSBURG MERCURY course of events. But little more than a century ago and there was not a nation under heaven in which slavery was forbidden. But, behold, England's air grows too pure for the slave to breathe; the shackles fall from the negroes of the southland; the serfs of Russia walk in freedom. "Tis but the first ripening grains of that harvest which is yet to be. 'Tis but the glimmering stars of the morning which foretell the coming of the sun. Go, read the workings of this great principle in the mighty movements of the past century, in the extended suffrage of our land, in the history of the Rockdale pioneers, in the great secret societies of our age, in the present attitude of the Christian Church, all unite in one mighty strain, the Brotherhood of Man. But as society more fully realizes the great bonds which unite man to man, as the flame of truth grows brighter and brighter, men more clearly see the injustice which surrounds them on every side. The scales fall from their eyes. They behold an age of such marvelous labor-saving inventions as a century ago the boldest imagination would not have dared to dream of. But never has the lot of the toiler been harder. Never have his ranks num-bered so many of the children of our land. They behold a nation groaning beneath the burden of its wealth, whose fields are wav-ing with yellow harvests, whose granaries are bursting with golden grain. Yet in the very midst of these greatest accumula-tions of wealth, there are homes of direst poverty, and children that hunger and freeze. They behold a civilization, the most wonderful of all the aeons of time. But its course is strewn with the wrecks of humanity, its foundation stones are red with the blood of man. But seek a deeper meaning in thy book of truth, in the Utopi-an literature of Bellamy and Morris in the mighty trades-unions with their cry of "labor against capital," in the air ever rife with the curses and threats of the striker; yea, go breathe it in the fra-grance of those flowers that bloom on the graves at Homestead and Lattitner. The great social principle is at work in the world, and has been from Babylon down. But never have its notes of warn-ing sounded so plainly in the ears of all who listen. The silent toilers of the ages have at last begun to know the great wrongs which are being done under the veil of law and necessity, and they are determined to right them, even by that greater wrong, the strike and the riot. The principle is at work in the hearts of THE GETTYSBURG MERCURY 45 men. We see it in the struggling, starving masses of our great cities, in the discontented workers in our factories and furnaces. The threatening murmur grows louder and louder, until but a few months ago, the hills and valleys of our own fair state echoed and re-echoed, rumbled and thundered with the angry cry and fearless demand of such an army of toilers, in solid and united ranks, as never before in an industrial crisis, has blocked the wheels of progress. The toilers of earth have at last realized their strength, and they are demanding that which by justice has ever been theirs. They have turned on their oppressor and ask, "Who made thee a task-master over us? Why shall thy children have a plenty and more than enough while our little ones go a-hunger-ing?" The toilers are waiting their answer. The appearance of a new truth or principle among men ever means a change in the great social organization. It is only a question whether society shall gradually and in due time adjust itself, and it shall only be a reformation, or whether it shall repress the changes which the growing principle makes necessary, until they shall suddenly break forth in a revolution. Ambition and power have been repressing the changes in tlae organization of society which this growing social principle has made necessary, and for this cause is labor arrayed against capital, and there are strikes and riots and bloodshed. Build your roads of iron and your bridges of steel. Harness the steam and the mighty Niagara. Delve deep into the heart of earth and search the infinite with thy telescope. Bring forth the atom of matter and circle the globe with thy lightning. But, im-portant as all these are, there is yet a greater task before the American manhood of to-day—to solve the great social problems which are pressing on every hand, to put an end to this fraternal strife which threatens, to stay the floods of discontent which are slowly gathering their mighty waters, to quench the fires of an-archy which are kindling in every city and village, to fell this cruel giant of oppression who is trampling out the souls of men. Is the task too great ? Falter not, for we have in our sling one sure stone, even justice. By this shall we accomplish our mighty work, put an end to this tyranny of man over man, let no longer one man possess that which belongs to all, but recognize the equal rights of every man to the bounties of nature, the free blessings of heaven and the rich heritage of all the past. This is 46 THE GETTYSBURG MERCURY what justice demands and the working men of to-day are seeking. And it is because we have trampled on these great principles of right, because the opportunities of life have not been thrown open to all alike, but it has been for some to sow and for others to reap, for this cause are the stormclouds gathering on the horizon of time and the laborers are marshalling their forces. The call comes to finish the work begun by Garrison and Lin-coln, to strike down the oppressor of men and forever loose the bonds of slavery which still linger, to wipe out the stain of that southern legislature's recent action, and to make the pages of our own state yet fairer, to rescue the childhood and daughters of our land from the curse of such lives as that of the factory, that life which to-day, ere the bloom ot youth hath appeared, stamps disease on thin pale faces, hopelessness and ignorance on their young lives, and forever brands vice and immorality on their in-nocent souls. We plead not for the men, they are strong. We plead for the helpless childhood of our land, for the fathers and mothers of the years to come. Shield them from the curses which blight. I,et not the gates of the factory and the depths of the mine shut then* from the opportunities of life. Else in the after years they shall know the great wrong which has been done, their hearts shall grow bitter within, and their lives shall become sources of evil and anarchy. "For the child's sob in the silence curses deeper Than the strong- man in his wrath." Go, conquer the isles of the sea. Carry thy commerce to the uttermost parts of the earth. Gather the riches of the nations in thy garners. Wear thy purple robe, knit with the life threads of youth. Drink thy sparkling wine, tinged with the heart drops of childhood. But remember, our brothers, the toilers, are journeying to meet us among the rock-bound hills of Gilead. Wronged through all the centuries, they have not forgotten that stolen blessing. L,et us not delay, but haste to see that these great labor problems are solved, that justice is done in the land, and that brother is reconciled unto brother. Else, behold, these toilers of earth shall rise up and become a very Samson in our land,—nay, even now they are rising—and in their wrath shall they bow themselves and the pillars of state shall tremble and fall at their might. It needs no Daniel to read God's handwriting on those pages THE GETTYSBURG MERCURY 47 of the past. The great social principle must prevail in the end. Whether it come by peace or by a Reign of Terror, whether by the mounts of Gilead where the sons of Isaac met, or by Pharsalia, whether thy brother's anger shall be appeased or he shall rise in his wrath and strike thee down, I know not. But come it will as sure as the fountains of eternal truth and justice. And when at last this great principle shall have prevailed among men, and there shall have been effected in society those changes which the growing light of truth and intelligence has made necessary, when the fertile Canaan of life's opportunities shall have been thrown open to all alike, then and then only will the race of man have taken one more step up the incline of true progress and we shall have come a little nearer to that "Dream of the Ages," that time of which the prophets have foretold, and the poets have sung, that day when the stranger shall see in the stranger his brother, when man shall no longer rise on his fellow-man, but united by the bonds of brotherhood, they shall together mount the heights of progress and achievement. «^ THE MAN WITH THE HOE HOWARD E. SHIMER, of Muhlcuberg- \ RIGHTEOUS discontent has ever been the dynamic force ** making for social uplifting,—the sign manual of progress. It is the men who have been discontented with wrong and oppres-sion that have carried on the great agitations of the world, and have made history. Wilberforce and Howard, Thomas Paine and Samuel Adams, Garrison and Phillips were all men profoundly discontented with the wrongs inflicted upon their fellow men; and from their discontent came the spark that lit the altar-fire of liberty. Were Millet's "Angelus" before us while reading Edwin Markham's "The Man with the Hoe," we would be inclined to revolt against nature's apparent injustice. Millet has painted the man with the hoe in colors; Edwin Markham, in words. He is a digger of the earth, bowing his back and breaking the clods. He stands as a type, the honest and honorable representative of those whose lot it is, and must always be, to perform the hard uninspir-ing and soul-crushing labors of mankind. He was seen of old 48 THE GETTYSBURG MERCURY among the brick-makers of Egypt, among the millions who lifted wearily the walls of Ilium; who carved the pillars of Karnak and paved the Appian way. To-day he may be seen with a needle in a New York sweat-shop, with a pick in a West Virginia coal mine, with a hod in a London alley, with a spade on the banks of the Zuyder Zee. The manual laborer of to-day is far more discontented with his environment than were his progenitors. This discontent does not imply that his condition has degenerated. It is rather a sign of progress from the status of the mere burden bearer to that of the thinking and responsible social unit. The leaven of educa-tion has worked through the mass—all too imperfectly it may be —and fermentation is still going on. As the reed, breathed upon by the great god Pan, could become no more "a simple reed by the river," so it is no longer possible for the man with the hoe, into whose soul has come the conception of larger liberties and a wider life, to accept with dull and passive content the lot of his forefathers. Much depends upon the point of view from which this man with the hoe is considered. When beheld through the windows of a Fifth Avenue palace, the objective universe takes on a different aspect to that which it assumes when seen from an East-side tene-ment house. The counting house and the sweatshop generate two distinct philosophies of life. The sympathetic spirit may be aroused by the thrilling tale of the sailor's ship-wreck, the miner's entombment, or the slow starvation of the sweater's slave; but only those who must bear the brunt of these industrial tragedies can realize to the full the horrors of the black waves, the poison of the fire-damp, and the howls of the hungry wolf at the door. Sometimes it is a tyrant, forgetful of this brunt, who oppresses; sometimes it is an aristocracy which gathers in the fruits of power and throws upon the masses the burdens of government; sometimes it is a plutocracy which openly exalts money and debases flesh and blood; but everywhere it is the same brutal spirit which ig-nores the brotherhood of man. He was a veritable Columbus in the world of sociology who made the discovery that there is a good deal of human nature among men. The man with the hoe may justly claim to possess his modicum of human nature. With Shakespeare's usurer, he may exclaim: "If you prick us, do we not bleed? If you tickle THE GETTYSBURG MERCURY 49 us, do we not laugh? If you poison us, do we not die?" The laborer is a man, claiming a man's share of life; and the questions which most directly affect him can be best considered from the standpoint of manhood rather than from that of classhood. But it is this very breadth of vision that is the most difficult of attainment. The increase of the class sense is rapid. Even the constant attrition going on under democratic institutions does not serve to keep it in check. Plato's saying that "every city holds two nations, the rich and the poor," has in it only too much truth. The Optimist, however, sees thatthe standards of humanity are being more and more upheld by the masses, who occupy that social stratum which lies between the dark despair of the Sub-merged Tenth and the gilded idleness of the Elevated Four Hundred. The literary sycophants who strew rhetorical flowers in the pathway of the successful, without inquiring into the methods employed for procuring success, complacently throw the respon-sibility for the present condition of the man with the hoe upon God, or Nature, or the man himself. Is it the fault of God or Nature that children are driven into factories at so early an age that their bodies are stunted, their minds dwarfed and the strength and usefulness of future generations impaired? Is God or Nature responsible for the laws which permit this impairment of the man-power and the woman-power of the nation? The indolent cannot expect plenty under any just form of government; neither can the vicious expect happiness. But, let us see whether something can not be done to alleviate effectually the painful inequalities of the conscientious employee as compared with his employer, and whether philosophy can not be led from the closet and religion from the altar, and made to exert a united, a practical, and an all-powerful influence upon the affairs of men. Give justice to everyone—justice in the making of the laws, justice in the interpretation of the laws, justice in the execution of the laws,—justice first and charity afterward. But questions of detail and method constitute, after all, but a comparatively unimportant part of our problem. The great thing is, that the mass of the community shall be capable of self-govern-ment. Theologies and governments alike are but the replica of the human minds back of them. Michael Augelo may conceive SO THE GETTYSBURG MERCURY heaven-reaching lines of grace; but to erect the stately edifice there must be suitable material. So, the question of the industrial welfare of the American laborer merges into the broader question of the triumph or the failures of the democratic idea upon which the American Republic is founded. Political equality and industrial inequality can not long co-exist. In our republican institutions work the ferment of the ages and the leaven of all nations. Kings may prop up their thrones with bayonets; but democracy must rest upon in-telligence. The greatest danger which confronts our republic is the grow-ing antagonism between classes. The poor will never again be the passive sufferers of bygone ages. Their indictment of social injustice is drawn and presented. "Bitter voices say it," writes Ruskin, "voices of battle and famine throughout all the world, which must be heard." The test is at hand which is to prove whether the sneers of Macaulay and Carlyle against the republic were false or founded upon truth. It is easier by far to preach the gospel of rights than to teach the law of the comprehension of duty; for the latter demands a well-disciplined and well-devel-oped intellect. We know that it is said, iu palliation of the restrictive influence of plutocracy, that the condition of the man with the hoe is as good as he deserves. We know that it would be useless and per-nicious to call upon the half-savage and brutalized peasantry by electing them to Congress or the State Legislature. We know that the man with the hoe is unfit for it, that is the very curse of the system. What is it that unfits him? What is it that makes slavish labor, and slavish ignorance, and slavish stupidity his necessary heritage? Does not the same Aryan blood course through his veins? Has he not five senses, the same faculties, the same passions? When every true American realizes that the Almighty knows no class distinctions; when the lessons of truth and purity which have been inculcated in our Christian homes, will be applied to the man with the hoe; when religion and labor will go hand in hand; when none but the bravest and most loyal citizens dare sway the employer's sceptre, all signs of decay will be buried into oblivion and we shall have a nation too noble to crumble, too great to be conquered. THE GETTYSBURG MERCURY 51 WAR IN THE LIGHT OF THE TWENTIETH CENTURY EDWARD E. KELLEY, of Ursinus '-pHE military power of Europe has become a matter ot vital *■ importance. She is virtually arm-crushed. Her armies are devouring her very substance, depleting the national treas-uries, and changing the established social and political con-ditions. With the unsettled state of China, the increase of arma ments and navies and the attitude of a people cursed by taxation and conscription, Europe cannot remain forever a vast, hostile camp. The rivalries of England and Russia and the antipathies of the Frank and the German threaten to "turn loose the dogs of war'' to prey upon humanity for their self aggrandizement. Under existing conditions war must come. Such is the verdict of history as she points the finger of warning to Rome and Carthage. A condition of affairs like this, however, has no place in the midst of the liberty, the intelligence, the happiness and the morality of our age. When war thus threatens to rush the nations headlong into a "roaring conflagration of anarchies," then war disdains the spirit of the age, mocks the God-like reason within man, and becomes "the living and triumphant relic of barbarism." Not only Europe but the civilized world demands that this in-stitution, by which so few rights have been gained, which could not have been achieved without it, be brought before the bar of reason. For this institution has committed the greatest crimes recorded on the pages of history in blasphemy of that which is holiest; in the name of liberty, fraternity and equality, the French Revolution raised a gigantic monument whose brick was the flesh of Frenchmen and whose mortar was the heart's blood ot France. True, some wars have been productive of a lasting good. Europe purchased liberty of mind by the death of six million crusaders; religious liberty was the outgrowth of the Thirty Years' War; the French Revolution broke the iron chains of despotism; this, our own glorious union, had its birth in war. It were a grievous pity, however, if such a blasting institution had not done some good. The most lasting benefit may be the result of the worst evil, and on the other hand, "the purest, holiest and noblest virtue may be devoted to a useless cause." But the blighting and accursed results of war everywhere predominate. Civiliza-tion was retarded one hundred years, as a consequence of the THE GETTYSBURG MERCURY Thirty Years' war. The civil wars in England and France delayed it for similar periods. Above all, man is to be governed not by material but by moral standards. There is no doctrine more abusive to the human understanding than that we ma}' do evil that good may come. There is another sentiment—"sublime, sacred, insurmountable, indestructible, eternal—the sentiment of right." Let no advocate of war presume on the dead past as a criterion for the breathing, ever living present. Political and economic conditions have changed since George the III; absolutism is a thing of the past; the object of the crusades is now the noble mission of the press. Oh! how incompatible with the age is this institution of war. We, the heirs of all the ages, look with sympathy on the barbaric past, and still we train legions of men to the profession of murder; we speak of a higher civilization amidst the ruin of our home, the shriek of the widow and the cry of the orphan which our cruelty has made. We boast of a common brotherhood of man, and yet we grasp our fellow by the throat and stifle the very life that God gave him! The fact that our own nation recently drove despotism from the shores of this west-ern continent and broke the shackles of an oppressed people is no justification of war. It was a glorious work. And she but made use of a recognized agent which is maintained by the interests and prejudices of powerful nations. The stigma lies not on the noble work of the Republic; but upon the age which upholds this bloody relic of the past in domination over reason; for this age, while it makes the individual abide by a trial of reason, is so inconsistent as to allow the nations, groups of individuals, to be ruled merely by their lust for conquest. Let us not, I beseech you, deceive our-selves. For this institution of war to have a mission, our religion, which teaches love to one's neighbor, must be false; philosophy, which teaches the irrationality of brute force, belies itself, and man, who professes to acknowledge standards of morality and justice, is a base and unworthy hypocrite. Vain and delusive is the theory of the survival of the strongest —of the right of one civilization to crush another out of existence. Our universe is a natural one, and its units can only grow from step to step through the continuous process of natural law. Where-ever nations have attempted to usurp the place of nature by in. troducing untimely changes, inevitable and dreadful reaction has THE GETTYSBURG MERCURY 53 followed. History is replete with the baneful results of coercion. Such a theory binds only the jungle. When applied to man, fash-ioned in the Divine image and sweeping onward, ever onward to the realization of his ideal, it prostrates the native dignity of his manhood in the dust. The triumph of the stronger is not the triumph of justice. O, strange Justice, which is ever on the stronger side. "Truth forever on the scaffold, wrong forever on the throne." Tell me, when Poland, noble and heroic Poland, lay crushed and bleeding at the foot of the Muscovite, was the triumph of the stronger the better? Who of us is certain in his heart that force is accomplishing a purpose in South Africa? Read in the history of Ireland another living witness against the iniquity and injustice of war. Truly, justice depends upon reason and not upon the sword, and man, "the sovereign animal of crea-tion," cannot be molded like clay. We have reached that stage in the world's progress when the restriction of force will be conducive to the advancement of civ-ilization; when co-operation must replace destructive competition. Before this growing love of humanity man must acknowledge his fellow as a natural as well as a social and political unit. Before this growing love of humanity war becomes a crime. From amongst the ruin, bloodshed, and carnage of the battle-field, the soul, startled, shrinks from its shattered body to wing its flight heavenward ':o record its destruction. Do you not think that God, the great sovereign of nature, will demand the right of its deviation from that purpose for which the laws of nature and of nature's God created it? By what right do we rush this being, its heart fermenting with evil passions, with curses upon its lips, un-called into the presence of an offended deity? How will we in judgment before the tribunal of the Most High, free ourselves from our responsibility for its condemnation? How will we an-swer the shivered, wrecked and ruined legions—the once glorious and God-like representatives of a mighty universe standing hand to hand .witnesses before the Eternal King against us? Is it through the plea that we desired the territory belonging to another? Is it through the false argument that we wished to substitute our higher civilization for a lower? The rise and fall- of nations means less to God than the loss of this one soul—this soul, which, as Cato says, "secured in her existence, smiles at the drawn dagger and defies its point. The stars shall fade away, the sun himself grow dim S4 THE GETTYSBURG MERCURY with age, and nature sink in years, but thou shalt flourish in im-mortal youth, unhurt amidst the war of elements, the wrecks of matter and the crush of worlds." When all is considered we find that man is bound to his fellow not through mere ties of blood, but by the sacred ties of his own divine nature. A condition of affairs like the present which ig-nores this hallowed link of a common Fatherhood strikes at the very vitals of Christian idealism. The maintenance of war, this relic of primitive man, on the plea of its antiquity is unjustifiable. History is a mute witness to the fact that all human institutions have their day, that once they have ceased to be of utility they must either be forgotten or destroyed. "There is no question without an answer; no problem without a solution." War and "man's inhumanity to man has made countless thousands mourn." Man introduced inequalities and wrongs upon this earth; honor de-mands that by him they must be righted. Duty calls to everyone of us to array himself on the side of humanity. Let others sing of the flag and country, I plead for this growing love of humanity which will elevate and purify patriotism. Let others chant the martial music of war, I hear the cries which have risen midst the ruins of the world's battle fields; from the homes of those who have shed the rich, ripe blood of their manhood in behalf of military glory; from the millions who have been robbed of their liberties; from the millions throughout the broad universe who have been ruthlessly sacrificed to the cause of nations. Oh, we have had enough,of bloodshed! Let us blot it from our lives, and I appeal to you, representatives of our civilization, to cast your in-fluence wherever you can, against this hideous relic of barbarism. Remembrance implores you by the sorrow-tensioned chords of memory; from every blood-stained battle-field the commingled ashes of the dead entreat you; humanity cries out to you in the mute persuasion of her fallen greatness, and heaven adjures you in the dying agonizing voice of a crucified God: Thou shalt not plant the brand of Cain upon the brow of man! >*> ««£> " Eloquence is the appropriate organ of the highest personal energy.''—Emerson. THE GETTYSBURG MERCURi 55 ■ INTERNATIONAL ARBITRATION TO SATISFY NATIONAL HONOR JAMHS N. DOWNEY, of Lehig-h HPHE establishment of an international tribunal to which all * disputes between nations, that cannot otherwise be adjusted, should be referred has been the dream of philosophers and states-men for ages. That this has not been accomplished, proves that civilization has not advanced sufficiently to enable nations to set-tle their differences except by resort to arms. In the dawn of civilization we find, even in judicial processes, a mixture of forcible contention, showing the transition from a period when rights were regulated by the strong hand. In later years, however, there has been some progress in settling disputes between nations and the principle that human reason is capable of settling differences as well as creating them has been established. The past century was ushered in in the midst of a period of destructive wars and its history contains the records of many bloody conflicts. Nevertheless, it has witnessed the growth of the practice of international arbitration to satisfy '' National Honor." This method has been shown to be broad and far-reach-ing, and while in some instances the award has been set aside or not enforced, in no case have two nations gone to war after hav-ing agreed to arbitrate a difference. The first experience of this nation in settling disputes was the Jay Treaty with Great Britain in 1794. While this treaty was not satisfactory and by no means popular with the American people it is our initial step in the paths of arbitration. Washing-ton alone, while not approving of the treaty, stood up for it and signed it. In so doing he exhibited his firmness of character, good judgment, and foresight. And when he said "My objects are to prevent war, if justice can be obtained by fair and strong representations of the injuries which this country has sustained at the hands of Great Britain," he at once struck the key-note of arbitration. Since the Jay Treaty there have been twenty distinct arbitrations between the two great English speaking nations of the world, Great Britain and the United States, of which the Behring Sea dispute is the latest example. The greatest settle-ment was that of the "Geneva Award" in regard to the Alabama claims and it demonstrated that arbitration between nations was possible. This was a grave question and involved the honor 01 S6 THE GETTYSBURG MERCURY England and the United States, yet by temperate and wise dis-cussion, it was brought to a peaceful adjustment, and, as has wisely been said, "Two great and powerful nations, gaining in wisdom and self-control and losing nothing in patriotism and self-respect, taught the world that the magnitude of a controversy need not be a bar to its peaceful solution and the maintenance of national honor." When the conference at the Hague was called by the Czar in 1899, the suggestion was greeted with sneers and suspicion on the part of many, with enthusiasm by a few and by most with a shrug of the shoulders. The majority of the delegates attending had vague ideas concerning arbitration and its extent. Russia, the leader of the movement, was the greatest surprise of all. She thought arbitration should be made obligatory except where honor and vital interests were involved. Honor and vital interests are always shadowy things in the hands of the statesmen, and, more-over, can be shown to exist in any dispute that may arise. The conference found the idea of disarmament too fanciful and the limitation of armament to its present strength premature. Dis-armament should follow and not precede arbitration. The real obstacle in the way of arbitration is not so much the lack of efficiency in method as the lack of disposition to try it, and the system of arbitration presupposes that nations desire an amicable adjustment of their differences. Such settlement may be prevented, either by wilful opposition to it, by claims that render argument impossible, or by some covert act on the part of one of those concerned. It is difficult, if not impossible, to con-tend against a situation like this, since the direct tendency and effect is to bring on a collision before arbitrators can intervene. History affords many examples of aggressive wars or wars of ambition where national honor was not concerned; but happily they are now becoming less frequent. The remedy against such wars was suggested in the unratified treaty of arbitration adopted in 1890 by the Pan-American Conference. It was proposed to adopt a principle of international law, and to make it imperative that diplomatic and consular controversies and any disputes what-soever between nations, except cases in which, in the judgment of one of the parties concerned, its independence was at stake, should be settled by arbitration. The object of this was to leave each nation the right of self defense, while forbidding any to - THE GETTYSBURG MERCURY 57 commit aggression. Again, at the conference at Hague, these resolutions were revived and vigorously pushed by Great Britain and the United States. Great generals have shown their abhorrence of war. Well-ington said, "Nothing except a battle won can be half so melan-choly as a battle lost." General Grant, speaking of arbitration and national honor, said, "Though I have been trained as a soldier and have taken part in many battles, there was never a time, when in my estimation some way could not have been found to prevent the drawing of the sword." The characters of the men who govern nations and to whom the honor of their country is entrusted, shape the events that fol-low. If they are wise and honorable, then their country will be peaceful and prosperous. If they are impulsive, self-seeking, and unreasonable, then their country will suffer. Our republic, guided and directed by this spirit, has done more for the cause of international arbitration than any other country in the world. Its purpose has been the enlargement of the individual, the advancement of his interests and liberties, and finally, to administer justice to all. The question of peace and the satisfaction of national honor is one which may not be settled for generations. It is one, how-ever, which this and every coming generation will have to deal with, and whatever is done the world looks to the United States as a leader. Appreciating this we may close our minds to our ingenious fault-finding and turning our eyes away to the far horizon, we there see the shadowy images of international law and justice and morality dimly visible among the clouds. k "The prodigies which eloquence often works, in the hands of a single man, upon an entire nation, are perhaps the most shining testimony of the superiority of one man over another." —D''Alemberi. 58 THE GETTYSBURG MERCURY JOHN RUSKIN—THE MAN ' WM. L. HESS, of Swarthmore JOHN RUSKIN has said, 'All my theories are summed up in *-* the line of Wordsworth, 'We live by admiration, hope and love.' Not admiration of ourselves, nor hope for ourselves. Love can be only of others; self-love is a contradiction of terms." Truly, a noble utterance from a man of intense earnest-ness and commanding sincerit3r. Search where you will, there can be found no character who commands more genuine respect and whose personality has been more general than that of the practical thinker, the late John Ruskin. His was a life of genius, enthusiasm and self-devotion. To read him is to admire him; and to admire him is to admire that which is sincere, pure and poetic. John Ruskin was born in London, England. Unlike the fathers of many of our celebrities, his father was a man of affluence, his shrewdness in business, that of a wine merchant, being the means of his acquiring a fortune early in life. We are told that the elder Ruskin was of a visionary nature when away from his shop, and that he spent his evenings in reading Shakespeare and in singing. The mother was a woman of great severity. One of the tasks which she imposed upon her son until he was fourteen years of age was that of committing many and long passages from the Bible. The influence of this early teaching was manifold. His writings teem with Biblical quotations and imagery. We do not find in Ruskin's early life any of those amusements which are so common to boyhood. He was not in any way in-dulged, and if he committed a fault the usual penalty was sure to follow. These restrictions made his boyhood unattractive and uninteresting. Yet there was developing in this quiet and reserved child a genius which was destined to astound the world. At the age of eleven years he is discovered successfully copy-ing the etched illustrations by George Cruikshank, to Grimm's '' Fairy Tales." It is true that as an etcher he showed slight pro-ficiency, but this early performance is evidence that he had the power to become mighty in something although it happened not to be in etching. After having received a preparatory training under the direc-tion of tutors, Ruskin was sent to Oxford, where he was graduated at Christ Church College. His college life was uneventful, and of his life at Oxford he relates, "It seemed to me all that was re- I THE GETTYSBURG MERCURY 59 quired of me was to say my prayers, go to church, learn my les-sons, obey my parents and enjoy my dinner." Like the unfolding of a beautiful, delicately perfumed flower which gradually opens its petals to God's genial sunshine was the unfolding of the life and character of the nineteenth century prophet, John Ruskin. The tempest of criticism beat about him; the fierce winds of doubt, greed and envy tried by their piercing blasts to cast him to the dust; but, like the flower, he remained steadfast and pure—beautiful in his constancy. He held that 'his mission in life was to proclaim the beauties in the works of others—not his own." Did he fulfill his mission? Ask that stu-dent of art who received his first impressions from Ruskin ! Did he fulfill his mission ? Turn to that student of architecture who owes to Ruskin what skill he possesses, and ask if his master ful-filled his mission ! Ask that lecturer or preacher who uses such choice rhetoric in his discourses, that lecturer or preacher who has read Ruskin ! Ask that social reformer who has studied Rus-kin's ideas and method of reform as he saw them in others but which he idealized and made his own; yes, ask that question of all, and the artist, the architect, the lecturer and preacher, and the social reformer will candidly answer, John Ruskin did fulfill his mission, he did perform those duties which he claimed he would perform; and, sir, the world to-day is better because there has lived in it a man who not only promised, but one who also acted out his promises in word and in deed. Ah! a great and good man has gone out from our midst. The physical form of our lamented Ruskin has left us, but the influence of his Christian life remains. And this influence will remain as long as the world endures, and future generations will appreciate Ruskin as we have failed to do. Criticism will be heard no more; but the melody of his language; his grand prophetic visions will be enjoyed by all! Pre-eminently was Ruskin a nature-worshipper. He loved the flowers, the brook, the mountains, and the fleecy clouds. To him the wayside rose preached more eloquently than words the lessons of purity and simplicity, and to sit for hours watching the fitful changing of the skies was to him a perfect delight. His soul stirred within him, he could exclaim with Shakespeare: 60 THE GETTYSBURG MERCURY "Full many a glorious morning have I seen Flatter the mountain-tops with sovereign eye, Kissing with golden face the meadow green, Gilding pale streams with heavenly alchemy." We should study Ruskin, for, by so doing, our faculty of appreciation for nature will be opened. We will more deeply value the small things which lie about us on life's pilgrimage. The tiny blade of grass will arouse new thoughts within us. The dainty Quaker-lady will teach us the lesson of humility as it has never before been taught; even the seemingly unsightly stones which are strewn along our path possess a language too deep for words. An editor of note has lately said, "Work is for the worker." To no one does this more aptly apply than to John Ruskin. Many of his well-defined theories for the betterment of the working classes, and for the uplifting of humanity in general may appear to have been as seed sown by the wayside, but the time spent in working out his theories only strengthened him for the practical tasks which he so well performed day by day. That which is put into work is surely that which shall be reaped. Put in envy, and discontent and misery shall be the reward, whereas power is the reward of love and patience! Thus it was a practical test of our teacher when he gathered around him that promiscuous band of workmen and children to teach .them the right way of living. After his arduous labor of thirty long years to undertake such a stupendous work was noth-ing less than heroic. Again must we pay honor to this fearless spirit, who needed only to speak, and the intelligence of the world listened with awe! L,eft a fortune by his father, he lavished it upon his chosen people, ignorant and poverty stricken. The quintessence of art, literature, and science was offered to them; and costly museums were founded for their instruction. And this cost him more than his wealth! He paid the price; they reaped the material reward! His was the loss of peace; theirs was the gain of a new life and happiness! But the enterprise was a failure! Failure, did I say? Yes, but a glorious failure; not shorn of any of its benefits, its fame still lives as a blessing to humanity! In its character this enterprise might seem Utopian, but after all deductions have been made there is no discredit to be cast THE GETTYSBURG MERCURY 61 upon the memory of John Ruskin, for, bear in mind, he was merely living what he wrote. With his Bible as his lexicon he followed its teachings; followed them although the whole Christian world laughed him to scorn; aye, followed them even after his project had failed! He wrote, "Religion is a submission, not an aspira-tion; an obedience, not an ambition, of the soul," and he lived that religion. His life was a constant submission, a holy obedi-ence to the will of his God, and our God. In his declining years he was rejected; thrust aside by the busy world; but from out his confinement we still heard him proclaim against the evils of the times. In poor health, yet while life lasted he continued to attack the most alluring vices, and preach those "inner virtues" which he held so sacred. There was something awaiting him beyond which was no vanity; all was radiant before him; and on the twentieth of January of the last year of the nine-teenth century the soul of John Ruskin serenely took its flight. . The character of this great benefactor of the whole human race, what is its message to thinking men and women? Simply this, that truth, knowledge, right living, are the basis of growth in man. But there is a sadness in truth! Knowledge has its sorrow! Right living still continues to have its tragedy! The martyred Lincoln wrote the truth in his Proclamation which freed millions in bondage, and his life was the price! The Seeker after knowledge, a Newton or a Darwin, must drink to the dregs the cup of sorrow! A Christ must be led to a Calvary, and there pay the penalty for his spotless life! Upon the monument of Time one more name should be en-graved, that of John Ruskin, and underneath, I would have traced the words, "Prince of Peace." "Those who speak in public are better heard when they dis-course by a lively genius and ready memory than when they read all they would communicate to their hearers."—Watts. "The business of oratory is to persuade people." —Lord Chesterfield. THE GETTYSBURG MERCURY Kntertdat the Postoffice at Gettysburg as second-class matter VOL. X GETTYSBURG, PA., APRIL, 1901 No. 2 K. C. RUBY, '02, Editor-in- Chief R. ST. CLAIR POFFENBARGER,' 02, Business Manager J. F. NEWMAN, '02, Exchange Editor AAssi■s,tant. E»dji,tors Advisor'y Board " , ., 0 ,"" PROF. J. A. HIMES, A. M., LIT. D. MISS ANNIE M. SWARTZ, '02 _ " " " ' "' * . " " ,", PROF. G. D. STAHLEY, M. D. A. B. RICHARD,'02 _ . _. _ ' _ PROF. J. W. RICHARD. D. D. Assistant Business Manager CURTIS E. COOK, '03 Published each mouth, from October to June inclusive, by the joint literary societies of Pennsylvania (Gettysburg) College. Subscription price, One Dollar a year in advance; single copies Fifteen Cents. Notice to discontinue sending the MERCURY to any address must be accompanied by all arrearages Students, Professors, and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE GETTYSBURG MERCURY, GETTYSBURG, PA. EDITORIALS "Mercuri, facande nepos Atlantis." THIS expression from Horace no doubt was used in the prayers of each of the orators who have recently been in our midst and have given us such a delightful treat in oratory. The earnest attention and hearty applause which were given by the audience are sufficient evidences that the efforts of the orators were highly appreciated. Through the kindness of the contestants we are permitted to place before our readers all the orations which were used in the contest, and to the Public Ledger of Philadelphia we owe our grat-itude for the use of the plate in reproducing the photogravure as found on the frontispiece in this issue. We wish to state, how- THE GETTYSBURG MERCURY 63 ever, that the defects in the frontispiece are due to the condition of the plate and not that of the printer. Time did not permit of any change. • Having opened a new store opposite W. M. R. R. Depot, will be pleased to have you call and examine goods. Picture Framing promptly attended to. Repair Work a Specialty Students' Trade Solicited FAVOR THOSE WHO FAVOR US. Spalding's Official League Ball and Athletic Goods Officially adopted by the lead ing Colleges, Schools and Athletic Clubs of the Country Every Requisite for— BAbE BALL FOOT BALL QOLF TENNIS ATHLETICS QVfllNASIUM Spalding's Official League Ball Is the Official Ball of the National League, the princi-pal minor leagues and all the leading college associations Handsome Catalogue of Base Ball arid all Athletic Sports Free to any address Spalding's Offi-cial Base Ball Guide for 1901, edited by Henry Chadwick, ready March 30,1901. Price 10 cents. A. Q. SPALD1NQ & BROS., Incorporated NEW YORK CHICAGO DENVER ROWE, Your Grocer Carries Full Line ol Groceries, Canned Goods, Etc, Best Coal Oil and Brooms at most Reasonable Prices. OPPOSITE COLLEOE CAMPUS. S. J. CODORI, iM Druggistoe Dealer in Drugs, Medicines, Toilet Articles, J- Stationery, Blank Books, Amateur Pho-tographic Supplies, Etc., Etc. BALTIMORE ST. R. H. GULP PAPER HANGER, Second Square, York Street. COLLEGE EMBLEMS. EMIL ZOTHE, ENGRAVER. DESIGNER AND MANUFACTURING JEWELER. 10 S. NINTH ST. PHILADELPHIA SPECIALTIES: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, Stick Pins and Athletic Prizes. All Goods ordered through A. N. Beau. To Repair Broken Arti-cles use Remember MAJOR'S RUBBER CEMENT, lAJOR'S LEATHER CEMENT. Meneely Bell Co. TROY, N. Y. MANUFACTURERS OP SUPERIOR BELLS The 2000 pound bell now ringing in the tower of Pennsylvania Col-lege was manufactured at this foundry. PATRONIZE OUR ADVERTISERS. The Pleased Customer Is not a stranger in our establish-ment— he's right at home, you'll see him when you call. We have the materials to please fastidious men. J. O. LIPPY, Merchant Tailor 39 Chambersburg St., Gettysburg-, Pa. Try My Choice Line of High-Grade Chocolates ¥¥ 3 at 40c per lb. Always fresh at A L CHAS. H. McCLEARY \t Carlisle St., Opposite W. M. R. R. L Also Foreign and Domestic Fruits Y' Always on Hand. L. D. Miller, GROCER Confectioner and Fruiterer. Ice Cream and Oysters in Season. 19 Main St. GETTYSBURG City Hotel, Main St. Gettysburg. Free 'Bus to and from all Trains Thirty seconds' walk from either depot Dinner with drive over field with four or more, $1.35 Rates $1.50 to $2.00 per day- John E. Hughes, Prop. Capitol Cits Cafe Cor. Fourth and Market Sts. HARR1SBURG, PA. First-Class Rooms Furnished. Special Rates to Private Parties. Open Day and Night. European Plan. Eunch of All Kinds to Order at the Restaurant. ALUINGER'S CAPITOL CITY CAFE. POPULAR PRICES - F. Mark Bream, Dealer in Fancy and Staple Groceries Telephone 29 Carlisle St., GETTYSBURG, PA. .Photographer. No. 3 Main St., GETTYSBURG, PENNA. Our new effects in Portraiture are equal to photos made anywhere, and at any price. PATRONIZE OUR ADVERTISERS mm, Ran Co. 140-142 Woodward Avenue DETROIT, MICH. Manufacturers of High Grade Fraternity Emblems Fraternity Jewelry Fraternity Novelties Fraternity Stationery Fraternity Invitations Fraternity Announcements Fraternity Programs Send for Catalogue and Price List. Special Designs on Application. MOTEL GETTYSBURG LIVERY GETTYSBURG, PA. LONG & HOLTZWORTH, Proprietors Apply at Office In the Hotel for First-Class Guides and Teams THE BATTLEFIELD A SPECIALTY XLhc JSoIton Market Square fjatrfsburg, ©a. Large and Convenient Sample Rooms. Passenger and Baggage Elevator. Electric Cars to and from Depot. Electric Light and Steam Heat. J. M. & M. S. BUTTERWORTH, Proprietors Special Rates for Commer-cial Men o^j^jXJXJXj:^^^j:^:-j:^j^->:^j:^>:^?kJ^j-^J^J^>i->i->k-»Ji-?^ji

The Mercury October 1893 ADVERTISEMENTS. IReafring 1Ratlroa6 "The "Royal ■Route" New and Direct Line To and From QETTTSBURQ. Fast, Frequent and Superbly Equipped Train Service Between , NEW YORK, PHILADELPHIA, Allentown, Pottsville, Williamsport, Reading, Harrisburg and Interior Pennsylvania Points, with through connections to and from all parts of the Middle States, New England and the West. Visitors to America's Greatest Battlefield can obtain through tickets and baggage checks, via this new and most picturesque route, at all principal stations and ticket offices throughout the country. I. A. SWEIGARD, C. G. HANCOCK, General Manager. Gen. Pass. Agt. Berber Sfyop, CHARLES C. SEFTON, PROPRIETOR. BALTIMORE STREET. THE PLACE FOR STUDENTS TO GO. ONLY FIRST-CLASS WORK. Chartered 1850, offers Classic, Normal, Music and Art courses for Diploma and Degrees ; comprises three large brick buildings, situated on a beautiful eminence, a lovely campus, library, apparatus, hot and cold mountain water, steam heat, gas light, electric bells, a suite of rooms nicely furnished for every two or three students, music lessons on Pipe Organ, Reed Organ, Piano, Violin, Guitar, Mandolin, Banjo, and Cornet. Lessons in Drawing, Crayoning, Pastel, China and Oil Painting. German and French languages taught and spoken. Special attention paid to Elocution and Voice Culture. Normal course with Diploma for teaching. Strict attention given to Physical, Social, and Religious culture. Kee Mar College is located in a most attractive, refined, and healthful city of 14,000 people. SEND FOR CATALOGUE AND JOURNAL TO Rev. C. L. KEEDY, A. M., M. D., President, Hagerstown, Md. To th£ S^Ud^s oF QANDERS & OTAYMAN Beg to call attention to their splendid exhibit of the leading makes of Pianos and Organs Including the famous ESTEY ORGAN, WEBER, DECKER BROS., ESTEY, FISCHER, AND IVERS AND POND PIANOS. Also a full line of Sheet Music, Music Books, and Musical Instruments of all kinds, including Violins, Mandolins, Banjos, Guitars, Cornets, Autoharps, &c. SANDERS & STAYMAN, 13 NORTH CHARLES ST., BALTIMORE, MD. 934 F STREET, N. W-, WASHINGTON, D. C. Music Sent " On Selection." Catalogues Free. We are Sole Agents for the Wonderful ".^OLIAN," an Orchestra in Your Own Parlor, With You as Musical Director. Spalding's Livery Stable, STRATTON ST., GETTYSBURG, PA. Branch Office, E. S. Faber's Cigar Store. Hacks, Carriages, Wagonettes, Double Teams, Riding Horses, Large Wagons Capable of Holding Sixty Persons at a Time. COMPETENT GUIDES FOR THE BATTLEFIELD. CHAS. J. SPALDING, Proprietor. -SIimiiiiiitlliiiim; .:i',iiiiiniiiiiiuii 'Hii|iiiiiiiiiiiiiiiiiiiiiiiiiiiiini (§"" Gettysburg Carriage Works, CHAS. J. SPALDING, Proprietor. WEST MIDDLE STREET. BUILDER OF ori3e8 Society Baboes H^ti3e flfoebals Stationery The most successful designers of College and University Badges in the Country Estimates Designs on Application ■$f£ ■$• 3f£ BAILEY BANKS BIDDLE Chestnut and Twelfth Streets Philadelphia, ?a. Mary had a Little Lamb, amp jour Memory.) It's wool was all the go— We make it up in BUSINESS SUITS for $1 5.00 you know. These Custom-Made Suits are popular throughout America— because they represent the very Quintessence of Nobby Dress, and are essential to every | business man who cares one lota for economy and APPEAR-ANCE. Send us 6 cents in stamps, stating kind of gar-ment or suit desired, and we Will forward you SAMPLES of Cheviots, Cassimercs, etc., Self-measurement rules and fashion plate. YOU DO THIS; and we do the rest. Balti more cheapest market. KEELER the largest custom producer. Full Dresi Suits, Trousers, - - Frock Suits, • Overcoats, - - JO,iN M. KEELER, 5 N. Calvert St. Baltimore, rid, "Suffer no longer the extortions oflocM tailors '" $25.00 Up. ■ $4.00 Up. $18.00 Up $18.00 Up. OEM'S AGME HALL @MIIV Hirnm 5 and 7 W. Baltimore Street, Annex 6 and 8 S. Charles St., BALTIMORE, MD. NEW SPRING STYLES Of Suits and Overcoats now ready at 20 to 30 per cent, under com-petitors' prices. Write for Samples and Price List. WILLIAM SMALL, DLFIIIK D0OR IlMER AND DOOR DIM 6 WEST MARKET STREET, YORK, PENNA. w. s. SCHRODER, -&>• DEALER IN Correspondence Solicited With Responsible Parties Desiring to Act as Agents, Hats and Caps? Boofrs and Shoes? No. 6 Balto Street, Gettysburg. IV ADVERTISEMENTS. F. D. SCHRIVER, Draper, Importer, - fl^D JVLerehant Tailor, 23 Baltimore Street, GETTYSBURG, PA. The College Mercury. Vol. I. Gettysburg, Pa., October, 1893. No. 6. THE COLLEGE MERCURY, Published each month during the college year by the Students of Pennsylvania (Gettysburg) College. STARR. Editor : JULIUS F. SEEBACB, '94. Associate Editors : FRED H. BLOOMHARDT, '94. FRANK E. FICKINGER, '94. HENRY E. CLARE, 95. WALDO D. MAYNARD, '95. PAUL W. KOLLER, '94. ROSCOE C. WRIGHT, '95. WILMER A. HARTMAN, '95. Alumni Association Editor : D. FRANK GARLAND, Baltimore, Md. Business Manager: BENJAMIN R. LANTZ, '94. Assistant Business Manager: CHARLES F. KLOSS, '94. TERMS * / ^ne vo'ume Cten months), . . . . $1.00 ' (.Single copies, 15 Payable in Advance. All Students are requested to hand us matter for publication. The Alumni and ex-members of the College will favor us by send-ing information concerning their whereabouts, or any items they may think would be interesting for publication. All subscriptions and business matters should be addressed to the Business Manager. Matter intended for publication should be addressed to the Editor. Address, THE COLLEGE MERCURY, Gettysburg, Pa. CONTENTS. EDITORIALS," 91 THE AMERICAN PEOPLE, 93 SEITEMHER, 94 COLLEGE LOCALS, , 94 ALUMNI, 100 FRATERNITY NOTES, 102 ATHLETICS,' 103 TOWN AND SEMINARY, . 104 LITERARY SOCIETIES 105 EDITCrRIAL. IN days long since gone, when the simple great of earth believed and doubted not— in the days when the gods ruled the universe, Mercury was their chosen messenger, carry-ing the expressions of their will wherever sent. He was a jovial fellow, ever ready to respond to the happier moods of those around him ; nor did he deem himself superior to the mor-tals he often visited. Indeed, so well did he endear himself to them by his cheering, help-ful ways, that images of himself were used along roadsides as .finger-posts to guide trav-elers, and the first thing to greet the way-farer at gate of city or door of house was the smiling face of Mercury bidding welcome to its portals. But now all is changed. Men, in the haughty superiority of their knowledge, have dethroned the gods. Mercury alone re-mains. Offered the freedom of the world by its grateful inhabitants, he accepted it, settling down at length to his old occupation as an index to travelers and welcoming host to the. guests who arrive at this city of learning. He it is who, in the name of the older citizens, in his modern form bids a hearty welcome to the class of '97 and all new guests. You have indeed well come. * CLASS of '97! THE MERCURY congratu-lates you on your numbers and oppor-tunities. In these times of stringency in the money markets of your land, you have come as pure gold from your monometallic homes to replenish anew the circulating medium of these classic halls. Your Alma Mater, con-scious of the charge given her, is proud to direct your course. Your elder brothers, though they affect contempt for your " fresh- 92 THE COLLEGE MERCURY. ness," think with pride of the name your presence will help to give our common mother. The Faculty—what can it do but be pleased? You may be offended at times by the strictness of your instructors, by the rigidness of your discipline, and think the Mater has received the wrong appellation, but after years will teach you better. What seems strictness now will then appear the truest kindness, while words of rebuke will be treasured up as incen-tives to better endeavors where mistaken kind-ness will be forgotten. * * * " A SPLENDID opening at Gettysburg " is fl the way to put it this time. And we are glad to see it. With a Freshman class number-ing 55 or more, and additions to other classes we have an assurance of what the future will bring for our Alma Mater* Let all the friends of the college rally with increasing devotion to her support, and give to her that large-hearted sympathy and encouragement which shall make her strong. These large acces-sions, we take it, give assured evidence both of the deep interest which the sons of the college take in her welfare, and also of the unwaver-ing confidence which she inspires. This is as it ought to be. Let the work go on. Give us more students—more endowment—still better equipment for the work, so that at Gettysburg may be found all the advantages which the very best institutions of the landfumish. There ought to be, for a Church which takes fourth rank in America, at least one powerful university, and where else than at Gettysburg ? We ex-pect to see that realized in our lifetime. Hasten the day. G. * ■ * * THE editors of THE MERCURY desire to ask the indulgence of their readers for whatever in its present columns does not approach its usual high standard of excel-lence. The staff is laboring under the de-cided disadvantage this month of having several new associate editors who are entirely unacquainted with the requirements of their respective departments. In addition to these, the editor of the Alumni department was un-avoidably delayed in his return to college, and his work has suffered in consequence. This explanation is made at the request of the new staff members, who wish at the same time to assure the subscribers of a better showing next month. In this connection it may be well to reiterate the request that has been made in these columns at different times for contributions and news items from students and Alumni. THE MERCURY is the best, indeed the only true representative of the interests of the college and student-body, and should, therefore, be upheld by all who are interested in the advancement of old " Pennsylva-nia." * * LET there be no hesitancy among the new students in joining one or the other of the Literary Societies. No one can at all afford to miss the advantages which these afford in the direction of literary culture. There will be a rich return rendered if these societies are in any measure what they ought to be. And we are led to believe that never in their history have they been so excellent as now. The croaker will be around, of course. He has no interest in them, except to revile their work and their methods. Don't listen to the croaker, he is at college for the fun there is in it, or to spend his father's money; he is not one of the progressive, wide-awake boys who will use every advantage afforded for intel-lectual'culture. Don't listen to this fellow, but go into a literary society and work there four years, and you will spend the remainder of your life in thankfulness that you did so. G. * * * THE MERCURY desires to call the atten-tion of the students to the advisability of establishing a second-hand book-store within the college walls, in which those who wish to dispose of and those who wish to THE COLLECxE MERCURY. 93 buy books may find a ready medium of exchange. All know what trouble and delay was caused at the beginning of this term by the inability of the majority to ob-tain books. Nor is this merely an occasional occurrence—every term witnesses the same confusion. There would be no need of this, if system were introduced into the exchange. The plan has much to recommend it, and has been successfully put into operation at other institutions. Let some one take the matter in hand, establish headquarters for exchange, and the boys will soon recognize the benefits of the plan. Those who wish to sell can bring their books with the prices marked therein; those who wish to buy will find at such a place whatever books they need. Of course, the one in charge will have to receive a moderate commission, but, in view of the time, trouble, and temper saved there can be no objection to this. The plan is worth a trial. AS the libraries of the institution are for use, they ought to be opened daily to the students. - The old custom of opening twice each week is out of date now that the college has advanced to the front rank in' other directions. It was in the past the experi-ence of the writer that the society libraries were used more largely than the college library. And it is likely so now. But these store-houses are locked up to the anxious reader now, except on two occasions each week. He may look through the iron bars at the treasures stowed on the shelves, but he must not touch, taste, or handle. It ought not to be so. Let it cost a small sum each month, but by all means put some one in charge who will open these libraries several hours each day. Make it convenient to the students to get books and they will use them. Settle this at once, as there is no question about the wisdom of it. Let the most pro-gressive Society move first in this direction. We wait the issue. G. THE AMERICAN PEOPLE. ALL bustle, excitement, hurry, business pressure, quick disappointments, short joys, feverish desires, insatiable ambition, all these are characteristic of the great Amer-ican nation. Never since time began has there existed in any country or in any clime such a being as the American. He is denominated by fellow-countrymen as morbid, petulant, and excitable. Why all this speed ? why all this hurry ? Is it an intuitive desire to do such things, or is he so influenced by his surround-ings ? The word^ hurry has become synony-mous with the term American. In comparing the life of a business or professional man in Europe with that of types of the same class of persons in our own country, a marked dif-ference is observed. There is not a moment in which American men seem to be unem-ployed. They rush along the streets like ani-mated wagon-wheels. From early morn until dewy eve there is a constant rush and bustle. This drive and excitement of business often continues far into the night. The lawyer, after leaving his office, merely transfers his work to the quieter surroundings of home. The mer-chant, after closing his place of business, burns the midnight oil over his day-books and led-gers ; and while half the world is wrapt in the sweet embrace of slumber, the financier is planning fresh business schemes and is study-ing the fluctuations of stocks and bonds. The silence and rest of the Sabbath is broken by the shrieking and howling of the trains carry-ing perishable freight, such as lumber, soft coal, and coke. We travel by lightning ex-press, correspond by telegraph, talk through the telephone, and the time is not far distant when mighty vessels shall rush through the hazy atmosphere carrying both passengers and freight. The American widower of to-day, deprived of a gentle, peaceful, and loving wife, buys for himself a phonograph, in order that he still may have something to talk back to him. The 94 THE COLLEGE MERCURY. American baby of to-day will scarce repose in its cradle long enough for its foot to grow to sufficient size to wear a number naught shoe. At the age of three it will talk politics with its father, and at six will want to vote. Everything is hurried. Men will rush for the trains. Men will rush to the lunch-counters. Men will rush to the stock exchanges with a bundle of stocks in one hand and a roll of bills , in the other. If one is successful, he ventures again; if he fails, he is in a hurry to die, and no matter if the office is Russell Sage's, he will blow to atoms, with a dynamite bomb, the office, with its inmates and himself included. He is in a hurry to get rich, consequently he besieges the race-tracks and gambling dens, and stakes his money with the insane idea that he can beat the gamblers. He is in a hurry to get married,- which necessitates the building of a church on one side of the street and a di-vorce court on the other; and it very often happens that the bridegroom stands before the judge in a divorce court with the same bouquet in his button-hole that he had when he stood before the' parson at the bridal altar. The children of the present generation are scarce able to know they have a mamma until they are placed behind the walls of a kindergarten, and a few years later, by undue mental develop-ment, possess heads like pumpkins, bodies like radishes, and a dyspeptic stomach in the bar-gain. The American women besiege our bar-gain dress-goods counters in ceaseless streams, and array themselves in such fantastic shapes that philanthropic persons have been forced to organize societies of dress reform. We have societies for the prevention of cruelty to ani-mals— let the good work go on—and, if the dress-reform movement continues, perhaps we will have some more. Although death should end the hurry of the American, yet even after death he is hurried. He is either placed in a crematory and his mortal remains all consumed in the brief space of forty-five minutes, or the hearse in which he is placed to be conveyed to his last resting-place is driven at such a tre-mendous rate of speed over the cobble-stones that the black ornaments on top of the wagon of death float to the breeze like the plumes on the helmet of a mounted warrior. Finally, he is placed beneath the green sod, and on the tombstone, reared to his memory, is inscribed the very appropriate motto, " Died through too much hurry. The American takes a vaca-tion at last. May his rest, indeed, be sweet." J. S. E., '94. SEPTEMBER. Gold that fades into misty pink, I'ink that melts into tender blue, I >eep in the west where the mountains sink, Like gates that close when the sun goes through, Glowing to rest like a dying ember— And that's September. Mist that floats in the valley at eve, Frost that gleams on the grass at morn; Insect voices at dusk that grieve ; Gathered sheaves of the ripened corn; Hearts that yearn and hope and remember— And that's September! M. R. H., '94. COLLEGE LOCALS. FRED H. BLOOMJIARDT and WILMER A. HARTMAN, Editors. COLLEGE opened Thursday morning, September 7th, at 8 A. M. Many famil-iar faces were missed from each class, while many new ones were seen filling their places. The prospects for a successful year were never brighter in the history of the institution. After an address of welcome by President McKnight, the customary announcement to the assem-bled students of the order of their recitations and the books required was made by the pro-fessors, after which the boys were released for the day, in order to give them a chance to ar-range their rooms, and prepare for the real beginning of the college year on the morrow. On Monday night, September nth, the Sophomores and Freshmen had their annual rush. It was so dark that one could scarcely distinguish faces, so that it is difficult to decide THE COLLEGE MERCURY. 95 to whom the victory belongs, but the general opinion seems to be that, although '96 was outnumbered more than two to one, it won the greatest number of rushes. It may not be out of place, in this connec-tion, to suggest to those who may take part in future rushes that they have them during the day. The advantages to be derived from this are numerous, while the disadvantages are almost nil. Both classes can then see what they are doing, and not be guilty of the re-cently- observed absurdity of pushing their own men around the field. It will also do away with the incentive to unfair play which the darkness of night offers to those of both classes whose sense of right is feebly devel-oped. Besides, it will make it more of a class affair, compelling the upper classmen and townsmen to hold aloof. All these objection-able features were in force in the last rush, and the time is at hand for reform. The college musical organizations lose two very valuable members in Hoffman and Ma-dara of the class of '95. The former enters Yale while the latter goes to the University of Pennsylvania. Notices were placed On the bulletin boards by the manager of the Glee, Banjo and Man-dolin Clubs calling for candidates for the sev-eral organizations. The answers to the call were encouraging and Prof. Miller considers the present status of the applicants, without any joint practice, almost, if not altogether, equal to that of last year's clubs with all their train-ing. Manager Duttera is pleased with the out-look and feels confident of success. Ninety-three was well represented in chapel on the morning of September 19th by Messrs. Kline, Bare, Ehrhart, Oberholtzer, Parsons, Neudewitz, Kelly, and Enders. " Fads " re-ceived his usual share of attention. President McKnight was in attendance at the Allegheny Synod September 9th, at Hunting-don, Pa. Dr. Huber attended the meeting of the Board of Publication at Philadelphia last week. In a meeting, held September 23d, the class of '95 elected Mr. Witman as Business Mana-ger, in place of Mr. Hoffman, now of Yale. Mr. Newcomer was also elected Assistant Business Manager, and Mr. Eckels as Asso-ciate Editor to fill .the vacancy caused by Mr. Witman in that department. Freshman yell: 'Rah! 'Rah! Rah! 'Rah! 'Rah! 'Rah! '97 Siss ! Boom! Yah! The banjo and mandolin clubs have been partially organized and consist of the follow-ing members. The positions and names of the former are Banjeaurines: HERSH, BAUM, ECKELS. Second Banjo : COBEAN. Piccolo Banjo : HEINDEL. Guitars : BlKLE, ZEIGLER, FICKINGER. Mandolin: EHRHART. Another guitar will be added in a short time. The positions and names of those on the mandolin club are as follows : First Mandolin : EHRHART, WERT, RICE. Second Mandolin : BAUM, HEKR. Guitars: BlKLE, ZEIGLER, FICKINGER. Flute : SMITH. The clubs, in conjunction with the glee club, will give an entertainment in Brua Chapel, on the 23d or 24th of November. This will be their initial concert, perhaps the 96 THE COLLEGE MERCURY. only one given during the term, but there is every assurance given of an extended tour of the clubs during the Christmas holidays. The musical talent of the college will not suffer total annihilation for awhile, at least, since the " Count" has his new guitar, " Sweitzer " his mandolin, " Sheckels " his banjo, while " Plainfield," in the absence of a violin, makes use of " the instrument nearest it," the human voice divine (?). The artists on the staff of '95's Spectrum have begun active work in their department. The associate editors have also been assigned to their various departments, and the Spectrum may now be expected to move on to glorious success. The courtesy of the new treasurer, Mr. Pick-ing, and the convenience of having his office on the college grounds are greatly appreciated by the boys. Even Seniors make mistakes. One defines " Political Economy " as the " Gospel of Mor-mon." Va(i)n are our strivings toward per-fection. And now the innocent Freshman speaks about the " Livy" exercises of the class of'93. Our c(l)ute Freshman says he has a dead " kinch " on a horse to the French alphabet. " Our James " says the early races " culti-vated " animals. The dear little fellow thinks he can give them pointers on keeping stock. " That same old smell."—Kloss. The Juniors have succeeded in convincing Dr. McKnight that it is too hot to study Psy-chology. The "clbetrich " season has opened with many devotees. Several " Preps " have been out on the hunt for the mysterious animal, but without success. Dr. B. (in Lab.)—" Mr. J., in what are you heating that substance ?" Mr. J., '95 (knowingly)—" In an indignation tube, of course." Dr. B.—" Give me the parts of sum!' M., '96 (after much hesitation)—"Amo, amarc, amavi, amatum." S., '94, whose knowledge of transportation is limited to horse-cars only, answers the trol-ley- car conductor's query, " Where do you want off," by "Oh! I only want five cents' worth of ride." " Remsen" (while napping over his Political Economy and reveling in dreams of his be-loved Chemistry)—"Dang it! what experi-ment's that ?" S., '94—" What's wrong)?" " Remsen" (rubbing his eyes)—" Oh ! I was just reading over a line here, and all I could get out of it was, 'And he had a cheerful, frank, sodium countenance.' " Respectfully dedicated to the co-eds. of '94: " Little Miss Muffet Sat on her tuffet, Studying Theistic Belief, When along came a spicier And sat down beside her, And brought her nigh unto grief." Mr. W., '95 (translating *f:i-! 4>tS!)—"Alas! Alas !" Dr. B.—" How is that ?" U.,'95—"Alas! Alas!" Dr. B.—" I guess not." U., '95—"A lass!! A lass !!" C, '97, to H., '95—" Don't you know, I was filling my student's lamp to-night, and it all ran out before I knew I was filling the wrong end." " Ursinus " (waiting at Y. M. C. A. reception, greatly excited)—" We've only got two kinds of vanilla—peach and ice-cream." " Buckskin " says he hardly thinks Governor McKinley can be re-elected Governor of Cali-fornia. "Kid" H., '94, during his visit to Chicago, had quite an experience. When the bell-boy answered the continuous ringing of the call- THE COLLEGE MERCURY. 97 bell, he heard the " Kid " murmuring, as he held the pitcher under the button, " I have been pressing this button for fifteen minutes and haven't got a drop of ice-water yet." Every Senior class has its married man, and '94 is no exception. .Arthur Deisroth, Hazleton. E. M. Duck . Spring Mills. J. H. Eckert, Gettysburg. Charles Emmert, . Hagerstown, Md. George Englar, Linwood. Joseph Enniss, Burkettsville, Md. Charles Erb - Boyertown. .Frank Fegley Allentown. C. E. Fleck, New Kingstown. Dr. B.—" Have you ever heard any Chinese^ w ^.^ Jefferson, Md. music?" ■ John E. Gable . •. Lititz. B.,'94 (suspiciously, after a summer's ex- ,4 Carroll Graff, Dululrnft perience)—" Do you mean chin music, doc-tor?" Hanover. University down to 16 to o. More will be '/j. p. Michler, ." Easton. given in next number. Hurrah for Gettys- { burg! The following are the accessions to each department. There are several others who contemplate coming, but who have not arrived as yet. Their' names will be published in our next issue. , Senior Class. Orville Sigafoos, Easton. Junior Class. George Eckels Shippensburg. J. C. Fassold, Sunbury. Harry Mohn, Adamstown. Sophomore Class. C. W. Rank, Williamstown. ■ D. E. Rice, . ' Chambersburg. C. J. Stephenson, Pervin. Freshman Class. George Abel . Philadelphia. E. A. Armstrong, Hellam. A. R. Aukerman, Altoona. W. M. Aukerman, Altoona. E. D. Bankard Taneytown, Md. F. E. Beltzhoover, Jr Shepherds Town, W.Va. Henry Bikle, Gettysburg. John Cable, Smithsburg, Md. Horace Clute, Harrisburg. Roy Coble, Lykens. Arthur Coble Lykens. K. M. Culp, Gettysburg. Walter Monath; Chambersburg. Charles Nicholas, . • West Fairview. Harry Olewine, Hazleton. J. W. Ott Rocky Ridge, Md. Harry Sheely, Gettysburg. 1 Pearlie Shriver Fairplay. W. M. Shoop, . Colebrook. H. R. Smith, . . Chambersburg. C. G. Smith Beaver Springs. "^M. L. Smyser, Wellsville. W. R. Stahl, Hays Mills. Robert Stahle Gettysburg. -J. Emory Stockslager Funkstown, Md. Lillie Tipton ' Gettysburg. -{(. G. B. Trimmer, Union Bridge, Md. John Turnbach Hazleton. W. E. Weikert, Green Mount. 4 C. G. White, Manheim. Robin Wolf, Gettysburg. Preparatorians. Ralph Buehler, Gettysburg. James Burrell Williamsport. Howard Erdman, Macungie. Chas. W. Earnest, Mifflinburg. Roy Geesy, Altoona. George P. Grammer, Gettysburg. Harry Hardman, Littlestown. Chas. B. Kephart, Harney, Md. William Kepner, Gettysburg. J. W. Krafft Glenrock. John Le Fean, York. Blanche Minnich Gettysburg. 98 THE COLLEGE MERCURY. H. J. Musselman Fairfield. Naomi Myers, . . Gettysburg. J. Henry Raffensberger, Gettysburg. Norman H. Swartz, Gettysburg. Samuel F. Tholan, Merlin. Chas. H. Tilp, Myersdale. Carl Tipton, Gettysburg. Joseph Trimble, Ansoiiia. Geo. H. Watson, Fairfield. Charles Wendt, New York, N. Y. John Wendt New York, N. Y. Annie Wible, Gettysburg. Leland Wilson, Philadelphia. Guy Wisotzki Gettysburg. Samuel K. Yaukey, Fayetteville. Y. M. C. A. NOTES. The College Y. M. C. A. has begun the present school year under the most favorable circumstances. Being the only Christian organization among the students, it naturally expects the support and attendance of all. To make its success in religious work equal to that attained last year will be indeed a grand accomplishment, but why should we not exceed the amount of good done last year, and build up our Association in influence and numerical strength ? The reception to the new students, which took place in Recitation Hall, Friday evening, September 8th, was an exceptionally pleasant affair, and we believe was thoroughly enjoyed by all the persons present, especially by the new men. Short exercises were held in Philo. Hall previous to the serving of refreshments in the large room just below it. Mr. Ibach, '94, opened the exercises with a piano solo. Dr. Martin then led in prayer, after which Dr. Huber filled the place of President McKnight, who was unable to be present, in extending a cordial " Welcome to College." Then fol-lowed a banjo and guitar duet by Mr. Baum, '96, and Mr. Herr, '97. The President of the Association, Mr. C. F. Kloss, '94, then ex-tended a hearty welcome to the Y. M. C. A in a few appropriate words, urging all to great zealousness in the work. These exercises were concluded with a piano solo by Mr. Erb, '95. The effort which was put forth by the Reception Committee and. the old students in general to make the evening one of great enjoyment was well repaid. According to custom, the Biblical hour of the first Sabbath ' was given into the hands of the Y. M. C. A. The meeting was conducted by Rev. L. S. Black, '88, Pastor of the College Church, who addressed the students in Brua Chapel on the three-fold claims of the Chris-tian religion upon the college man. It was just such an address as a college boy needs before he begins the work of a new year, and was listened to with much appreciation by the entire student body. The first regular meeting of the Y. M. C. A. was held on September 14th at 7 p. M., when some considerations were presented " Why the New Men Should Join the Y. M. C. A.," by Mr. C. F. Kloss, Dr. Baugher, and a num-ber of the students. At the close of the meet-ing, some Association business was transacted, quite a number of new members were elected, and Mr. S. C. Burger, '95, was elected to fill the vacancy in the office of Corresponding Secretary. Bible classes are being formed among the students, and all are earnestly requested to identify themselves with the classes in " Bible Study." Many of the lecturers and musical organi-zations which have entertained us in former courses have been so delighted with their kind reception here that they are making ap-plications to the " Lecture Course Committee " for engagements on the coming course. Since the above was written, the Lecture Course Committee has selected its course for next term, which is superior in talent to any which has ever made its appearance before a Gettysburg .audience. The attractions will be "The Temple Quartette," Robert J. Burdette, John Temple Graves, Major Henry C. Dane, and the "John Thomas Concert Company," THE COLLEGE MERCURY. 99 with a possible engagement of " The Lotus Glee Club," or "The Mendelssohn Quintette," about the middle of November. The course will be looked forward to with great interest, and those who have never as yet enjoyed the pleasure of attending such a course will surely not be disappointed in this initial series. Of course everyone will attend. The subjects of the lectures to be delivered will be given in a succeeding number. GENERAL COLLEGE NEWS. The students at Amherst are making a big fight for the abolishing of compulsory chapel. The college senate recently unani-mously adopted a resolution asking the Faculty to abolish compulsory worship. The reso-lutions were vetoed by the president, Prof. Gates.— University Courier. President Schurman, of Cornell, recently made an eloquent address to the Freshman class, calling upon them to produce a crew that would be a credit to Cornell. Would that there were more professors in the college world like President Schurman, who can rec-ognize the value of student life to the Uni-versity he represents, and who lives among his students, not above them.— University Courier. The University of Chicago has the largest library of any American college; it contains over 225,000 volumes. Yale has 200,000 vol-umes, and Columbia, third in size, has 140,000. —Excliangc. Harvard has graduated fourteen Cabinet officers.—Red and Blue. A young colored lady took the first prize for the best entrance examination to Chicago University.—The College Forum. This year, Johns Hopkins, for the first time in-its history, conferred the degree of Ph. D. upon a woman. Miss Florence Bascom is the one thus honored.—Bates Student. As this is the time when many of the pre-paratory students are discussing the question as to whether or not it will pay them to join a literary society in college, the following from Hesperian will be of interest: " Every student intending to pursue a col-lege course should by all means join a literary society. It is in the literary work of these organizations that we put into use the learning acquired by the study of the class-room. One of the most important characteristics of an educated and refined personage should be ab-solute ease and grace of manner—the ability to impart the brilliancy of intellect to others in a fascinating, yet unaffected manner. The prac-tice afforded by society work is certainly a great help in the acquisition of ' address, man, address.' "—The Occident. A court has been established at Princeton, composed of under-graduates, to try men ac-cused of dishonorable conduct in examinations. The court was given power to impose penalties according to the nature of the offense.— Uni-versity News. Dartmouth is considering various plans of student self-government. The plan recently instituted at Cornell will probably be adopted with some slight modifications.—The Occi-dent. This year Tuft's College adds a course for the degree of A. B., which will substitute mod-ern languages for Latin and Greek.—Bates Student. The students in Iowa College have sub-scribed over $10,000 for a Y. M. C. A. build-ing.— Bates Student. The plan of college government at Wes-leyan, in which the under-graduates are ad-mitted to a share, has been definitely framed by the Faculty. Four Seniors, three Juniors, two Sophomores, and one Freshman will be associated with not more than five members of the Faculty.—Bates Student. IOO THE COLLEGE MERCURY. ALUMNI. FRANK E. FICKINGER, Editor. THE amount of matter in this department is unavoidably small for this issue, for which the editor makes due apology. It is not our purpose to slight our Alumni in any particular, and we promise, that in the future this department shall be given as much prominence as in the past. All communica-tions are thankfully received and greatly appreciated. '39. During the summer we noticed an ac-count of the tragic death of Rev. Philip Wil-lard, who was struck by a railroad train, near his home, at Mexico, Pa., along with his little grandson Allen, both of whom died within a few hours after the sad catastrophe. Father Willard was for many years at the head of the Tressler Orphans' Home, at Loysville, Pa., and his memory will ever be most fondly cherished by not a few of our Alumni. '42. Rev. Henry Baker, D. D., celebrated his golden wedding, in the First Lutheran Church of Altoona, Pa., on August 25th, 1893, of which church Rev. Baker was pastor for thirty years. '42. Grace Lutheran Church, of Round-town, York County, Pa., Rev. M. J. Alleman, D. D., pastor, was dedicated on Sunday, September 10th. Services were held all day, and the pastors of York assisted the pastor in the feast of dedication. The church is only a few miles from York. '53. Rev. Peter Bergstresser, D. D., has ac-cepted a call to Rockwood, Somerset County, Pa. He is already on the ground. '57. The Elmira, N. Y., Gazette and Freie Presse, of September 5th, contains a very full sketch of the life of Prof. H. L. Baugher, D.D. '57. Hagerstown Female Seminary, Rev. C. L. Keedy, M. D., principal, has had, since [853, about 5,000 students in attendance from all over the country. The total number of graduates is 318. This next year it will have a faculty of 18. '63. Dr. G. U. Wenner will complete the 25 th anniversary of his entrance into the min-istry, in November next, and, at the same time, Christ Lutheran Church, of which he is the honored pastor, will celebrate the 25th an-niversary of its founding. '65. Rev. J. W. Henderson was installed as pastor of the First Lutheran Church, of Phil-lipsburg, Pa., on Sunday, August 27th. The charge to the pastor was delivered by Rev. E. E. Hoshour, of Bellefonte, Pa., and the charge to the people by Rev. Chas. B. Gruver, '73, of Lock Haven, Pa. '70. The Rev. G. F. Behringer has declined the Professorship of Dogmatic Theology in the German Theological Seminary, at Chicago, to which he was elected by the Board some time ago. '70. Rev. S. A. Ziegenfuss, A. M., of Ger-mantown, Pa., delivered the opening address to the students of Muhlenberg College, Allen-town, Pa., on September 7th. '70. Rev. J. T. Gladhill, of Jersey Shore, Pa., spent a few days of the past week in town, visiting friends and relatives, leaving on the 21st inst. '71. At a meeting of the Board of Managers of the Pennsylvania Chautauqua, held in Har-risburg, Pa., September 4th, Rev. Dr. William H. Dunbar was elected a member of the Ex-ecutive Committee. '72. Rev. W. A. Trostle has resigned the Boalsburg, Pa., pastorate and will leave there October 1st. '72. Rev. W. E. Fischer left his charge at Centre Hall, Pa., September 14th, and has gone to Shamokin, Pa. '72. The address of Rev. Sylvanus Stall, editor of the Lntlicran Observer, is changed from 2127 Gratz to 1468 North Fifty-fifth Street, Philadelphia. '74. Rev. F. W. Staley, pastor of St. Peter's Lutheran Church, Middletown, Pa., is on a visit to the World's Fair. A check to pay his expenses was left at the National Bank at Middletown by three sisters, who. are now in the city of Chicago. This was an unexpected surprise to Mr. Staley, and he appreciates the generous gift with profound gratitude. '74. Rev. W. L. Remsberg, Beatrice, Neb., publishes a neat and attractive parish paper, Trinity Lutheran Quarterly. THE COLLEGE MERCURY. IOI '74. During the summer Rev. J. B. Focht dedicated his new church at Lewistown, Pa. 'jy. Rev. W. L. Seabrook, pastor of Trinity Lutheran Church, Abilene, Kan., was elected President of the Law and Order League of that city, and recently preached two very powerful sermons there on " Shameful Reve-nues." 'yj. Rev. J. J. Young, D. D., late of Rich-mond, Ind., preached his first sermon as pastor of St. John's, New York city, on Sunday, September 3d. '■jy. Prof. G. W. Gross is this year Principal of the York County Academy, in which insti-tution he had formerly held the position of teacher for a number of years. '80. The Independent for August 17th has an excellent article from Rev. C. W. Heisler, of Denver, entitled "A Voice from Denver." '80. Rev. L. B. Wolf sailed for India on September 13th,by the steamship " Majestic," of the White Star Line. He will again en-gage in his missionary labors, his family re-maining here at Gettysburg. '84. A Pittsburgh paper of September 6th contained the item that Rev. H. L. Yarger, of Lawrence, Kan., has been called to Braddock, Pa. '85. Rev. A. S. Fichthorn, at present secre-tary of the Y. M. C. A. at Tyrone, Pa., has declined a pressing call to the Brushton Ave-nue Church, Pittsburgh, Pa. '85. The address of Rev. H. M. Heilman is changed from Barlow, Md., to 214 Second Avenue, Altoona, Pa. '85. We were pleased to see on the campus recently, Rev. E. G. Miller, of Easton, Pa. During his absence from home, we understand, his church has been repaired and the interior handsomely decorated. '85. Rev. E. E. Hoshour's new church at Bellefonte, Pa., was dedicated on September 3d with imposing ceremonies, in which Presi-dent McKnight and Dr. Wolf took part. '86. Rev. J. G. Traver has been elected Prin-cipal of Hartwick Seminary. '87. After a long and continued illness of over eight months, Rev. Cyrus G. Focht died at his home at Centerville, Pa., on Sunday, September 17th. '87. Dr. I. N. Snively was recently elected a Fellow of the American Academy of Medi-cine— quite a distinguished honor—on which we congratulate the doctor heartily. '88. Rev. J. M. Francis, pastor of the Fourth Lutheran Church of Louisville, Ky., has been called to the Lutheran Church of Columbia City, Ind., recently served by Rev. C. H. Rockey. He has accepted the call. '88. Rev. John J. Hill has resigned at West Camp, N. Y., to accept a unanimous call from the English Lutheran Church at Canal Dover, O. He will enter upon his labors there about the middle of October. '89. St. John's Lutheran Church near Bar-tonsville, Pa., Rev. Cyrus E. Held, pastor, was dedicated solemnly to the worship of Almighty God on Sunday, August 6th. The dedicatory sermon was preached from Psalm lxxxiv, 1, by Rev. Charles E. Hay, pastor of St. Mat-thew's Lutheran Church, of Allentown, Pa., and President of the Eastern Conference of the East Pennsylvania Synod. The General Secretary of Church Extension had charge of the finances, and under his management all the debt was provided for, and the church dedicated free of all incumbrances. '89. Rev. W. L. Rutherford has resigned as pastor of St. Mark's Lutheran Church, Steel-ton, Pa., to take effect October 1st. '89. John R. Scott is the Republican nomi-nee of Adams County for the office of District Attorney. '90. Rev. H. C. Bixler, the new pastor at Manchester, has taken unto himself a good Lutheran helpmeet. We offer congratulations and best wishes. '90. Mr. Charles Foger, of Harrisburg, Pa., has been chosen professor of chemistry in the High School of that city. '90. The new pastor of Trinity charge, Rev. Fred. Geesey, has entered the field and is busily at work. At Stoverstown, he has started a class of over thirty catechumens. - He has moved his family to Spring Grove. 102 THE COLLEGE MERCURY. '90. The Pittsburgh Commercial Gazette of Monday, August 28th, gives an excellent ab-stract of a sermon by Rev. S. T. Nicholas, on " Christian Contentment." '90. Rev. G. H. Reen, late of the Seminary at Gettysburg, Pa., has begun his work as pastor of St. Luke's, Mansfield, O. '90. Rev. H. C. Reller, a recent graduate of Gettysburg Seminary, has accepted a call to the Lutheran church at Freeport, Pa., and en-tered upon his duties there the first Sunday of September. '90. Rev. W. J. Wagner, of Center Hall, Pa., a member of the last Senior Class in the Gettysburg Seminary, has been engaged to supply the Center Hall charge until a pastor shall be secured. '90. Mr. S. B. Martin left on the 25th of September for Yale, where he will enter the present Senior Class. Mr. Martin graduated last June from the Yale Law School, receiving the degree of Master of Laws. '90. Geo. W. Rowe is teaching in the High School at Muncy, Pa. '91. Mr. Wm. Hersh, of this city, after hav-ing recently passed a very creditable final ex-amination, was admitted to practice in the courts of Adams County. '91. J. Bradley Markward, of the Seminary, supplied the pulpit of Rev. W. E. Stahler, '80, at Shippensburg, Pa., during the vacation of the latter this summer. '91. Mr. A. C. Stup, who has been working up a new mission at Riverside, Cal, during the summer, arrived at his home in Frederick, Md., ' on 22d of September, and will soon resume his ' duties in the Seminary here. '92. Rev. F. D. Hesse visited Taneytown, on September 3d, and preached twice for Rev. McSherry, soliciting funds for the new church which is in process of erection at Brunswick, Md., quite a sum being realized. '92. Mr. E. O. Keen has entered the Ger-man Reformed Seminary at Lancaster, Pa. '93. A majority of the members of the class of '93 have returned to the Seminary. Of those who have not, we have been able, in part, to learn the whereabouts. Mr. Bortner is clerking in his father-in-law's store, at York, Pa.; N. L. J.Gron, W. J. Gies, J. F. Kempfer, and R. R. Miller enter Yale; H. E. Gettier, F. G Turner, and F. S. Hedges enter Johns Hopkins University; and A. S. Hain is Assist-ant Professor of German in Hartwick Semi-nary. FHATE-R/NITy 7NOTES. PAUL W. ROLLER, Editor. PHI KAPPA PSI. We are glad to welcome back Bro. R. E. Miller, '94. Bro. Reitzell, '94, was not able to return to college on account of sickness. Bro. Russell, '95, has left college to engage in business with his father. Bro. S. Duncan, '91, is engaged in post-graduate work at Harvard. Bro. R. R. Miller, '93, is continuing his studies at Yale. Bro. G. Frank Turner, '93, is pursuing a post-graduate course at Johns Hopkins. Bro. E. S. Duncan, '82, is the Democratic nominee for district attorney of Adams County. PHI GAMMA DELTA. Bro. S. B. Martin,'90, is spending a'few days at home. He will return to Yale at the opening of the session, and enter the Senior Class. Bro. Miller, '83, is visiting his father-in-law, Dr. Valentine. Bros. Anstadt,'90, Knubel, and Neudewitz, '93, have entered the Seminary; Bros. Fair, '94, Madara, and Hoffman, '95, failed to return at the opening of the session. Bro. Fair is teaching at Altoona. Bro. Madara will enter the Medical Department of the Uni-versity of Pennsylvania. Bro. Hoffman will enter Yale. Bros. Shaar and Hoffer represented the local THE COLLEGE MERCURY. 103 chapter at the Phi Gamma Delta banquet at the World's Fair. The fraternity enjoyed the exclusive right of the New York State build-ing for the evening. PHI DELTA THETA. Bro. A. S. Cook, '95, who enters Princeton this year, spent a few days among his friends at the college, at the opening of the college year. Bro. G. H. Eckels, '95, was initiated into the mystic order, September 16th. Bro. Ehrhart, '93, is engaged in the whole-sale grocery business at Hanover. Bro. Brallier, '93, is principal of the Berlin Public Schools. Bro. Lantz, '94, won the Junior oratorical prize, contested for during Commencement week. Bro. Van Camp, '94, received the Hassler Latin medal for the best scholarship in Latin. Bros. Maynard and Eckels, '95, are on the editorial staff of the Spectrum. Bro. Gettierj '93, will enter Johns Hopkins for the purpose of pursuing a course in medi-cine. Bro. J. K. Cook preached in the Methodist Church of this place, September 10th. Bro. Forney, '96, was initiated September 23d. Bro. Peffer, of Allegheny, made our chap-ter a very pleasant visit September 16th. Bro. Hoick, of the Seminary, has been sup-plying St. Paul's Lutheran Church, Asheville, N. C, during the summer. ALPHA TAU OMEGA. Alpha Upsilon begins the new year with 11 brothers. Bro. Bortner, '93, is engaged in business in York, Pa. Bro. Vastine, '93, is teller in the Catawissa National Bank, Catawissa, Pa. Bro. Hipsley, '93, is engaged in business in Baltimore, Md. Bro. Joe S. Hay, '95, enters the Medical Department of the University of Pennsylvania. Bro. Ammon, '93, is studying law in York, Pa. Bro. White Hutton, '97, was initiated June 22d of last term. Alpha Upsilon made an addition to the fur-niture of their hall in the shape of a pool and billiard table. ATHLETICS. HENRY E. CLARE, Editor. THOSE interested in athletics can certainly feel gratified by the promising prospects for the coming season. Probably no collegiate year in the history of the college has opened so auspiciously as the present. Enthusiasm sways the boys ; and the one absorbing topic is foot-ball. The new men are interested as well as the old. All await with eager expec-tations the coming games as tests of the mate-rial in hand, hoping, and with much confidence, that they will rather raise the interest to a higher pitch than lower it. From present in-dications, we feel that the confidence has not been misplaced, but that the coming season will add fresh laurels to those already won by former teams. The new men have furnished much promis-ing material for the team, and by it the vacant places are being creditably filled. Under the able direction of Manager Kloss, quite a number of games have been arranged, some of which promise to be more than ordi-narily interesting. Below is a list of scheduled games together with some probable ones : September 30th, at Ithaca, N. Y., CORNELL UNIVERSITY VS. GETTYSBURG COLLEGE. 104 THE COLLEGE MERCURY. October 4th, at Philadelphia, Pa. UNIVERSITY OF PENNSYLVANIA VS. GETTYSBURG COLLEGE. October nth,at Carlisle, Pa. DICKINSON COLLEGE VS. GETTYSBURG COLLEGE. ((ctober 141I1, at Getiysburg, Pa. FRANKLIN AND MARSHALL COLLEGE VS. GETTYSBURG COLLEGE. October 21st, at Lewisburg, Pa. BUCKNELL VS. GETTYSBURG COLLEGE. October 28th, at Harrisburg, Pa. WASHINGTON AND JEFFERSON VS. GETTYSBURG COLLEGE. November 4th, at Gettysburg, Pa. DICKINSON COLLEGE VS. GETTYSBURG COLLEGE. The probable games are Haverford, Swarth-more, a second game with Franklin and Mar-shall College, and Baltimore City College on Thanksgiving. In view of these approaching games the team is getting into trim by daily practice and training-table diet, the practice offered by the scrub teams becoming at times very formidable. A second team will be organized in the course of a few days. Considering the material from which choice is to be made, it is likely that a very good team will be selected. An effort will be made to arrange games with distant teams. The Gettysburg base-ball team, wishing to try its luck against a college nine, made its wish known, and was gratified. The regular college team having disbanded, a team was made up, consisting of four old players and five new ones. . The game was played on September 16th, resulting in a victory for the college by a score of 7 to 1. The game was a very interesting one, and many fine plays were made by both teams. The fielding was exceptionally strong. Judging from the dis-play of skill by the new men in this game, we look forward to an excellent team next year. The college can boast of four or five good pitchers and much other good material. At a recent meeting of the Athletic Asso-ciation, Messrs. Roller, Keefer, Moser, and Aukerman were placed on the Board of Con-trol. ■ At the same meeting it was decided to pro-cure the services of a " coach " for the foot-ball team, but at present such services arc very ably performed by Mr. Harry Buehler, of Gettysburg, and Mr. Gehrhart, an ex- Lehigh man. Under their directions, the team is learning a little more of the science of foot-ball. As we go to print one of the Athletic Asso-ciation officers informs us that a large number of names will be proposed for membership at the next meeting. It is gratifying to notice this evidence of interest on the part of the new men, and it is to be hoped that the old students ■who have not as yet identified themselves with the Athletic Association will follow their ex-ample. If we are to make any great headway, every one must co-operate with the Athletic Association. With such glorious prospects for good work, it is anything but pleasing to report that not a cent has been added to the athletic field fund. It was earnestly hoped that the means proposed last spring for raising funds would be successful, but it appears that no attempt has been made. This is the pressing need at present, and, if any friend of the insti-tution wishes to make his.name illustrious, let him remember us in our need and do the deed of beneficence. TOWN A/NTD S EMI /N TVRLj. ROSCOE C. WRIGHT, Editor. c TOWN. OL. OWEN, of the Quartermaster-Gen-eral's Department, was in town about the middle of the month completing arrange-ments for marking the forty regular commands. An iron tablet will be erected at the location of each, and when Congress appropriates sufficient funds these iron tablets will be re- THE COLLEGE MERCURY. 105 [placed by monuments. A cannon will be placed at each of the twenty-five battery posi-tions, and granite posts will be erected at the [corner of each lot. The dedication of the Minnesota monument has been postponed until July of next year, in order to secure a sufficient appropriation for the transportation of veterans. Duvall's Federal Cavalry, attached to the Purnell Legion of Maryland, held its Fourth Annual Reunion at the Washington House, September 16th. One hundred and twenty-five veterans of the Thirteenth New Jersey Infantry arrived here on the i8th, on a special train. A camp-fire was held in the court-house, at which a number of speeches were made. The Gettysburg Land Improvement Com-pany has laid out two streets at the foot of Seminary Ridge. One of these is called Hay Street, after the late Dr. C. A. Hay. Mrs. Sarah R. Hay, widow of the late Dr. Chas. A. Hay, has moved from Gettysburg to Harrisburg, to reside with her son, Dr. John W. Hay. SEMINARY. Dr. Wolf delivered the address at the lay-ing of the corner-stone of the St. James Luth-eran Chapel, at Frederick, Md., September 17th. Dr. Richard supplied the pulpit of Dr. A. W. Lilly; of York, on Sunday, September 17th. Drs. McKnight and Valentine preached at the dedication of the Lutheran Church at McSherrystown, September 24th. At the Religious Congress, held in Chicago September 13th, Dr. Valentine read a paper on " The Harmonies and Distinctions in the Theistic Teachings of the Various Historic Faiths." He was introduced as the distin-guished professor in the great Church of the Reformation—the Lutheran Church. He compared the universal beliefs in a God, and gave the monotheistic conception of a God, the conception of a divine personality, the cre-ative idea, the ethical conception, and the re-demptive view. The Chicago Inter-Ocean de-voted considerable space to his paper, which it considered an able and scholarly address. Rev. Prof. Richard has been appointed cura-tor of the Historical Society. The Seminary opened • Tuesday, the 19th. Dr. Valentine presided at the opening service. Dr. Wolf delivered an address upon " The Encouragements for Young Men to Study for the Lutheran Ministry." In the afternoon of the same day, Dr. Billheimer was installed Professor of Hebrew and Old Testament Exe-gesis. Rev. Boyer, President of the Board of Directors, presided, and delivered the installa-tion address. There are in the Seminary 23 Seniors, 25 Middlers, and 25 Juniors. LITE-R7VRy SOCIETIES. WALDO D. MAYNARD, Editor. THE interest shown in the societies at the opening of the term was very marked; . may it continue throughout the year. Let the enthusiasm be kept up, for there is no depart-ment which affords a better opportunity for practical work. The work performed in the societies and the debating clubs develops self-reliance in the student, and one who does his work faithfully is preparing himself for more usefulness than he would be able to render to the world without such a training. How often we find well-educated men who are unable to make a speech ! Why ? Simply because they have never been trained in this especial line, and consequently do not make as useful citizens as some who have accustomed them-selves to public speaking in their early training. In view of the great importance of the work done in the literary societies, we would urge every new man to become a member of one of the societies, and join early in the term, just as io6 THE COLLEGE MERCURY. soon as he has determined from which of the two societies he may be able to derive the most benefit. It would seem to be needless to remind the older members to invite others to come to the meeting, yet we were informed that last year there were good men who were never asked to join a society. Possibly this may have been an oversight, but it shows that we might be more active in our society work. We would not only advise the new men to connect themselves with a literary society, but also to join one of the debating clubs, since they afford an opportunity for one to do better work in the societies themselves. Following a long-established custom, the Adams County Teachers' Institute has pre-pared a series of evening entertainments to be given in connection with the Institute held in Gettysburg during Thanksgiving week. The enterprise of those in charge in affording us such a literary treat is to be commended. All of the speakers are known outside of our own State, many of them being even of national repute. The lecture of Will Carleton will be beyond doubt the main attraction of the series, and many will avail themselves of this rare opportunity of hearing one of America's widely read and highly appreciated poets. The following is a complete list of speakers : Monday Evening, . Tuesday Evening, . Wednesday Evening Thursday Evening, . Friday Evening, . . DR. L. B. SrERRY. WILL CARLETON. THEO. F. CLARK. . MRS. H. E. MONROE. I.OVETT'S BOSTON STARS. The music for the week will be furnished by the musical organizations of the college, which expect to be in good working order by that time and ready for anything along their line. PHRENA. NOTES. A very interesting programme was rendered on the evening of September 15th, consisting of instructive and entertaining essays upon im-portant subjects of the day. Phrena. intends having a series of meetings to be known as historical evenings, when his-torical subjects of importance and interest will be taken up. The first subject to be considered is the " American Revolution," October 6th. The society hopes by this course to awaken an interest in an important topic which is often considered dull and uninteresting. The following are the officers of the society: President, Barndt; Vice-President, Hartman; Recording Secretary, Jones ; Corresponding Secretary, Spayde; Librarian, Maynard; As-sistant Librarian, Brubaker; Treasurer, Miller; Monitor, Wright. The following have been elected members of the society: Hollinger, Bell,'95 ; Wolf, '97, and Duck, '97. Mr. Hartman, '95, has been elected one of the editors of THE MERCURY in the place of Cook, '95, who goes to Princeton. The following have been elected officers of I Phrena. Debating Club: President, Miller; Vice-President, Moser; Secretary, Spayde; Treasurer, Diehl. PHILO. NOTES. The society gave an exceedingly interesting literary and musical treat at its first meeting of the term. The society for the present will continue its series of" Authors' evenings," which have been found to be so interesting and profitable. American authors only will be considered during this term, the first one to be discussed is Bryant; The following have been elected members of the society: Mohn, '95; Heindel, '96; Swartz, '96 ; Olewine, '97 ; McCartney, '97; Culp, '97; Englar, '97; Sigafoos, '94, and Fassold, '95. Philo. Debating Club has organized with the following officers : President, Brosius ; Vice- President, Byers ; Treasurer, Loudon ; Secre-tary, Crilly ; Critic, Manifold. ADVERTISEMENTS. Wanamaker's. Sporting goods of every sort. Sporting wear of every sort—Goats, Trousers, Caps and such a gathering of Shoes for every indoor or outdoor game :n as was never before seen in America, And Wanamaker prices—as low as anybody's, very likely lower than any-where else. ATALANTA was the swiftest girl of antiquity. The myth has come true to-day in a Wheel. Our ATALANTA is a Bicycle as fast, as strong, as simple as any on the market; faster, stronger, simpler, safer, better than most of the " first-class" machines. And lighter—weight 30^ lbs. But the best part is the price—$120 for a bang-up $150 Bicycle ! JOHN WANAMAKER. SEND FOR CATALOGUE OF - FOR - yOUfSG ^T5S> NEAR. BALTIMORE, lylD. This widely known, thoroughly equipped, and extensively patronized School will open its 41st Annual Sesson, Sept. 13th, 1893. PROFESSIONAL CARDS. All the Departments of a High Grade Seminary. CtfA*?IiES S. DU^CA]*, '82, ATTORNEY AND COUNSELLOR-AT-LAW, Baltimore Street, GETTYSBURG, PA. CHAS. E. STRH^E, '87, ATTORNEY-AT-LAW, Biiltimoi-e Street, GETTYSBURG, PA. DR. CHAS, B. STOUFFER, OFFICE, STAR AND SENTINEL BUILDING, GETTYSBURG. PA. \ , fiber's Dr^ Store, Baltimore Street, GETTYSBURG, PA. Prescriptions Carefully Compounded. ISatest Stylcs i*l Hats, Shoes, AND Gents' furnishings, R. M. ELLIOTTS. N. B.—Stiff Hats made to Fit the Head in two minutes. A; D. BUEHLER&CO., Headquarters for Bs©Ks a^d Brags, Stationery and Blank Books. Address, Rev. J. H. TURNER, A. M., Principal, LUTHERVILLE, MD. LOWEST CASH PRICES. VI ADVERTISEMENTS. DECKER BROTHERS' PIANOS. Absolute Evenness of Touch, Richness and Brilliancy of Tone, Extraordinary Singing Quality, Unequaled Workmanship, Power of Standing in Tune longer than any other Piano made, are among the characteristic qualities of DECKER BROS. PIANOS, 33 Union Square, Jieixx York. Used in Philo. Hall at Gettysburg College. GO TO C.A.BLOCHER'S Jecueli*y Stove fot» Souvenir * Spoons, ^ Sword * PTVins, &c. ReparWng a specraTty. DEEKA Fine Stationery and Engraving House, 1121 Chestnut St., Philadelphia. COLLEGE INVITATIONS CLASS STATIONERY SOCIETY STATIONERY PROGRAMMES, BADGES WEDDING INVITATIONS VISITING CARDS BANQUET MENUS DIPLOMAS AND MEDALS Post Office Conor, Centre Square. STEEL PLATE ENGRAVING FOR FRATERNITIES, CLASSES AND COLLEGE ANNUALS. All work is executed in the establishment under the personal supervis-ion of Mr. Dreka, and only in the best manner, Unequaled facilities and long practical experience enable us to produce the newest styles and most artistic effects, while our reputation is a guarantee of the quality of the productions of this house. ADVERTISEMENTS. VII R. H. REININGER, Merchant * Tailor. )K ^ X X THE BEST WORK AT THE LOWEST PRICES. Suits from $12.00 to $40.00. Pants from $4.00 to $12.00. NEXT DOOR TO POST OFFICE, UP-STAIRS. CENTRAL SQUARE. PETE THORNE, Shaving $ Hair Cutting Parlors. FI-RST CLASS 7VRTISTS. CENTRAL SQUARE. FLEMMING & TROXEL, Billiard AND Pool 'Rooms. BALTIMORE STREET. RJVIOS ECKE^T, DEALER IN Hats, Shirts, Shoes, Ties, Umbrellas, Gloves, Satchels, Hose, Pocket Books, Trunks, Telescopes, Rubbers, Etc., Etc. AMOS ECKERT. SPECIAL! TO STUDENTS. Fine Tailoring. JOSEPH JACOBS, Merchant Tailor, Chambersburg Street, (Mow Eagle Hotel) GETTYSBURG, PA. Red Front Cigar Store R. H. RUPP, Proprietor. |4o. 8 fialtimore St., Gettysburg. The place for a fine Cigar or a good chew. Solid Havana filler, 5 for 25c. An elegant article. A FINE ASSORTMENT OF PIPES AND SMOKING MIXTURES. ^■■■^■■■^■■■B V1I1 ADVERTISEMENTS. ESTABLISHED 1876. PE/N-ROSE MgE-RS, JEWELER. Ltapge Stock of LUatches, Clocks, Jeuiclfy, etc., on Hand. That Man is Out GETTYSBURG SOUVENIR SPOONS. COLLEGE SOUVENIR SPOONS. 10 BALTIMORE STREET, GETTYSBURG, PA. Students' Headquarters IS AT J. R. STINE S, SON'S CLOTHING STORE The Cheapest Clothing and Gents' Furnishings in Gettysburg. WHO BUYS HIS BASE BALL, . BICYCLE, . . LAWN TENNIS ^2^ <-^ OUTING, YACHTING AND BOATING ELSEWHERE SUPPLIES, . THAN AT . A. Q. SPALDING & BROS. CHICAOO, NEW YORK, PHILADELPHIA, TO8 Madison St. 243 Broadway, 1032 Chestnut St. MERCHANT TAILORING A SPECIALTY. COME AND SEE US. J. R. STINE & SON, THE LEADING CLOTHIERS, MAIN STREET, GETTYSBURG, PA. DnTTLETIELD LlVEKT. Rear of Washington House, Opposite W. M. R. R. Depot. GETTYSBURG, PA. m^r. All Kinds of Teams. Good Riding Horses. -:o:- The Battlefield a Specialty, With First-Class Guides. DAVID McCLEARY, Prop.

Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.

Daniel Levine on Hidden Hands, Vocation and Sustainable Critique in International Relations











Daniel Levine is part of a new generation
of IR scholars that takes a more pluralist approach to addressing the hard and
important questions generated by international politics. While many of those
interviewed here display a fairly consistent commitment to a certain position
within what is often referred to as 'the debate' in IR, Levine straddles the boundaries
of a diverse range of positions and understandings. Time to ask for
elaboration.














Print version of this Talk (pdf)




What is, according
to you, the biggest challenge / principal debate in current IR? What is your
position or answer to this challenge / in this debate?






The
question I'd like us to be asking more clearly than we are is, 'are we a
vocation and, if so, what kind of vocation are we'? This points to a varied set
of questions that we, as scholars, gesture to but spend relatively little
theoretical time developing or unpacking. There's an assumption that the
knowledge we produce is supposed to be put good for something, practical in
light of some praiseworthy purpose. Even theorists who perceive themselves to
be epistemologically value-free hope, I think, at least on an intuitive level, that
some practical good will emerge from what they do. They hope that they are doing
'good work' in the sense that some Christians use this term. But, there is not
really a sustained project of thinking through how those works work: how our notions of vocation might
be different or even mutually exclusive, and how the differences in our notions
of vocation might be bound up in non-obvious ways to our epistemological,
methodological, and theoretical choices.







Moreover,
except for a few very important and quite heroic (and minoritarian) efforts, we
don't really have a way to think systematically about the structure of the
profession: how it influences or intervenes or otherwise acts on particular
ideas as they percolate through it, and how those ideas get 'taken up' into
policy. Brian Schmidt has
done work like that, so has Inanna Hamati-Ataya,
Ole Waever, Ido Oren,
Oded Löwenheim, Elizabeth Dauphinee, Naeem Inayatullah,
and Piki Ish-Shalom; and it's good work, but
they are doing what they are doing with limited resources, and I think without due
appreciation from a big chunk of the field as to why that work is important and
what it means.







When
I started writing Recovering
International Relations, I had wanted to recover the 'view from nowhere'
that many social scientists idealize. You know, that methodological conceit
where we imagine we are standing on Mars, watching the earth through a
telescope, or we're Archimedes standing outside of the world, leveraging it
with distance and dispassion. I had worked on the Israeli-Palestinian conflict
for a long time, was living in Tel Aviv, working for a think tank, and was—am—an
Israeli citizen and an American citizen. I had this somewhat shocking discovery
right after the Second Intifada broke
out. Most of my senior colleagues were deploying their expertise in what seemed
to me to be a very tendentious way: to show why the second Intifada was Yassar
Arafat's fault or the Palestinian Authority's fault—or, in a few cases, the
Israelis' fault. There were some very simplistic political agendas that were
driving this research. People were watching the evening news, coming into work
the next morning, and then running Ehud Yaari's commentary through their respective fact-values-methods mill. Or if they were
well-connected, they were talking to their friends on the 'inside', and doing
the same thing.







It
was hard to admit this for a long time, but I was very naïve. I found that very
unsettling and quite disillusioning. That's why the view from nowhere was so
appealing. I wanted to be able to talk about
Israel and Palestine without taking a position on Israel and Palestine—but without eschewing the expertise I had
acquired along the way, in part because I was
a party to this conflict, and cared about its outcome. I was young,
inexperienced, and slightly arrogant to boot—neither yet a scholar, nor an 'expert,'
nor really aware of the game I was playing. So my objections were not well
received, nor did I pose them especially coherently. To their credit, my senior
colleagues did recognize something worthwhile in my diatribes, and they did
their best to help me get into graduate school.







As the
project developed, and as I started engaging with my mentors in grad school, it
appeared that the view from nowhere was essentially impossible to recover. With
Hegel and with the poststructuralists, we can't really think from nowhere; the
idea of it is this kind of intellectual optical illusion, as though thinking
simply happens, without a mind that is conditioned by being in the world. Therefore,
there needs to be a process by which we give account of ourselves.







There
are a variety of different ways to consider how one might do that. There's what
we might call the agentic approach, in which we think through the structure of
thought itself: its limitations, our dependence on a certain image of thinking
notwithstanding those limits—thought's work on us, on our minds. This is closest
to what I do, drawing on Adorno and Kant, and Adorno's account of how concepts
work in the mind; how they pull us away from the things we mean to understand
even as they give us the words to understand them. And drawing on Jane Bennett, William Connolly,
Hannah Arendt, Cornel West, JoanTronto, and JudithButler to think through how one
conditions oneself to accept those limitations from a space of love, humility
and service. Patrick Jackson's (TheoryTalk #44) Conduct of Research in IR is quite
similar to this approach; and so is Colin Wight's Agents, Structures and International
Relations; though they use more philosophy of science than I do.







One
could also do this more 'structurally.' One could say 'this is how the academy
works and this is how the academy interconnects with the larger political
community' and then try to trace out those links: I mentioned Hamati-Ataya,
Oren, and Ish-Shalom, or you could think of Isaac Kamola,
Helen Kinsella, or
Srdjan Vucetic.








Any of
those approaches—or really, some admixture of them—would be pieces of that
project. I would like us to be doing more of that—alongside, not instead of,
all the other things we are already doing, from historical institutionalism to formal
modeling, to large-N and quantitative approaches, and normative, feminist and
critical ones. I would like such self-accounting to be one of the things
scholars do, that they take it as seriously as they take methods, epistemology,
data, etc. Driving that claim home in our field, as it's presently constituted,
is our biggest challenge.






How did you arrive at where you currently are in IR?






I'm 42,
so the Cold War was a big deal. I'm American-born, and I was raised in a pretty
typical suburb. John Stewart from the Daily
Show is probably the most famous product of my hometown, though I didn't
know him. My view of history was a liberal and progressive in the Michael
Waltzer/Ulrich Beck/Anthony Giddens, vein, but I was definitely influenced by
the global circumstances of the time, and by the 'End of History' discourse
that was in the air. I thought that the US was a force of good in the world. I
was a nice Jewish boy from New Jersey. I really wanted to live in Israel for
personal reasons, and the moral challenge of living in Israel after the
Intifada seemed to go away with the peace process. So, it seemed to me that it
was a kind of golden moment: you could 'render unto Caesar what was due to Caesar',
and do the same for the Lord. I could actually be a Jewish-Israeli national and
also a political progressive. (That phrase is, of course, drawn from the Gospels,
and that may give you some sense of how my stated religious affiliations might
have differed from the conceptual and theological structures upon which they actually
rested—score one for the necessity of reflexivity. But in any case, those
events were important.)







I moved
to Israel when I was 22 and was drafted into the military after I took
citizenship there. In the IDF, I was a low-level functionary/general laborer—a
'jobnik', someone who probably produces less in utility than they consume in
rations. Our job was to provide support for the combatants that patrolled a
certain chunk of the West Bank near Nablus—Shechem, as we called it, after the
biblical name. I was not a particularly distinguished soldier. But we were cogs
in a very large military occupation, and being inside a machine like that, you
can see how the gears and pieces of it meshed together, and I started taking
notice of this. Sometimes I'd help keep the diary in the operations room. You
saw how it all worked, or didn't work; or rather, for whom it worked and for
whom it didn't. All that was very sobering and quite fascinating.







I once
attended a lecture given by the African politics scholar Scott Straus, and he
said the thing about being present right after genocide is that you come across
these pits full of dead bodies. It's really shocking and horrific—there they
are, just as plain as day. Nothing I saw in the sheer level of violence compares
to that in any way—I should stress this. But that sense of it all just being out there, as plain as day, and being
shocked by this—that resonated with me. Everyone who cared to look could
understand how the occupation worked, or at least how chunks of it worked. So I
would say in terms of events, those things were the big pieces that structured
my thinking.







Here's two
anecdotal examples. Since I was a grade of soldier with very limited skills, I
was on guard duty a lot. We had a radio. I could hear the Prime Minister on the
radio saying we are going to strike so-and-so in response to an attack on such-and-such,
and then I could see helicopters pass overhead to Nablus, and then I could see
smoke. Then I could see soldiers come back from going out to do whatever it was
the helicopter had provided air support for. I'd see ambulances with red
crescents or red Stars of David rush down the main road. It began to occur to
me that there was a certain economy of violence in speech and performance. I
didn't think about it in specifically theoretical terms before I went back to
graduate school, but Israelis had been killed, political outrage had been
generated. There was a kind of affective deficit in Israeli politics that
demanded a response, and some amount of suffering had to be returned—so the
government could say it was doing its job. I found this very depressing. My odd
way of experiencing this—neither fully inside nor outside—is certainly not the
most important or authentic, and I'm not trying to set myself up as an expert
on this basis. I'm only trying to account for how it made me think at the time
and how that shows up in what and how I write now.







Later,
when I was in the reserves, I was in the same unit with the same guys every
year. One year, we were lacing our boots and getting our equipment for our
three weeks of duty in a sector of the West Bank near Hebron, I think it was. I
remember one guy, one of the more hawkish guys, said 'we'll show 'em this time,
we'll show them what's what'. Three weeks later, that same guy said 'Jeez, it's
like we're like a thorn in their backside; no wonder they hate us so much.' (He
actually used some colorful imagery that I can't share with you.) I remember
thinking, 'well, ok, he'll go home and he'll tell his family and his friends;
some good will come of this.' The next year, I saw the same guy saying the same
thing at the start, 'we'll show those SOBs.' And then three weeks later, 'oh my
God, this is so pointless, no wonder they hate us…' So after a few years of
this I finally said to him, 'tagid, ma
yihiyeh itcha?'—Like, dude, what's your deal? 'We've had this conversation every year! What happens to you in
the 48 weeks that you're not here that you forget this?' And I think he looked
at me like, 'what are you talking about?'







I
thought about that afterwards: we have these moments of experience when we're
out of our everyday environment and discourse, the diet of news and fear, PR
and political nonsense—that's when these insights become possible. So, when
this guy comes in and says 'ok, we'll get those SOBs,' he's carrying with him this
discourse that he has from home, from the news and TV, from his 'parliament'
with his friends where they get together and talk about politics and war and
economics and whatever else—and then a few weeks of occupation duty disrupts
all that, makes him see it in a different light, and he has these kinds of
fugitive experiences which give him a weirdly acute critical insight. Suddenly,
he's this mini-Foucault.







In a
few weeks, though, he goes back to his life, there's no space or niche into
which that uncomfortable, fugitive insight can really grow, so it just sort of
disappears or withers on the vine, its power is dissipated. This is a very
real, direct experience of violence and it's covered over by all of this
jibber-jabber. So there's a moment where you start to wonder: what exactly
happens there? What happens in those 48 weeks? What happens to me during those weeks? You can see how a
kind of ongoing critical self-interrogation would evolve out of that. Again,
none of those things are exactly what my book's about, but it gives you a sense
of how you might find Adorno's kind of critical relentlessness and negativity vital
and important and really useful and necessary. You can see how that might
inform my thinking.







In
terms of books, as an undergraduate, I had read, not very attentively, Said and
Foucault, and all of the stuff at the University of Chicago we had to take in
what they called the 'Scosh Sequence,' from sociologists like Elijah Anderson
and William Julius Wilson to Charles Lindblom and Mancur Olsen: texts from the
positive and the interpretive to the post-structural. I had courses with some
very smart Israeli and Palestinian profs—Ephraim Yaar, Salim Tamari, Ariela
Finkelstein. And of course Rashid Khalidi was there at that time. Once I was in
the military, the Foucault and Said suddenly started popping around in my head.
Suddenly, this sort of lived experience of being on guard duty made the
Panopticon and the notion of discipline go from being a rather complicated,
obscure concept to something concrete. 'Oh! That's
what discipline is!'







When I
went back to graduate school, I was given a pretty steady diet of Waltz,
rational deterrence theory, Barry Posen, Stephen Walt (Theory Talk #33), and Robert Jervis (Theory Talk #12). Shai
Feldman was a remarkable teacher, so were Ilai Alon in philosophy, Shlomo
Shoham in sociology and Aharon Shai in History. Additionally I had colleagues
at work who were PhD students at the Hebrew University working with Emanuel Adler;
they gave me Wendt (Theory Talk #3), Katzenstein's (TheoryTalk # 15) Culture of National Security, Adler and
Barnett, and Jutta Weldes' early article on 'Constructing National Interests'
in the EJIR (PDF here).
My job was to help them publish their monographs, so I got really into the guts
of their arguments, which were fascinating. I am not really an agency-centered
theory guy anymore and I am not really a constructivist anymore, but that stuff
was fantastic. I saw that one could write from a wholly different viewpoint,
perspective, and voice. This is all very mainstream in IR now, but at the time,
it felt quite edgy, very novel. Part of the reason why the middle chapters of Recovering IR has these long discussions
about different kinds of constructivism is that I wouldn't have had two
thoughts to rub together if it was not for those books. I do disagree with them
now and strongly, but they were very important to me all the same.






What would a student need to become a specialist in IR or understand the
world in a global way?






I'd be
more comfortable answering that question as someone who was, until relatively
recently, a grad student. I've not been productive long enough to say 'Well,
here's how to succeed in this business and be a theorist of enduring substance
or importance' with any authority. But I can say, 'here's how I'm trying to be
one.' There's a famous article by Albert O. Hirschman called 'The Principle of
the Hiding Hand,' (PDF here)
and in it he says that frequently, the only way one can get through really
large or complicated projects is to delude oneself as to how hard the project
is actually going to be. He takes as an example these ambitious, massively
complicated post-colonial economic projects of the Aswan High Dam variety. The
only way such enormous projects ever get off the ground, he says, is if one
either denies their true complexity or deludes oneself. Otherwise you despair
and you never get it done. From the first day of seminar to dissertation
proposal to job—thank God I had no idea what I was in for, or I might have
quit.







Also,
the job market being what it was, we had to be very, very passionate scholars who
wrote and argued for the sheer intellectual rush and love of writing. And yet,
we also had to be very practical and almost cynical about the way in which the
academic market builds on the prestige of publications and the way in which
prestige becomes shorthand for your commodity value. At least in the US, the
decline of tenure and the emergence of a kind of new class of academics whose
realm of responsibility is specifically to engage in uncomfortable kinds of
political and moral critique—but without tenure, and at the mercy of a sometimes
feckless dean, an overburdened department chair or fickle colleagues—that's very scary. If you're doing 'normal
science', it's a different game and the challenges are different. But if your
job is to do critique, in the last ten years, it's a very big deal. Very
difficult. I'm very fortunate in that regard; at Alabama I've had great support
from my department, my chair, and my college.







I was a
Johns Hopkins PhD, and my department was fantastic in terms of giving me
support, encouragement, getting out of my way while throwing interesting books
at me, reading drafts that were bad and helping me make them good—or at least
telling me why they were bad. We did
not get particularly good professional training, because I think they did not
want us to get professionalized before we found our own voice. I'm really
grateful for that, truly. But then there's this period in which you have to
figure out how to make your voice into a commodity. That's really tough, it's a
little bit disheartening—even to discover that you must be a commodity is dismaying; didn't we go into the academy to avoid
this sort of logic? But just like Marx says, commodities have a double life, and
so do you. The use-value of your scholarship and its exchange-value do not
interlock automatically and without friction. So you spend all this time on the
use-value of it—writing a cool, smart, interesting dissertation—thinking that
will translate into exchange-value, and it turns out that it sort of does, but
a lot of other things translate into exchange-value too that aren't really about
how good your work is necessarily. And many of your colleagues, if what you're
doing is original, won't really understand what you're doing; the value or the
creativity of it won't be apparent to them unless they spend a lot of time sifting
through your bad drafts of it, which only a few—but God bless those—will do. So
how you create exchange-value for yourself is important. So is finding people
who will care about you, your project, your future—and learning when to take
their advice, when to ignore it, and how to do so tactfully.







If all that's
hard, you're probably doing it right. It's unfortunate that that's how it is,
but at all events, that's how it was for me.











Would you elaborate on the concept of
vocation and why this is so important to the view from nowhere? It is important
to say that the view from nowhere is perhaps difficult. So is vocation, or a
kind of Weberian approach, a way to articulate that for you?







There's
a quote in a book from a Brazilian novelist named Machado de Assis. His
protagonist is this fellow Bras Cubas, who's writing a posthumous memoir of his
own life. He's writing from beyond the grave. From there, he can view his whole
life and his entire society from outside; he's finally achieved positivism's
view from nowhere. But the thing about this view—and the book means to be a
sendup of the Comtean positivism that was fashionable in Brazil in those
days—is that it gives him no comfort. He now knows why he lived his life the
way he did; how he failed and what was—and what was not—his fault. The
absurdity of it all makes sense. But it changes nothing: he has died
unfulfilled, unloved, and essentially alone: a minor poet and back-bench politician
who was ultimately of little use to anyone nor of much to himself. All he knows
is how that happened.







In the
end, if we're all playing a role in how a world comes into being and it's in
some sense our job simply to accept this, and our job as scholars merely to
explain it, this gives us no comfort in the face of suffering, in the face of
violence and evil. To some extent as scholars, and to some extent as a
discipline, we exist as a response to evil, to suffering, to foolishness, to
folly; it's not a coincidence that the first professorship of IR is created in
Britain in the wake of WWI, and that it's given to someone like E. H. Carr.







If we
don't have a view from nowhere because we've given up anything like a moral
sense that can't be reduced to fractional, material, or ideological
sensibilities, and if we know that sometimes those 'views from somewhere' can
provide cover for terrible kinds of evil or justify awful kinds of suffering,
then the notion of vocation seems to come in at that point and say well,
'here's what I hope I'm doing', or 'here's what I wish to be doing', or 'here's
what I'd like to think I'm doing', and then allowing others to weigh in and
give their two cents. Vocation, in the sense of Weber's lectures, comes out of
that. It's Kant for social scientists: What can I know? What should I do? For
what may I hope? In other words, what the necessity and obligation of thinking
is on the one hand, and on the other what its limitations are.







This is
a way to save International Relations from two things: one, from relativism and
perspectivism, and the other, from a descent into the technocratic or the
managerial. I am trying to stand between the two. My own intellectual
background was in security studies at Tel Aviv University in the 1990s: the
period immediately after Maastricht, in the period of the Oslo Process, the end
of Apartheid. My hope back in the days when the peace process seemed to me to
be going well was that I'd be able to have a kind of technocratic job in
Israel's Ministry of Foreign Affairs or Defense. Counting tanks, or something
similar. I thought that would be a pretty good job. I would be doing my part to
maintain a society that had constructed a stable, long-term deterrent by which
to meaningfully address the problem of Jewish statelessness and vulnerability,
but without the disenfranchisement of another people. I could sit down and
count my tanks with a clear conscience, because the specter of evil was being
removed from that work. The problem of the occupation was being be solved.
Again, it's somewhat embarrassing to admit this now.







I would
say in the US academy, there is definitely a balance in favor of the
technocrats. We have enormous machines for the production and consumption of
PhDs in this country. The defense establishment is an enormous player. Groups
like the Institute for Defense Analysis need a lot of PhDs, the NSF funds a lot
of PhDs (for now, at least), and that tips the balance of the profession in a
certain way. My ability to use ideas compellingly at ISA won't change that fact
all by itself, there's a base-superstructure issue in play there.







In
Europe, it's a different story, for a bunch of reasons. The defense
establishments of the EU member states aren't as onerous a presence. And, there
are more of them; so there's a kind of diversity there and a need to think
culturally about how these various institutions interlock and how people learn
to talk to each other: the Martha Finnemore-to-Vincent Pouliot-to-Iver Neumann (Theory Talk #52) study of ideas and institutions and
officials. Plus, you have universities like the EUI and the CEU, which are not
reducible to any particular national interest or education system; creating
knowledge, but for a political/state form that's still emergent. No one knows
exactly what it is, what its institutions and interests will ultimately be.
Because of that, it's hard to imagine the EUI producing scholars with obviously
nationally-inflected research programs, like Halford Mackinder,
Mahan, Ratzel from a century
ago. There will still be reifications and ideologies, but there's more 'give'
since the institutions are still in play. And there's fantastically interesting
stuff happening in Australia, and in Singapore—think of people like Janice
Bialley-Mattern, Tony Burke and Roland Bleiker.











Critique has a long and controversial
history in our discipline. Could you perhaps elaborate, as a kind of background
or setting, how critique can be used in IR and why you've placed it at the
center of your approach to IR theory?







Critique
as term of art comes into the profession through Robert Cox (Theory Talk #37) and through the folks that were writing
after him in the '90s, including Neufeld, Booth, Wyn-Jones, Rengger, Linklater and
Ashley—though pieces of the reflexive practice of critique are present in the
field well before. For Cox, the famous line is that theory is always 'for
something and for someone.' The question is, if that's true how far down does
that problem go? Is it a problem of epistemology and method, or is it a problem
of being as such, a problem of ontology? Is it fundamental to the nature of
politics?







If the
set of processes to which we refer when we speak of 'thinking' is inherently
for someone and for something, and that problem harkens back to the idea that
all thinking is grounded in one's interests and perspectives, i.e., that all
practical or systematic attempts to understand politics are 'virtuous' in the
Machiavellian sense (they serve princely interests) but not necessarily in the Christian
sense (deriving from transcendent values), then we have a real problem in keeping
those two things separate in our minds. Think of Linklater's book Men and Citizens in International Relations
as a key node in that argument, though Linklater ultimately believes (at least
in that book) that a reconciliation between the two is possible. I'm less
convinced.







Now
recall the vocation point we discussed before. IR as a discipline has a deep
sense of moral calling which goes beyond princely interest. And the traditions
on which it draws are as much transcendently normative as anything else. So
encoded in our ostensibly practical-Machiavellian analyses is going to be
something like a sense of Christian virtue; we'll believe we're not merely
correct in our analyses, but really and
truly right in some otherworldly, transcendent way. True or not, that sense
of conviction will attach itself to our thinking, to the political forces and
agendas that we're serving. We'll come to believe that we are citing
Machiavelli in the service of something greater: whether that's 'scientific
truth' or the national interest, or what have you. Nothing could be more
dangerous than that. Critique, as an intervention, comes here: to dispel or
chasten those beliefs. Harry Gould, Brent Steele, and especially Ned Lebow (Theory Talk #53) write about prudence and a sense of
finitude: these are the close cousins of this kind of critique.







If we
take seriously the notion that people sometimes fight and kill in the service
of really awful causes while believing they are doing right, and that scholars
sometimes help them sustain those convictions rather than disabuse them of them—even
if they do not intend this—then critique becomes an awfully big problem and it
really threatens to undermine the profession as such. It opens up a whole new
level of obligation and responsibility, and it magnifies what might otherwise
be staid 'inside baseball'—Intramural scholarly or methodological debates. Part
of the reason why the 'great debates' were so great—so hotly fought—had to do
with this: our scholarly debates were, in fact, ideological ones.







It
undermines the field in another way as well. If we take critique seriously,
there's got to be a lot of moral reflection by scholars. That will make it hard
to produce scholarship quickly, to be an all-purpose intellectual that can
quickly produce thought-product in a policy-appropriate way, because I will
want to be thinking from another space, and of course precisely what
policy-makers want is that you don't
think from some other space; that you present them with 'shovel ready' policy
that solves problems without creating new ones.







So you
now have not just a kind of theoretical or methodological interruption in the
discussion of, say, absolute or relative gains. You now have to give an account
of yourself. And for me, that's what critique in IR means. To unpack the
definition I gave above, it's the attempt to give an account of what the duties
and limits of one's thinking are in the context of politics, given the nature
of politics as we understand it. Because IR comes out of the Second World War,
we're bound to take the most capacious notions of what political evil and
contingency can be; if we are not always in the midst of genocide and ruin,
then we are at least potentially so. And so contingency and complexity and all
the stuff that we're talking about must face that. I want to hold out that Carl
Schmitt and Hans Morgenthau might be
right—in ways which neither they, nor I, can completely fathom. Then I have
to give accounts of thinking that take a level of responsibility commensurate
with that possibility.







In that
vein, when I look at accounts of thinking in the context of the political, when
I look at what concepts are and how they work and how they do work on the world
so that it can be rendered tractable to thought, I realize that what we come up
with when we're done doesn't look very much like politics anymore. We have
tools which, when applied to politics, change it quite dramatically; they reify
or denature it. To be critical in the face of that, you're going to be obliged
to an extensive degree of self-interrogation and self-checking, which I call chastening.







That process
of chastening reason, is, in effect, what remains of the enlightenment obligation
to use practical reason to improve what Bacon called the human estate. What's
left of that obligation is to think in terms of the betterment of other human beings
as best as you can, knowing you can't do that very well, but that you may still
be obliged to try.







That's
really hard to do and it's an odd form of silence and non-silence. After all,
if I were to look at the Shoah while it was happening, or look at what happened
in Rwanda, and say 'well, I don't really have a foundational position on which
to stand so I can't analyze or condemn that'—that would not be a morally
acceptable position. Price and Reus-Smit (TheoryTalk #27) say this
in their 1998 article and they are absolutely right. But then there's the fact
that I don't quite know what to say beyond 'stop murdering people!' The world
is so easy to break with words, and so hard to put back together with them—assuming
anyone cares at all about anything we say. So I am obliged to respond to those
kinds of events when I see them, and I am also obliged to acknowledge that I
can't respond to them well, because my authority comes from the conceptual tools
I have, and they aren't really very good. Essentially, what I'm doing as
scholar of IR is the equivalent is using the heel of my shoe to hammer in a nail.
(That's a nice line, no? I wish it was mine, but it's Hannah Arendt.) It will
probably work, but it will take a while, and the nail won't go in so straight. To
chasten one's thinking is to remind oneself that the heel of one's shoe is not
yet a hammer; that all we're doing is muddling through—even when we do our work
with absolute seriousness and strict attention to detail, context and method—as
of course we should.











You discuss IR theory in terms of different
reifications. In which was does that also lead you to take a stand against a Weberian
understanding of IR?







I think
where I depart from Weber is that he has more faith than I do that, at some
point, disenchantment produces something better. There is faith or hope on
their part that the iron cage that we experience as a result of disenchantment
and as a result of the transformation from earlier forms of charismatic and
traditional authority to contemporary rational ones won't always be oppressive,
not forever. New forms and ways of being will emerge, in which those
disenchanted modes actually will fulfill their promise for a kind of
improvement in the human estate. If it's a long, complicated process—hence the
image of slow boring into hard wood—but faith is still justified, good things
can still happen.







For me,
the question is how would you manage a society that is liable to go insane or
to descend into moments of madness because of the side-effects or intervening
effects of disenchantment and modernization, while holding fast to the notion
that at some point, this is going to get better for most people? I'm a bit less
certain about that than I read Patrick and Weber being. I think that even if
they're right, it makes sense morally as scholars, not necessarily as citizens
or individuals or people, to dwell in the loss of those who fall along the way.








I find
myself thinking about the people who are gone a lot. My ex-wife teaches on
slavery, and I think a lot about this terrible thing she once told me. On slave
ships, when there was not enough food they would throw the people overboard
because ship masters got insurance money if their property went overboard, but
not if human beings succumbed on-ship. There's a scene depicting this in
Spielberg's film Amistad and it
haunts me. I find myself thinking about those people, dragged under with their
chains. I wonder what they looked like, what they had to say. I wonder what
they might have created or how their great-great grandchildren children would
have played with my child. I wonder if my best friend or true love was never
born because her or his ancestor died in this way. An enormous number of people
perished. I can't quite believe this, even if I know it's true.







Yoram
Kaniuk, the recently deceased Israeli novelist, wrote that the Israeli state was
built on the ground-up bones of the Jews who couldn't get there because it was
founded too late. I wonder about them too. And when I taught course modules on
Cambodia, I would find myself looking at the photographs made of the people in
Tuol Sleng before they were killed, the photo archives which the prison kept
for itself. There is a mother, daughter, father, brother, son, and I find
myself drawn into their eyes and faces. I don't want those people to disappear
into zeros or statistics. I want somehow to give them some of their dignity
back, and I want to dwell in the tragic nature my own feeling because it bears
remembering that I cannot ever really do that. If I remember that, I will have
some sense of what life's worth is, and I won't speak crassly about
interventions or bombings or wars—wherever I might come down on them. I would
say that it's almost a religious obligation to attend to the memory of those
people. My desire to abide with them makes me very, very suspicious of hope or
progress. I want this practice of a kind of mourning or grief to chasten such
hope.







There's
a problem with that position. Some will point out to me that this will turn
into its own kind of Manichean counter-movement, a kind of Nietzschean ressentiment. Or else that dwelling in
mourning has a self-congratulatory quality to it. And there are certainly
problems with this position at the level of popular or mass politics. We do see
a lot of ressentiment in our
politics. On the left, there's a lot of angry, self-aggrandizing moral
superiority. And you can think about someone like Sarah Palin in the US as a
kind of populist rejection of guilt and responsibility from the right.







But as social
scientists, we might have space to be the voice for that kind of grief, to take
it on and disseminate the ethics that follow from it; to give that grief a
voice. That kind of relentless self-chastening is what I'm all about. I think
it opens you up to new agendas and possibilities. I think it's a much deeper
way to be 'policy relevant' than most of my colleagues understand this term. If
we are relentlessly self-critical as scholars, and if we relentlessly resist
the appropriation of scholarly narratives to simplistic moral or political ends
and if we, as a society, help to build an intolerance of that and a sense of
the mourning that comes out of that, we also open our society up to say things
like, 'ok, well what's left?'







And
then, well, maybe a lot of things are left, and some of them are not so bad. Maybe
we start to imagine something better. That's where I'd rejoin Jackson and
Weber; after that set of ethical/emotional/spiritual moves. I think, by the
way, that Patrick mostly agrees with me; it's only a question of what his work
emphasizes and what mine has emphasized. On this point, consider Ned Lebow's
notion of tragedy. He and I disagree on some of the details of that notion. But
on top of his remarkable erudition, he's a survivor of the Shoah. I suspect he has thought very deeply about grief and
mourning, and in ways that might not be open to me.











The final question I want to pose to you is
a substantive one: Your understanding of critique somehow does relate to
sustaining progress, in a way. Perhaps on the one hand, you are not so
optimistic as Weber was, but on the other hand, your work conveys the sense
that it is possible to bridge the gap between concepts and things. I'm not sure
if it's possible, but perhaps you can relate it to the substantive example of
how your work relates to concrete political situations. I think the example of
Israel-Palestine comes to mind best.







Again,
I don't think I am as optimistic as that. In my heart of hearts, I desperately
wish this to be the case. To think of the people who were most influential on
my intellectual development—my cohort of fellow grad students at Johns Hopkins
and our teachers, to whom as a group I owe, really, everything in intellectual
terms—I was certainly in the minority view. Most of them were, I think, working
in the Deleuzian vein of making 'theory worthy of the event.' I just don't
believe that's possible; or anyway I think it's really, really, really hard, the work of a generation to tell that
story well and have it percolate out into our discipline and our culture. In
the meantime, we must muddle through. I hope I'm wrong and I hope they're
right. I'm rooting for them, even as I try to give them a hard time—just as I
give Keohane (Theory Talk #9)
and Waltz and Wendt and everyone else I write about a hard time. But I'd be happy, very happy, to
be wrong.







What I
do think can be done is that you can sustain an awareness of the space between
things-in-themselves and concepts, and by extension some sense of the fragility
and the tenuousness of the things that you think and their links to the things
that you do. Out of this emerges a kind of chastened political praxis.







You mentioned
Israel and Palestine, which I care a great deal about and am trying to address
more squarely in the work I'm doing now, partly on my own and partly in pieces I've
worked on with my colleague Daniel Monk. What we observe is that though the diplomatic
negotiations failed pretty badly twelve and a half years ago, we're still
looking at the same people running the show: the same principal advisers and
discussants and interlocutors: in the US and Israel and in the Palestinian Authority.
The same concepts and assumptions too. Just a few days ago, Dennis Ross
published a long op-ed about how we get the peace process back on track, and
you might think that you're reading something from another time—as though the
conflict were a technical challenge rather than a political one. You know that
Prince song about 'partying like it's 1999'?







I don't
know what a peaceful, enriching, meaningful Israeli-Jewish-Arab-Palestinian-Muslim-Christian
collective co-existence or sharing of space or world looks like, but I know
that this pseudo-politics ain't that. When I see something that's just a
re-hashing, I can say, 'come on guys, that is not thinking, that's recycling
the old stuff and swapping out dates, proper nouns and a few of the verbs.' Nor
is it listening to other voices who might inspire us in different ways, or
might help us rethink our interests, categories and beliefs. Lately, I've been
listening to a band called System Ali, hip-hop guys from Jaffa's Ajami quarter,
who sing in four languages. What they say matters less to me than the fact that
they really seem to like another, they trust each other, they let each voice
sing its song and use its words. They have something to teach me about
listening, thinking, acting and feeling—because it's music after all—and that
can produce its own political openings.







Of course,
there are pressure groups, from industry and AIPAC to
whatever else in the US, and those groups merit discussion and debate, but I'm
also wary of the counter-assumption which follows from folks who talk about
this too reductively: that there actually is an American interest, or a
European or Arab or Israeli one, which somehow transcends partisan interest—one
that can be recovered once the diaspora Jews, the oil moguls, the arms dealers
or the Christian 'Left Behind' people are taken out of the picture. That feels
like the same heady brew that Treitschke and Meinecke and the German realpolitik scholars poured and drank:
that the national state has some transcendent purpose to which we gain access
by rising above or tuning out the voices of the polity or its chattering
classes. Only with a light liberal-internationalist gloss: Meinecke meets David
Lake (Theory Talk # 46),
Anne-Marie Slaughter or John Ikenberry.







I can
also go meet starry-eyed idealists who want to hold hands and sing John Lennon,
I can say to them yes, I want to hold your hand and sing John Lennon, but I am
also enough of a social scientist to know that if a policy does not respond to
real and pressing problems—water, land, borders etc.—that any approach that
does not respond to those things will be hopelessly idealist. It will be what
my granny called luftmentsch-nachess—the
silly imaginings of men with their heads in the clouds, like the parable about Thales
and the Thracian maiden. I am not interested in being either a luftmentsch nor a technocrat. So what
does that leave with you with? You need to balance.







You can
look at groups at the margins of political culture to see what they can tell
you. In Israel and Palestine, it's groups like Ta'ayush, Breaking the Silence and Zochrot, and this settler
leader who recently died, Rabbi Frohman, who was going out and meeting every
Palestinian leader he could because for him, being a Jew in the land was not,
in the first instance about his Israeli passport. There were and are
possibilities for discussion that feel really pregnant and feel very different
from the conversation we are sustaining now; which reveal its shallowness and
its limitations and its pretentiousness. These other voices are of course not
ideal either, they are going to have their own problems and limitations, their
own descent into power and exclusion and so on, but they reveal some of the lie
of what we're doing now.







I guess
in the end, social scientists make a living imagining the future on the basis
of the past. I also spend a lot of time reading novels and watching books and
films. Partly because I am lazy and I like them. Partly because I'm looking for
those novels and films to help me imagine other possibilities of being that
aren't drawn from the past. Art, Dewey tells us in The Public and its Problems,
is the real bearer of newness. Maybe then, I get to grab onto those things and
say ok, what if we made those them responsive to an expansive materialist
analysis of what an Israeli-Palestinian peace would need to survive? What if we
held the luftmentsch's feet to the
materialist/pragmatic fire, even as we held the wonk's feet to the luftmentsch's fire? Let them both squeal
for a while. There's possibility there.







Daniel J. Levine is assistant professor at the University of Alabama. Among his recent publications (see below) stands out his book Recovering International Relations.



0
0
1
7019
40009
School of Global Studies/University of Gothenburg
333
93
46935
14.0





Normal
0




false
false
false

EN-US
ZH-CN
X-NONE









































































































































































/* Style Definitions */
table.MsoNormalTable
{mso-style-name:"Table Normal";
mso-tstyle-rowband-size:0;
mso-tstyle-colband-size:0;
mso-style-noshow:yes;
mso-style-priority:99;
mso-style-parent:"";
mso-padding-alt:0cm 5.4pt 0cm 5.4pt;
mso-para-margin-top:0cm;
mso-para-margin-right:0cm;
mso-para-margin-bottom:10.0pt;
mso-para-margin-left:0cm;
line-height:115%;
mso-pagination:widow-orphan;
font-size:11.0pt;
font-family:Calibri;
mso-ascii-font-family:Calibri;
mso-ascii-theme-font:minor-latin;
mso-hansi-font-family:Calibri;
mso-hansi-theme-font:minor-latin;
mso-fareast-language:ZH-CN;}










































































































































































































































































Related links








Faculty Profile at U-Alabama
Read the first chapter of Levine's Recovering IR (2012) here (pdf)
Read Barder and Levine's The World is Too Much (Millennium, 2012) here (pdf)
Read Levine's Why Morgenthau was not a Critical Theorist (International Relations, 2013) here (pdf)
Read Monk and Levine's The Resounding Silence here (pdf)




Print version of this Talk (pdf)

The Mercury June, 1893 ADVERTISEMENTS. IRailroafc "The "Royal 'Route" /Viu^rc and ^rfc C°1s^^Vato^y. Chartered 1850, offers Classic, Normal, Music and Art courses for Diploma and Degrees ; comprises three large brick buildings, situated on ;t beautiful eminence, a lovely campus, library, apparatus, hot and cold mountain water, steam heat, gas light, electric bells, a suite of rooms nicely furnished for every two or three students, music lessons on 1'ipc Organ, Reed Organ, Piano, Violin, Guitar, Mandolin, IJanjo, and Cornet. Lessons in Drawing, Crayoning, Pastel, China and Oil Painting. German and French languages taught and spoken. Special attention paid to Elocution and Voice Culture. Normal course with Diploma for teaching. Strict attention given to Physical, Social, and Religious culture. Kee Mar College is located in a most attractive, refined, and healthful city of 14,000 people. SEND FOR CATALOGUE AND JOURNAL TO Rev. C. L. KEEDY, A. M. M. D., President, Hagcrstown, Mel. To th$ StlJd^rjts oF New and Direct Line To and From QETTT5BURQ. Fast, Frequent and Superbly Equipped Train Service Between NEW YORK, PHILADELPHIA, Allentown, Pottsville, Williamsport, Reading, Harrisburg and Interior Pennsylvania Points, with through connections to and from all parts of the Middle States, New England and the West. Visitors to America's Greatest Battlefield can obtain through tickets and baggage checks, via this new and most picturesque route, at all principal stations and ticket offices throughout the country. I. A. SWEIGARD, C. G. HANCOCK, General Manager. Gen. Pass. Agt. Barber SfrQP> CHARLES C. SEFTON, PROPRIETOR. BALTIMORE STREET. THE PLACE FOR STUDENTS TO GO. ONLY FIRST-CLASS WORK QANDERS & OTAYMAN Beg to call attention to their splendid exhibit of the leading makes of Pianos and Organs Including the famous ESTEY OROAN, WEBER, DECKER BROS., ESTEY, FISCHER, AND IVERS AND POND PIANOS. Also a full line of Sheet Music, Music Books, and Musical Instruments of all kinds, including Violins, Mandolins, Banjos, Guitars, Cornets, Autoharps, &c. SANDERS & STAYMAN, 13 NORTH CHARLES ST., BALTIMORE, MD. 934 F STREET, N. W., WASHINGTON, D. C. Music Sent " On Selection." Catalogues Free. We are Sole Agents for the Wonderful "JEOLIAN," an Orchestra in Your Own Parlor, With You as Musical Director. Spalding's Livery Stable, STRATTON ST., GETTYSBURG, PA. Branch Office, E. S. Faber's Cigar Store. Hacks, Carriages, Wagonettes, Double Teams, Riding Horses, Large Wagons Capable of Holding Sixty Persons at a Time. COMPETENT GUIDES FOR THE BATTLEFIELD. CHAS. J. SPALDING, Proprietor. "-vjX5))jj ■ ■ ■ ■ 11 ■ 11V? 11111:111 -1 -11: ■ i.ii i.iiiiiiiiiiiiiiiiiiuiiiiiiii-iiiaiii'iiuiiiiiiiiiiiiiiiiiiiiiiiimlftQv1*^— Gettysburg Carriage Works, CHAS. J. SPALDING, Proprietor. WEST MIDDLE STREET. BUILDER OF « Surreys, Buggies ^ Road Wagons.>« REPAIRING PROMPTLY DONE. ADVERTISEMENTS. B. # O If you are Going to the World's Fair— And we suppose you are— We desire to Call your attention To the Baltimore and Ohio Railroad, Because it is The Shortest Route From this section Of the country, And because it Is the most Picturesque and Historic. Its solid Vestibuled Trains from New York, Philadelphia, and Baltimore Run via Washington, Traverse the Historic Potomac Valley, the theatre Of the war between the States, and cross the Allegheny Mountains, 3,000 feet above The sea level. All through trains carry Pullman Sleeping cars. The rates to the World's Fair via the Baltimore and Ohio R. R. Will be very cheap, And the train service Will be unexcelled. The Baltimore and Ohio Has direct tracks From its station at Chicago to the World's Fair Grounds. Apply to Chas. O. Scull, General Passenger Agent, Baltimore, Md., if You desire to know More about this Great Route. ADVERTISEMENTS. iii Society Baboes flbri3e flfcebals Stationery The most successful designers of College and University Badges in the Country Estimates— -Designs on Application BAILEY BANKS BIDDLE Chestnut and Twelfth Streets Philadelphia, *Pa. iHary had a Little Lamb, (Stam> your Memory.) It's wool was all the go— We make it up in BUSINESS SUITS for S1 5.00 you know. These Custom-Wade Suits are popular throughout America — because they represent the very Quintessence of Nobby Dress, and are essential to every business man who cares one lota for economy and APPEAR-ANCE. Send us 6 cents in stamps, stating kind of gar-ment or suit desired, and we will forward you SAMPLES of Cheviots, Cassimeres, etc., Self-measurement rules and fashion plate. YOU DO THIS and we do the rest. Balti-more cheapest market. KEELER the largest custom producer. Full Dress Suits, Trousers, - - Frock Suits, • Overcoats, - - JOnN M. KEELER, 5 N. Calvert St. Baltimore, fid, "Suffer no longer the extortions ofloco-1 tailors. S25.0U Up. $4.00 Up. $18.00 Up $18.00 Up. OEHM'S AGME HALL @nirm Hnnm & ruinisnrm 5 and 7 W. Baltimore Street, Annex 6 and 8 S. Charles St., BALTIMORE, MD. Correspondence Solicited With Responsible Parties Desiring to Act as Agents. NEW SPRING STYLES Of Suits and Overcoats now ready at 20 to 30 per cent, under com-petitors' prices. Write for Samples and Price List. WILLIAM SMALL, DIM DQOH nnra AND BOOK DMDLX 6 WEST MARKET STREET, YORK, PENNA. w. SJSGHRODER, DEALER IN rjafrs and Caps? ^ No. 6 Balto Street, Gettysburg. IV ADVERTISEMENTS. p. D. SCHRIVER Draper, Importer, • AtfD Merchant Tailor 23 Baltimore Street, GETTYSBURG, PA. The College Mercury. Vol. I. Gettysburg, Pa., June, 1893. No. 4. THE COLLEGE MERCURY, Published each month during the college year by the Students of Pennsylvania (Gettysburg) College. STAFF. Editor: JULIUS F. SEERACH, '94. Associate Editors : ALBERT S. COOK, '95. FRANK E. FICK1NGER, '94. HENRY E. CLARE, 95. WALDO D. MAYNARD, '95. PAUL \V. KOLLER, '94. ROSCOE C. WRIGHT, '95. SUMNER R. MILLER, '95. Business Manager: BENJAMIN R. LANTZ, '94. Assistant Business Manager : CHARLES F. KLOSS, '94. T^n^.r-. f One volume (ten months), . . . . $1.00 lERMS-| Single copies, .15 Payable in Advance. AH Students are requested to hand us matter for publication. ' The Alumni and ex-members of the College will favor us by send-ing information concerning their whereabouts, or any items they may think would be interesting for publication. All subscriptions and business matters should be addressed to the Business Manager. Matter intended for publication should be addressed to the Editor. Address, THE COLLEGE MERCURY, Gettysburg, Pa. eONTE/NTS. EDITORIAL, 55 CHARLES S. WOLF, 56 RESOLUTIONS ON THE DEATH OF SUMNER R. MILLER, 57 THE PROGRESS OP MESMERISM, 58 AN EPISODE 59 SPECIALISM: ITS NECESSITY AND ITS DANGER, . 59 PROOF-READING—MENTAL AND MORAL, 61 PAPA H 's SOLILOQUY ON THE DAY THE KEE-MAR GIRLS WERE HERE, 62 COLLEGE LOCALS, 63 ALUMNI, 66 FRATERNITY NOTES, 69 ATHLETICS, 70 TOWN AND SEMINARY, 71 LITERARY SOCIETIES 73 E/DITO-RIAL. WITH this number of THE MERCURY, the lately elected staff takes charge of affairs. It is their desire to mirror faithfully the life and thought of the students of Gettys-burg College, and bring before them in read-able form the doings of each month. Such work, however, calls for the heartiest co-opera-tion of the student-body. We, therefore, ask you for your willing help and for contributions to its columns. Remember that THE MER-CURY is the true representative of the college, for it alone stands for the interests of the students. * * * IT is of peculiar interest to us, who are train-ing for active work in the world, to know just what sort of material the world demands. The idea is slowly dying a natural death that four years of Latin, Greek, and Mathematics will fit a man to deal with all the problems of life. Text-books and dictionaries contain ten times more knowledge on these subjects than the average student, but they are powerless to effect the solution of our daily enigmas. The world calls for more than that, it calls for men. Our learning is of no account to those around us, unless a man stands behind it. Character-is a prime necessity for a man, and here is the place to develop it, for the college is a little world with duties as real as those of the throbbing world about us. If we fail here when the test is applied, we are bound to fail when larger duties demand our attention. The world is a severe judge, and takes no excuses. We are weighed in the balance, and, if found wanting, the command comes : " Make way for a man !" To quote the words of Dr. Hulbert: " Men are in demand; not homines—animals 56 THE COLLEGE MERCURY. that wear pants—but viri, plumed knights, with swords upon their thighs," ready to battle for right and truth, and make the great world better. THE spirit of death seems hovering over our college. But a short time ago we were called upon to mourn the loss of one whose college days were nearly over, Charles Wolf. Then came the announcement of the departure of the College Treasurer, Alexander D. Buehler, a man full of years and honors. And now again we have to bow to the will of that dread power, giving up one whose whole life lay before him filled with the glorious promise of highest achievement. Sumner Roscoe Miller, a member of the Sophomore class and one of the editors of THE MERCURY, died May 30th, shortly after the hour of noon. His illness was of a short duration, and the end came unexpected, swift and terrible. Just the day before his death, all reports spoke of speedy recovery, but now such.hope is vain—his health has come to him in a happier land. But words fail the writer, and the task of telling the story of that bright life must be left to a calmer mind and a quieter heart. Grief, deep and sincere, is in the hearts of all his fellow-students, and words are slow to come when the heart quivers in pain. IN days of old, when the burden of thought was turned to things heavenly, a common belief was expressed in the words of the adage : " Cleanliness is next to Godliness;" but now that the minds of men have deigned to descend from their lofty flight and take an interest in human affairs, the thought implied finds better expression in the changed form : " Cleanliness is next to manliness." Refer-ence is made to this in order that the careless-ness, so prevalent lately, may cease, and that the rubbish which litters the campus may dis-appear. It is to our interest to appear neat and tidy to the visiting world and the Faculty. We are judged by what is seen of us, and we naturally desire favorable judgment. But to obtain such judgment we must do something worthy of it. Let us, therefore, respect the request made of us, and rid ourselves of waste matter through the proper channels. If we respect the wishes of others, we have more chances of having our own respected, and more right to claim consideration for them. * * IN the editorial concerning the glee club, which appeared in the last issue, it should have been stated that the club was granted permission to be absent from college for sixteen periods. The reason that they were not allowed to give concerts away from college this term is owing to the fact that the time granted was exhausted last term. CHARLES S. WOLF. CHARLES STORK WOLF, son of Rev. Dr. and Mrs. E. J. Wolf, was born in Baltimore, Md., December nth, 1873. He was named for and baptized by the late il-lustrious Dr. Charles Stork, and it would seem that there was transmitted to the child the same gentle and charitable spirit of the sainted man whose name he received. In his second year, he removed with his parents to Gettysburg, and resided here until his death. He began the work of his education in the public schools of this place, and was graduated from the High School with the highest record of his class in June, 1887. The following Sep-tember he entered the Preparatory Depart-ment, where he remained for two years, and entered the Freshman class in college in Sep-tember, 1889. Three years of his college life had passed and the day of his graduation was at hand, when, on April 26th, he left home to spend a few days in New York city, at a con-vention of the Sigma Chi Fraternity, of which he was a faithful and devoted member. He returned home on the evening of Saturday, THE COLLEGE MERCURY. 57 April 29th, happy and apparently in excellent health. The next morning, however, he be-came sick, and after an illness of little more than forty-eight hours, he died at 6.15 o'clock : on the morning of Tuesday, May 2d. Such are the facts connected with the brief life and sudden death of Charles Stork Wolf- He was a gentle, amiable, happy boy, scatter-ing smiles and sunshine into the lives of all with whom he came in contact. His nature was beautifully childlike in its tenderness and simplicity; his character was pure, noble, and upright. In his home he was an example of filial respect and brotherly love; in his frater-nity he was the type of loyalty and devotion ; in his class and the whole college community he was loved by all and hated by none. Among the citizens of Gettysburg he had a smile and kind word for all, knowing no dis-tinction of high and low, rich and poor; and beyond the limits of Gettysburg his friends were numbered by the score. His death came just at that period of transi-tion when the youth is passing into the man. The arena with its activities lay just before him, and in a few months he would have met the world, and dared the decrees of fate. What the future held for him we cannot say; if the boy was prophetic of the man, we believe his life would have added blessings to the world and benefit to the race. From child-hood his heart had turned longingly toward the work of the ministry, and it is not for us to predict what words of sacred eloquence and deeds of Christ-like love would have been his, had he lived to carry out his purpose. It is sufficient for us to know that God needed him and his service in some foreign part of his great universe, and that the bright boy, who so recently moved among us, still labors and loves in a broader and better life in the presence of his Father and his God. W. K. D. the death of a member of the active chapter. As we con-template the death of our young and beloved brother, Charles Stork Wolf, involuntarily we bow and say, " Truly death hath all seasons for her own." The very type of youth and health and happiness, he walked among us only a few days ago, and the thought of death was never associated with that bright face and manly form, but in a twinkling of an eye the summons came and he was taken. Charles Stork Wolf was a youth of rare and enviable qualities. His nature was bright, genial, and affable; his character pure, upright, and noble. Cheerful smiles, gentle words, and kind deeds were his constant companions. In his home he was a loving and obedient son and a kind and gentle brother. In his friendships he was true, sincere, and faithful, and in the world at large he had a heart of love and charity for all men. Only the garlands of friends rest upon his newly-made grave, and from no heart rises the curse of an enemy to distract the peacefulness of his slumber. In the death of Charles Stork Wolf, Theta chapter of the Sigma Chi Fraternity has suffered a sad and heavy loss. He became a member of the chapter early in the present col-legiate year, and during his membership his devotion to the White Cross and its interests was constant and memorable, and new lustre has been added to the emblem by his pure and unselfish life. As we gather in our chapter lodge it is hard to think of him as a " silent Sig," but the vacant chair with its drapings of mourning, the longing for " The touch of a vanished hand And the sound of a voice that is still " are sorrowful reminders of the truth. Our hearts are filled with sadness, for in the years to come we shall miss his hearty hand-shake, his cheery laugh, his happy ways. Resolved, That the chapter lodge be draped in mourning for a period of thirty days, Resolved, That a copy of this action be sent to the family of our deceased brother, spread in full upon the minutes, published in the college publications, and the Sigma Chi Quarterly. ED. W. LOUDON, CHAS. W. HUMRICHOUSE, FRANK S. LEISENRING. FRATERNITY RESOLUTIONS. 1'or the first time in the almost thirty years of its existence "as Theta chapter of Sigma Chi been called upon to mourn RESOLUTIONS ON THE DEATH OF SUMNER R. MILLER. WHEREAS, God in His all-wise providence has seen fit to summon from our midst our dearly-beloved friend and class-mate, Sumner Roscoe Miller; and WHEREAS, In his sad and unexpected death the class of '95 has lost a most talented and devoted member, and the ' ministry a most promising candidate ; therefore be it Resolved, That while we bow in humble submission to the will of Him " who doeth all things well," yet we deeply mourn the loss of him who, by his manly character and Christian conduct, had endeared himself to us; and, 58 THE COLLEGE MERCURY. Resolved, That in him we have lost one whose place can never be filled, and whose memory will ever be cherished, not forgetting that our irreparable loss is his eternal gain; and Resolved, That,as an expression of the sincere sorrow which we experience on account of this mysterious act of God, we extend to the bereaved family and friends of our departed classmate our deep sympathy; and Resolved, That a copy of these resolutions be sent to the family of the deceased, and that they be published in the College journals, Church papers, and The Millersburg Sen-tinel, E. H. WERT, W. H. FELDMAN, W. A. KUMP, W. D. MAYNARD, R. C. WRIGHT, Committee. THE PROGRESS OF MESMERISM. THE world to-day is alive with scientific investigators. Who will be the next to affix his name to the scientific roll of honor ? Such was the question that forced itself into the chemical brain of William Belshazzar Lutz but a very short time ago. Outside of compounding vile chemical mix-tures in the laboratory, the subject of mesmer- , ism has been the one absorbing topic that has occupied the mind of this gentleman for many years. Ofttimes when the bell in the tower would toll forth the silent hours of midnight, and when the rest of his college mates were wrapped in the sweet embrace of slumber, this devotee of science, with his face wreathed in smiles, would read how Joseph Smith, the great Mormon leader, had practiced the virtues of animal magnetism upon his credulous followers. Why not put this art to a more noble use ? Lengthy and deep were the medi-tations which followed, and many were the conclusions at which he arrived. His plans being formulated, the one great thing that re-mained to startle the scientific world with the results of his study was to make test of the same by practical experiment. Who should be the subject of experimentation ? This new and great difficulty now confronted him. The mesmeric ability of " Homer" Kloss, that lengthy man of antiquity, was well established. After mature deliberation, he resolved to give him a share of his confidence, and to make him the first and only partner in his mesmeric firm. These two worthy Juniors, the convolu-tions of whose brains are deeper than the teeth of a ten-foot ice saw, persuaded Freshman Carty and " Sister " Hedges to permit them-selves to be operated upon. Carty, whose will-power is remarkable, proved himself to be but a poor subject. " Sister " next seated him-self in the experimental chair, and Belshazzar, with a flourish of his hands that would have rivaled that of an Indian juggler, soon had his patient under mesmeric influence. The opera-tor softly whistled " Annie Rooney," and when the music had ceased the circus began. " Sister " performed all sorts of queer pranks. He washed his face with Sozodont. He jumped on the springs of Belshazzar's bed, and said he was riding in a Pullman palace car. He combed his hair with a broom, and put on a storm overcoat, saying that it was about time he had found his linen duster. He lathered his face with blacking, and tried to shave with a yard-stick. He imagined he was Bare's phonograph, and, when asked to hum a good old gospel hymn, he whistled " Reddy Get Your Hair Cut." He brushed his toe-nails with tooth-powder, thinking his teeth were at his pedal extremities. " Enough !" the brilliant operator exclaimed. "Now, gentlemen, allow me to remove the charm." His hands flew heavenward over " Sister's " face, but, alas, the patient only rolled his eyes and groaned. The operator was startled. Again he tried to break the spell, but a deeper groan and a more horrible rolling of eyes was the only result. The operator was unnerved. A third attempt was made, but groans and sighs that would have wrung the heart of any human being were the only response. The wildest alarm now followed. Never was there such consternation since the infernal fiends THE COLLEGE MERCURY. 59 were pitched over the " battlements of heaven." Belshazzar, naturally a religious man, gathered together all the busts of the immortal gods, and, having placed them on a copy of Clyde " Remsen's" Chemistry, prayed to each one separately. He besought Bacchus to pour some fire-water down his patient's throat and thus restore him. He tearfully asked Zeus to hit poor " Sister " with a thunderbolt and awaken him. He prayed Neptune to run his tri-dent through " Sister's " hair and electrify him out of his accursed spell. He prayed Apollo to shoot him with a golden arrow. He prayed jEolus to squash him with an Omaha cyclone. He prayed Vulcan to hit him with a brand new sledge-hammer, " but not too hard, dear Vulcan." He sought the aid of Juno, but Juno wasn't " in it." He prayed to Venus, but Venus said he had sported around the " Kee-Mar " girls, and she would have nothing to do with him. He lastly besought Minerva to grant him enough wisdom to restore poor " Sister," but Minerva did not look with appre-ciation upon the actions of such mortals as himself. Finally, in despair, he borrowed a new Columbian cent from his partner, " Homer," and, having placed it between his patient's teeth, he prayed that Charon might successfully ferry him across the hated river. But a greater surprise was in store for him. Belshazzar glanced toward the wall, and there an unknown hand was busy tracing, in bold hieroglyphics, the following terrible words: " Take him up town, set up the ice-cream, and get a Freshman to sleep with him." Only too thankful to follow some kind of directions, Belshazzar complied with the strange request, and the next day his patient was fully restored. Billy's scientific aspirations are now buried in the depths of the " Tiber." Like many other would-be scientists, he will eke out his exist-ence only as a disappointed and heart-broken man. But, what is still harder to bear, he has learned that the human heart is desperately wicked and deceitful above all things. The whole thing was a farce, for his partner was in league against him, and the joke was only brought to a beautiful termination by " Sister's " apparent innocence. " SUPER." AN EPISODE. He went to hear the phonograph, With her upon his arm ; He entertained her with his laugh, She with her eyes did charm. And when, the entertainment thro', They homeward took their way, They did not cease to laugh and coo, And much they seemed to say. She lolled her eyes, until her glance Beamed on his lovely face; And then, by some peculiar chance, Unknown to such a case, He turned and met those lifted eyes, And smiled his sweetest smile; For he did naturally surmise She loved him all the while. But next day, when the sun was bright, She, with those eyes of blue, Her lover had forgotten quite; For light made love untrue. Tho' in the dark she favored one, Yet, when it did come day, Round in the tennis-court she'd run And shout " Love thirty-Play." A. H. B., '96. SPECIALISM: ITS NECESSITY AND ITS DANGER. FIELDS of work, like fields of grain, look all green from a distance. In the general view, which is all that we commonly get of a science or an art, it is attractive, and like Hamlet we are apt to see the charms of each path so clearly that we are loth to choose one and forego all the rest. There is nothing more delightful than to take such peeps into the treasure boxes of knowledge as the maga- | zines afford. But not in such a way can one become the owner of a jewel or even tell the diamond from the paste. Yet it is often said that the periodicals are convenient forms in 6o; THE COLLEGE MERCURY. which to get the information that makes a " well-rounded man." Nothing more false! The well-rounded man is not the one who is symmetrical because of equal supcrficialty in all parts of his mind. For making a fine im-pression it is enough to converse about books which have been reviewed in the Pacific Monthly, but the habit is weakening to intellect and character. This is somewhat from the subject, but is a plea for the " man of one idea " over against the dead-level man of no idea. It is often said that a man never again knows so much as he did when he was a Senior at college, and it is because a man reaches the period then when he has just looked into the open gates of history, science, language and literature, and sees beautiful vistas of trees laden with ripe fruit. He has not yet learned of the labor of which he sees the result. He offers immense chunks of wisdom from what department you will, but after a while he begins to see that he was borrowing, and that he did not under-stand whereof he spoke. Then he wants to know something. One says to himself, I will pursue Science, and then decides that a life-time is too short for that, and says, I will learn Geology, and finding that too large, seeks to find the language of fossils. At last he begins to know something. Another will sacrifice all else to History, but how can he for himself find out anything when so much ground is to be covered ? He narrows himself to the history of Italy, but again he must take his knowledge second-hand, and finally, when he has become modest enough to confine himself to Florence or Venice, he says, this one thing I can know. And then a man becomes a power. Then he can be something more than a sponge, and leave a mark to show where he has been. Nature holds more truths ready for the dis-coverer than she has given up to Darwin. The world is learning fast, and it seems that it is learning so many new things that old tradi-tions cannot give way fast enough. Perhaps, j therefore, there will be a pause in religious in-vestigation until the Church can chew the large bite thrust into its mouth. But the energy will go into some other department. Deep dark-ness is all around us. Exploring parties go on in one direction until they are frightened by the distance they have come, then wait for the rest of men to come and occupy. Hut while they rest another party of specialists is en-larging the lighted area in another point, and so, by each individual working away at his one idea, the people get more light. It is surprising how much can be done in the knowledge of books by those who can give only surplus of time to them, if the study is specialized. Most of those who know why Shakespeare is the greatest poet that ever lived have read him from their youth up. He has been a companion of many men all through life. By giving themselves up to him, and growing into him, they have learned the secret of his greatness, have known him. What can be gotten from reading tons of criticism and ephemeral talk to compare with this intimate acquaintance with one or two great minds. By such specialization a man is developed. He reads literature as it ought to be read, namely, as thing inseparable from living, and not as a literary exercise. Hence he will be free from pretentiousness. One result of the other method is to tempt to a display of knowledge which is only on the surface. " Knowledge comes, but wisdom lingers." Objections are heard to specialism and specialists. It is said that those who give a great part of their time to either art or the pursuit of knowledge become self-absorbed, absent-minded, and egotistical. It ought not to be so. If it is the case, they are getting more than they can digest. They are apply-ing more to the surface than can be absorbed into the inner man. Ambition often drives the worker to this forcing process, and it can-not fail to have evil effects on his character. This, then, is a danger of specialism ; this is the abuse of the good thine. The man ought THE COLLEGE MERCURY. 61 PROOF-READING—MENTAL AND MORAL. to grow with his work. No matter how special his department, his acquirements ought to spread their influence through his nature j and leaven the whole. If, on the other hand, it takes the form of an outside excrescence, not only is it valueless, but also, as we are naturally more vain of the things we have ac-quired than of those we have by nature, the student fails to recognize it as a deformity, and feels pride in his borrowed glory. It is the old story of the peacock proud of his voice, j But this is only when conditions are abnormal. ' Healthy work on a chosen subject makes the mind broader, opener, greater in every way. It makes a man more capable of friendship and of higher feeling ; it raises the plane of his life. The man or woman who knows one thing has an anchor. He is no longer the slave of every doubt. He need no longer be a led-horse. He has some equipments for fighting the bat-tles of his own mind and for facing the ques-tions which assail every man. M. W. CROLL. TO the uninitiated eye, there is an air of deep mystery about the mutilated text and hieroglyphic margin of a corrected proof-sheet. The ranks of printed words have a grim and battle-scarred look, like a veteran regiment with tattered flags and ragged uniforms ; the gaps left by fallen comrades are not yet filled, and many of the survivors bear abiding marks of the stern conflict through which they have passed. The marginal corrections, in every variety of curve and angle, irresistibly suggest the bursting bombshells and bayonets keen of thrust which have wrought such havoc in the brave array. But these are only fancies ; and our supposed observer, being presumably of a practical turn of mind, soon seeks to discover a more intimate i relation between the text and the corrections —the casus belli, so to speak, which has occasioned this pitiless decimation of the soldierly ranks. A comparison of the marks in the text with those on the margin soon reveals the purport of the strange hieroglyphs, and the investigator sees how, by means of a few strokes and letters, omissions are supplied, confusions rectified, and intruders expelled, all with a view to the ultimate perfection of the text. A brief inspection will probably suffice to convince him that proof-reading is a very easy thing indeed. Yes, the typographic symbols of the proof-sheet disclose at least a part of their meaning without much difficulty to an intelligent observer; but to the mind of one who com-bines some degree of experience with his observation, the same lines and curves have another story to tell. To him they speak of that eternal patience which is yet not genius:— that patience which scans and scans again the printed lines, striving to detect the smallest error, until it seems that not so much as the ghost of a mistake can lurk within the tangled maze of words ; that patience which even then is not satisfied, but still scrutinizes each sentence over and over, going beneath the mere form of the words, not content until it has endeavored at every doubtful point to fathom the author's meaning, lest some mis-placed phrase, some intruding word, some omitted sign, should obscure the thought and frustrate the purpose of the writer. Such is the patience which perhaps of all patience sees the least result of its own toils, and has least confidence in the correctness of its own work— the keen-eyed patience of the proof-reader. But this is not all that the proof-sheet sug-gests. Strangers though most of us may be to the actual task of correcting proof, we are daily and hourly applying the methods of the proof-reader to the products of our mental activity and to the conclusions of our judg-ment and experience. The more we learn, the more deeply do we realize how much of our knowledge and belief is merely tentative—how frequently our opinions must be altered and revised, and how few of them can be depended 62 THE COLLEGE MERCURY. upon as absolutely correct in every particular. Even what we call facts are often largely relative, and the slightest change of circum-stances may introduce variations which will overturn our most careful inductions and dissipate our most ingenious theories. There is in almost all our thinking an element of un-certainty similar to the feeling of the proof-reader— a doubt that lingers after the most painstaking revision, and questions whether there may not still be somewhere an un-detected error which must be discovered and eradicated before the opinion or system of thought can be trusted. While it is unworthy of a rational being to accept a belief without good reason for its entertainment, it is equally irrational to close the mind against conviction, and to refuse, either from obstinacy or from indolence, to revise an opinion whose faulti-ness has been shown by the light of increased knowledge. The man who would rather think wrongly than incur the trouble of correcting his thinking needs to take a lesson from the proof-reader. Not only must our opinions be ever open to revision, but a similar method must be pursued in the developing of character. Our lives are not what the Author of our being intended them to be. An adverse force has twisted and marred and spoiled them, yet so artfully that we do not recognize it until we test them by the standard of the highest Truth—the only truth which is absolute. Then we cannot help seeing how faulty and incorrect our lives really are ; but it is so hard to change them ! An uncorrected proof-sheet looks so clean and fair beside the scarred face of a sheet that has been revised! As long as one does not read the former closely, the mistakes will not be noticed ; and so we are tempted to think that no one will mark our shortcomings unless our correction of them draws attention thereto. And these are the hardest of all errors to remedy—hardest to detect and hardest to elim-inate ; but if we would be true to our highest interests, we must not evade the task. We need not always perform it alone. A proof-sheet has far more chance of being correct if several readers have perused it; for one may detect what another has missed, and a third may notice what has escaped the others ; and so it is in moral proof-reading. " In the multitude of counselors there is safety." Not all persons, indeed, are willing to tell us of the faults they see in us; but as long as there are candid and truthful souls on earth, we need not fear that we will be left in utter ignorance of our defects. Happy are we if the lips that tell us of our faults be friendly ones. Nor is this the only assistance that we have. The author of a production is best qualified to read its proof, since he is so well acquainted with the form and sense of the original; and in reading the proof of our lives, we may always have the assistance of the Author, if we will. And when, at last, every error has been rectified, the corrected pages will not be allowed to remain marred and mutilated, any more than the finished book is composed of the disfigured proof-sheets. The final copy will be not only correct, but clean and beauti-ful as well; and the Author, seeing His pur-pose wrought out and His thought expressed in all its pristine perfection, will pronounce it very good. M. R. H., '94. PAPA H 'S SOLILOQUY ON THE DAY THE KEE-MAR GIRLS WERE HERE. To go, or not to go, that is the question :— Whether 'twill be better in the end to go With the pretty Kee-Mar girls from Hagerstown ; Or not to go, and run the risk that they will Think us slow: That must not be; too slow; but yet, If I should go, what would Miss H J say ? Would She permit me thus to flirt the whole day long With pretty Kee-Mar girls, and not object ? If She were only out of town to-day;—this day; That's a consummation devoutly to be Wished; but, then, she isn't—ay ! there's the rub. Dear me ! Now I almost wish that I had never gone To Middle Street until this day had passed. But Yet, we cannot always look ahead to times Of so great moment; and now I must decide. THE COLLEGE MERCURY. 63 When such grave questions stir the souls of men, No wonder that we hesitate. If I were (Inly familiar with such questions, 'twould be Far different; but as I've never gone with The girls before this year, I don't know what to Do. But, then, I am a Senior and that makes Up for all deficiencies, and Miss H will Not jilt me; for, if she did, who would translate Her Latin lessons? But conscience does make Cowards of us all. I have decided. I'll go, and if the boys Do tease me, I'll not mind it. Ha! ha! Yes, that Reminds me of a fox and a grape story I once read. 1 fully realize that I am risking Much ; but this is an opportunity of A lifetime. Some of my Kee-Mar friends are from Washington, and quite elite, you know ; much so, Tis said. And as I am a Senior of our Beloved G. C, perchance I may—, but I won't Soar too high, lest with broken pinion I fall Back crushed. But what's the use of further meditation. The die is cast. I am resolved to go. COLLEGE LOCALS. ALBERT S. COOK and SUMNER R. MILLER, Editors. AT last the long-expected and much-talked-of visit of the Kee-Mar girls to historic Gettysburg is an event of the past, and the College boy consoles himself, while he nurses his empty wallet, by thinking and talking of the fair one whose guardian angel he was on that glorious day, Saturday, May 13th. Ever since the Musical Clubs were at Hagerstown, this proposed visit has been looked forward to with the greatest pleasure and expectation. The boys were royally re-ceived and entertained by the ladies of Kee- Mar, and they were only too anxious for an opportunity to return the kindness shown them there. The disappointment of the previous week increased this desire, for it had caused many bitter sighs and " weeps." All was excitement here on the morning of May 13th. Nearly all the boys were dressed in their best, and some of those who had never been known to " dress up," except on Sunday, were " sporting around " with the others. The Kee-Marians owned the battle-field, the town, the college, the boys, " and all the ap-purtenances thereof." The fellow who didn't have a girl wasn't "in it." Many were the hearts that were broken and the tears that were shed on parting ; but the boyshavemany mementos of the happy time in the shape of photographs, etc., which will ever be a source of pleasure to them. Dr. Keedy, whose kindness made it possible for the boys to have a good time, is most warmly praised, and their fondest wishes are that he may long continue to be President of Kee-Mar College, and often repeat the visit of May 13th. On Monday, May 15th, the ladies of Wilson College, Chambersburg, visited Gettysburg. Dr. Edgar loaded the girls into hacks outside of town and did not permit the boys to get near them. It was very considerate on his part, as the boys were all "dead broke," owing to the visit on the Saturday before. Examinations are rapidly approaching, and the Seniors are busily engaged on their Com-mencement work. The general inclination of the boys for the past week or two has been to imprecate the weather, and rejoice over the absence of several members of the Faculty. 'Rah ! 'rah ! 'rah ! —'rah ! 'rah ! 'rah ! Penn-syl- va-ni-a! was replaced by 'rah ! 'rah ! 'rah ! 'rah ! 'rah ! 'rah ! 'rah ! Gettysburg ! at a recent mass meeting of the students in Brua Chapel, April 29th. A second yell, Hoo-rah ! hoo-rah ! hoo-rah ! Get-tys-burg-i-a ! was also adopted. The value of having several yells was demonstrated during the Dickinson game, as was also the necessity of practicing them before trying to give them. It is rumored that some of the boys find more than flowers on their botanical excur-sions. Grave charges against some of the pro-fessors have been floating around the college during the last few weeks. They are accused of having stolen " horses " in broad daylight during the late racing season, and their owners declare that they continue prowling around their stables. Let the owners of " blooded stock " keep a sharp lookout lest their " record-breakers " be led away during the coming races. We suggest that the owners build hedges around the entrances, and fill the inter-vening spaces with (k) erbs. He was wheeling the carriage along the back streets, the while talking to a pretty com- <*4 THE COLLEGE MERCURY. panion, and one naturally made a slight mis-take, but the occupant of the carriage belonged to a different duffer. Dr. N.—" Gas tends to escape from open vessels, because it is lighter than air." S., '94.—" Can't you keep it in by putting a cover on the bottom ?" B-» '93-—" I think we will have a thunder-storm to-day—I feel it in my head." —, '95 (unconsciously).—" Your head must be a little bar(c)ometer." The latest chestnut.—" Pappy, when will the invitations be here ?" The next latest.—" Ben, when will The Spectrum be out ?" " Good-morning, Mrs. Smith." " Good-morning." "Any ice?" "No ice." "No ice? Get up J" Prof H.(in rhetoric).—" What is the theme ?" H., '95 (after thinking awhile).—" The theme of what, professor ?" E., '95, wishes to inform his friends and classmates that he has a large supply of " in-dices rerutn " on hand. • B.,/95, junctive?' -" Doctor, what tense is that—sub- L, '94 (just finishing speech on " Cleve-land's Cabinet").—"Professor, I forgot Mr. Smith, shall I bring him in now ?" Prof. H.—" Yes, bring him in." R, '94 (translating " Die Friede wohnt in diesem Kleide ").—" In this garment priests-beasts dwell." W., '95 (translating Homer's description of Thersites).—" There was a very ugly man came from Troy. He was cross-eyed, and his other foot was lame." Dr. N.—" Mr. C, put the multiplication table on the board for me." C-i '95-—"Doctor, I don't just know what you mean." Dr. H. (in English Bible).—" Mr. H., can you give me the etymological meaning of ' transgress ?' " H-, '95-—" Handed down from generation to generation." R., 95.—" Say, Jones, where is your hornet? I want to serenade my girl to-night." S., '94 (learnedly discoursing at table).— " Yes, the German pheasants eat rye bread and are healthy." Miss B., '96.—" Look here! this book tells you ' How Plants Grow—Gray'—that must be interesting." Dr. N.—" If I should throw a piece of chalk-up in the air, would it start a train of thought in your mind ?" N., '94.—" I don't know, Doctor." We are pleased to inform all that Nick has resumed his cordial relations with Grand-mother Pitzer. Dr. B.—" Marriage is of much more import-ance than most people make it." " Homer" (emphatically—just rousing from a day-dream).—" That's right." W., '95.—" I do wish Hill would pitch some of his straight curves." Dr. N.- Mr. Kemp, what is 'specific gravity ?'" K., '94.—" Pacific gravity is when a body is in motion it remains in motion, and when at rest tends to remain at rest."—Kemp studied Neptune's Oceanic Physics before coming here. A Senior says he has a dim idea how it goes for a woman to put up her hair. We gu(e)ss he does. Dr. S.—"What are warm-blooded ani-mals?" E., '96.—" Quadrupeds, such as men and birds, are said to be warm-blooded animals." E., '96.—" I have been out to Culp's Hill all morning." S., '96.—" Looking for flowers ?" E., '96.—" No, bullets don't grow on flozucrs!' Dr. H.—" How did Aaron excuse himself for making the golden calf?" L, '96.—"And Aaron said: 'The people brought their earrings to me, and I put them in the fire, and there came out a golden lamb! " The following letter was sent to Philo. Society by O. W. Holmes as a letter of en-couragement to its members. Mr. Kuhns, who solicited the autograph, deserves high praise for his wide-awake activity in behalf of his society. THE COLLEGE MERCURY. 65 BOSTON, May 6th, 1893. DEAR SIR :—I am much pleased to hear that the students of Pennsylvania College are diligently studying the best authors of their country, and, if by their indulgence my name is found among them, I will trust it to their charitable judg-ment. It is well that they should read French and German—that they should study the Greek and Latin classical writers, but best of all that they should be well acquainted with the mas-ters of their own language—for the only tongue a man thoroughly knows is the one he learned to speak through his milk-teeth. With heartiest good-wishes, yours very truly. OLIVER WENDELL HOLMES. Y. M. C. A. NOTES. On Saturday evening, May 20th, in Brua Chapel, Mr. Walter Pelham gave his excel-lent and amusing character entertainment, under the auspices of the Lecture Course Com-mittee. The audience received, with great ap-plause, the renditions of this celebrated im-personator. The Association has authorized delegates to be sent to the Northfield Training School, and it is probable that we will be represented also at the Lake Geneva (Wis.) School. The efficiency of the local work of our Y. M. C. A. would be greatly increased if we were provided with a separate building for Associa-tion purposes. The need of such a building has been felt for some time, and a Building Fund has been slowly accumulating. We believe the cause is worthy of outside help, and all receipts from Alumni and friends will be gratefully acknowledged. Among other things of interest to the As-sociation, the delegates to the Carlisle Confer-ence of Y. M. C. A. Presidents report that our Association has a larger percentage of students engaged in systematic Bible study in classes than any other institution represented at the conference. This shows the result of the earnest and repeated efforts in this line, and is most gratifying. But from the same source we learn that our work in the cause of Christian missions has not come up to a desirable standard. It is earnestly hoped that more active interest will hereafter be taken in the cause of missions. There is need for men to carry the Gospel to the young men of foreign lands who are with-out the blessings we enjoy, and the obligation largely rests upon us. The men are ready to go, the one thing needful is funds to send them. The attendance at the devotional meetings still continue to be good, and the meetings are made both interesting and profitable. Let us all put forth every effort to keep up the good attendance during the remainder of the term, and the good results will be veiy apparent. PENNSILFAUNISH DEITSCH GESELLSCHAFT. Schon etlicha yohra hen die Studenta g'schwetst fuhn en Pennsilfaunish deitsch societie ufgriega; aber es is alia mohl darich g'falla; die Ursach wahr das sie gemehnt hen dass es net 11 f g'halta sie kennt. Now des wahr all g'schwets. Sie hen ahner a dinger uf griega kenna un die hen auschalda, un fer-was net soh eppes. Aber sacha sin now ahnister. Letscht Dinshtag Ovet, der 23sten Moy, sin sechtza deitsha tzamma komma im Briider Bortner sei Sthup undhen en organ-ization g'formed. Die sin Charter members. Es wahr en enthusiastic meeting. All die members missen deitsch schwetsa kenna, un kenn English wort is erlaubt im meeting. Die object fun die verein is, ehrst, das wir Deische, unser Mutter sproach net gohns fergessa sol-len; un, tzwet, dass wir tzamma sticha sollen in en binderlicher weg. Die officers sin: President, Briider Bortner; Vice-President, Briider Ibach ; Secretary, Briider Newcomer ; Treasurer, Briider Kump; Gahrt, Briider Menges. Die charter members sin Briiders Dundore, W. H. Ehrhart, Uhler, Ibach, Nicholas, Rudi-sill, Becker, Nipple, Newcomer, Kump, Meisenhelder, Menges, Danner, Smith, Hain, Bortner. Professor (looking at his watch).—"As we have a few minutes I shall be glad to answer any questions that any one may wish to ask." Student.—" What time is it, please ?"—Ex. 66 THE COLLEGE MERCURY. ALUM/SI. FRANK E. FICKINGER, Editor. WITH this number of THE MERCURY, a new editor of this department appears before you. It will, perhaps, be necessary to say nothing more than to reiterate the words of the former editor, in outlining the aim of the Alumni Department to be that of keeping the former graduates in closer touch with one another, with the undergraduate, and, in chief, with their A/ma Mater, and likewise to repeat his requests, earnestly soliciting all proper in-formation, both concerning yourselves and others, that you may be disposed to give. Let the Alumni Association at its Commencement meeting not fail to elect a wide-awake inter-ested man as Alumni Editor. The success of THE MERCURY depends in great part upon the attitude of the Alumni toward it, and we would therefore most earnestly hope for your hearty co-operation, sanction, and support in the June meeting. We trust we will not be disap-pointed. We are pleased to learn that the class of '78 will hold a reunion in Gettysburg, with a banquet at McCullough's cafe, on Tuesday evening of Commencement week, June 20th. Other reunions are being talked of, but as yet nothing else authentic has come to our ears. Let us have a large representation of the Alumni with us this year. Your presence is inspiring both to the professors and to the students. '39. Rev. Dr. C. A. Hay, of the Seminary, delivered the address at the laying of the corner-stone of St. John's Lutheran Church, Steelton, on Sunday. '39. Rev. P. Willard, now at Mexico, Pa., is writing a history of the Orphans' Home at Loysville, Pa., of which he was the founder and for many years the superintendent. '44. Rev. P. Anstadt, D. D., of York, Pa., will install his son as pastor of the Lutheran Church at Bedford, Pa. '48. Hon. Edward McPherson, one of the executors of the estate of the late Hon. Thad-deus Stevens, filed his report the early part of May. The bequest of $1,000 to Stevens Hall (the Preparatory Department of our college), is sustained with interest. '49. Judge Wm. McClean began his series of lectures to the Senior class on Constitutional Law last Wednesday, the 24th ult. '51. Hon. David Wills, of Gettysburg, was in attendance as delegate from the Carlisle Presbytery at the General Assembly of the Presbyterian Church which convened recently in Washington, D. C. '53. Rev. P. Bergstresser, of Middletown, Md., will not remove to Chicago as stated in the last number of THE MERCURY. '55. Philadelphia, Pa.—The day for the dedication of the new Calvary Lutheran Church, Rev. S. A. Holman, D. D., pastor, will doubtless be fixed for Sunday, June 18th. '55. Rev. Dr. Huber, professor and chaplain in the college, contemplates building a resi-dence this season on his lot, on the northeast corner of Carlisle and Lincoln Streets. '57. President C. L. Keedy, of Kee-Mar College, Hagerstown, Md., has been appointed Vice-President of the Department Congress of Higher Education to be held at the World's Fair. On May 13th, the doctor, with a party of 35 of his charming students, visited the battle-field. The Kee-Mar girls and the Get-tysburg boys are always on the best of terms, so of course—well, you know—everybody had a nice time. '59. On Sunday, May 7th, Rev. J. G. Goett-man, D. D., pastor of Trinity Lutheran Church, Allegheny, Pa., preached the third in a series of inter-denominational sermons in progress in that city on " Why am I a Lutheran ?" The Doctor's congregation has arranged for an excursion to Gettysburg in June, to be present at the college Commencement and to view the battle-field. '61. Bethlehem Lutheran Church of Har-risburg, Pa., has extended a call to Rev. I. C. Burke, of the Third Lutheran Church of Baltimore, Md. Rev. Burke has been pastor of the latter church for sixteen years. '61. Rev. J. R. Williams, of Uniontown, Md., has received and accepted a call to the Millers-town charge, Chicora, Pa., and will begin his labors June 1st. '64. Rev. H. J. Watkins, pastor of the Luth-eran Church at Lockport, N. Y., recently cele- THE COLLEGE MERCURY. 67 brated his 55th birthday, when he was pleas-antly surprised by a visit from the pastors of all the other churches in the city, accompanied by their wives. The evening was spent in a most enjoyable manner. '65. Dr. McKnight, from latest advices, is at present in Paris, having left the Mediter-ranean coast very much benefited in health. The time, till June 8th, when he sails from Southampton, will be spent in sight-seeing. His full and complete recovery is earnestly and universally hoped for by the students. '67. Rev. Charles S. Albert, D. D., of Balti-more, Md., was elected president of the Gene-ral Synod, lately in convention at Canton, O. '67. Rev. W. E. Parson, D. D., has been secured to deliver an address at the Chicago Lutheran Congress on " Liberty in the Luthe-ran Church." '68. Rev. D. L. Mackenzie lately had an article in the Sioux City Times, entitled " Now and Then." '68. We were pleased to greet on our streets, the latter part of April, Rev. R. F. McClean, formerly of New Bloomfield, Pa. (pastor of the Presbyterian Church), but now located tempo-rarily in Carlisle, Pa. Sunday evening, April 30th, the reverend gentleman preached a most excellent sermon in the College Church. '68. Rev. J. W. Richard, D. D., of Gettys-burg, Pa., will next year deliver a course often lectures on Ecclesiastical Architecture. These lectures will treat of the history and develop-ment of the Roman, Gothic, and Italian archi-tecture. '69. The opening sermon of Rev. J. A. Clutz, D. D., the retiring president of the General Synod, was published in full in the Lutheran Observe}-, and is a masterly produc-tion. Dr. Clutz has been invited to deliver an address before the Lutheran Congress at the World's Fair. '70. The Board of Directors of the German Lutheran Theological Seminary, at Chicago, have elected the Rev. G. F. Behringer, A. M., of Saddle River, N. J., professor of Systematic and Exegetic Theology in that institution. '71. Rev. D. T. Koser, of Arendtsville, Pa., with his brother, A. S. Koser, of Muncy, left home the latter part of May for an extended trip to California and through the West. '71. Rev. W. H. Dunbar, D. D., of Leba-non, Pa., will preach the Baccalaureate sermon to the graduating class of the college on Sun-day, June 18th. Rev. Prof. Jacob Yutzy, '76, of Selins Grove, will deliver the annual address to the Y. M. C. A., on the evening of gradua-tion day. The Alumni address will be deliv-ered on the evening of June 21st, by Mr. Sterling Valentine, Ph.D., '82, of Lebanon, Pa. '73. Rev. Philip Graif's congregation at Oakland, California, will in a few days break ground for their new church edifice, which will be exceptionally handsome. '74. Rev. F. W. Staley, of Middletown, has been appointed by the General Synod as its fraternal representative to the next meeting of the General Convention of the Reformed Church in the United States, to convene in Reading, Pa., May 24th, 1893. '74. Rev. J. A. Wirt, of Hughesville, Pa., was here in attendance at the funeral of his father-in-law, the late Alexander D. Buehler. Rev. Wirt will preach a sermon to the Y. P. S. C. E., of Irving College, Mechanicsburg, June 4th. '75. Rev. E. G. Hay, of Pottsville, Pa., visited his parents in Gettysburg during the first of May. '76. Rev. S. E. Smith, of Newport, Pa., after the General Synod, will spend several months in the West. '79. The corner-stone of St. Matthew's Lu-theran church, on the Manor near Buckeys-town, Md., was laid in the presence of a large congregation on April 23d. The sermon was preached by Rev. Luther Kuhlman, of Fred-erick, Md., president of the Maryland Synod. Rev. A. H. Burk is pastor loci. '79. J. B. Raby, Esq., formerly corporation lawyer for Frick Co., Waynesboro, Pa., has opened a law office in that city as a practic-ing attorney. '80. Rev. A. H. F. Fisher, wife and son, of Barren Hill, Pa., spent a week in Gettysburg the latter part of May, visiting Mrs. Fisher's mother, Mrs. Picking. Mr. Fisher speaks in terms of the strongest commendation of his people at Barren Hill. 68 THE COLLEGE MERCURY. '80. The corner-stone of Rev. M. P. Hook-er's new church edifice at Steelton, Pa., was laid on Sunday, April 30th, amid large crowds and imposing ceremonies. '80. Rev. L. B. Wolf, President of the Watt's Memorial College, Guntur, India, ar-rived in Gettysburg, Wednesday evening, May 17th, after an absence of five years. After a few days' visit among friends and relatives, he repaired to the meeting of the General Synod, leaving his family here. '82. Messiah Lutheran Church, Philadel-phia, Pa., of which Rev. M. H. Valentine is pastor, at a recent effort, raised $2,000 toward making repairs and alterations in the church edifice, which was damaged by fire several months ago. '82. The Pennsylvania Lawyer, containing abstracts of the laws of Pennsylvania, and of the postal, patent, copyright, and pension laws, with legal and business forms, is a new book-by W. C. Sheely, Esq., of this place. It is published by L. G. Firestine & Co., of Mechan-icsburg, and sold by subscription at $4 and $5 per volume of about 700 pages. '83. The Second Lutheran Church ofJohns-town, Pa., Rev. G. W. W. Amick, pastor, has built a parsonage for its pastor. '83. Rev. Wm. W. Anstadt, pastor of the Lutheran Church at Bedford, and Miss Mary Alice Hantz, were married at the residence of the bride in York, Pa., on Wednesday evening, May 3d. The ceremony was performed by Rev. P. Anstadt, D. D., '44, father of the groom. '83. Rev. H. L Yarger, of Lawrence, Kan., will address the Y. M. C. A. at Midland Col-lege, June 7th. '84. The work of Rev. L. M. Zimmerman, pastor of Christ Lutheran Church, Baltimore, Md., has received the highest commendation at the hands of the city papers. The Balti-more Herald, of May 7th, contains a three-column review of his six years of labor there. '85. Rev. L. E. De Yoe, pastor of the Mes-siah Lutheran Church, Harrisburg, Pa., preached a sermon to the G. A. R. posts of that city on Sunday, May 28th. '85. We congratulate Mr. S. S. Neely, Esq., on his appointment by the Government as statistical agent of the State for the Agricul-tural Department. Mr. Neely's duties in his new position will not be of a very onerous nature, we understand, while the attendant salary is quite a lucrative one. '86. Rev. Prof. O. G. Klinger, principal of the Preparatory Department, spent a week in New York, recently, in the interest of the col-lege. '87. Hagerstown, Md.—Rev. S. E. Bateman, pastor of St. Mark's, has been called to All Saints, Philadelphia. His success in building up a new congregation, and erecting in a grow-ing part of the city an attractive and comfort-able chapel, has brought this popular and efficient worker into deserved prominence. '87. Rev. W. F. Steck, having accepted the call extended to him by the Lutheran congre-gation of Port Royal, Pa., has left the people of his former pastorate amid universal regret. May success attend him in his new field of labor. '88. The Church of the Reformation, Balti-more, Md., of which Rev. D. Frank Garland is pastor, was dedicated on Sunday, May 21st. The exercises consisted of a dedicatory ser-mon at half-past two o'clock, by Rev. J. W. Richard, D. D, '68, of Gettysburg Theological Seminary, and a sermon at eight o'clock in the evening by Rev. J. G. Morris, D. D., LL D. Short addresses were made by the pastor, by Rev. Charles S. Albert, D. D., '67, Rev. H. F. Kroh, '84, and others. '88. Rev. C. A. Hoy, Orrstown, Pa., reports having resigned his charge on the 21st inst, to accept a new mission congregation in south-east Philadelphia. '89. Rev. S. J. McDowell was installed as pastor of Emmanuel's Lutheran Church, Fries-burg, N. J., on Sunday, April 16th, by Rev. Dr. Enders, of York, Pa. This is one of the oldest Lutheran churches in America, having been founded nearly two hundred years ago. Mr. McDowell is performing an excellent work among his people, and has earned the esteem of the entire community. '90. C. B. Fager, Jr., Geo. B. Kunkel, and Wm. H. Ulsh, received their degrees of M. D. from the University of Pennsylvania, on May 10th. We expect the gentlemen to be with us Commencement week. THE COLLEGE MERCURY. 69 '90. L. M. Kauffman, lately graduated among the first in his class from Bellevue Hospital Medical College, is practicing his profession with his father at Kauffman, Pa. He was offered a hospital appointment, but declined. '90. Rev. N. E. Yeiser and wife, recently-sent by the General Synod of the Lutheran Church as missionaries to India, arc for the present living with Dr. Kugler and Miss Fannie M. Dryden, two lady missionaries who have been there some time. '91. D. A. Buehler, now with the A. E. Footc Co., wholesale dealers in scientific books, Philadelphia, Pa., was at home in attendance at the funeral of the late Alexander D. Bueh-ler. '92. We were glad to greet again on the campus, recently, Mr. H. H. Jones, who has spent the past year in the Medical Depart-ment of Maryland University; also Mr. E. J. Cook, an ex-member of '92, who has been, during the past year, principal of Bel Air Academy. Mr. Cook expects to study law after taking a short trip to the World's Fair this summer. '93. Mr. M. C. Wright, formerly of the class of '93, in Gettysburg College, graduates this year in the regular classical course at Michi-gan University, Ann Arbor, Mich. '94. Mr. J. H. Fichthorn, who left Gettys-burg at the end of Freshman to enter Cornell, has been compelled to forego attending college, during the past term, from weakness of the eyes. '94. We were pleased, indeed, a few days ago, to once more greet Mr. R. E. Miller, who the past year has been taking private tutorship at home, under the able direction of Mr. F. E. Metsgar, '88. Mr. Miller expects to join his class again at the opening of next year. F-RATEKMITy /NOTES. PAUL W. KOLI.ER, Editor. PHI KAPPA PSI. Our symposium will be held on Wednesday, June 21st, at the Eagle Hotel. Bros. Clayball and Stitely, of Westminster, Md., helped to cheer our base-ball team on to victory during the recent game at that place. Bro. Keefer, Secretary of I. C. A. A., at-tended a meeting of that body, held at the Bingham House, Philadelphia, on May 20th. Bro. Hill, of town, paid our Chapter a visit recently. Bros. Turner, Keefer, Witman, and Russell are entered in the tennis tournament. PHI GAMMA DELTA. A new Chapter (V 7) of Phi Gamma Delta has been chartered at Trinity College. Bros. M. G. L. Rietz, '95, and Howard M. Plerr, '97, were initiated on Thursday, April 27th. We enjoyed a short visit lately from Bro. Fred. T. Howe, Ph. D.,of theBeta Mu (Johns Hopkins) Chapter, and editor of the Phi Gamma Delta Quarterly. " The Religious Element in Man " is the subject that has been assigned Bro. Blint, '90, for his Commencement thesis. Bro. Hoffcr, '94, represented us at the Pennsylvania State Convention of Phi Gamma Delta which met at the Wyandotte Hotel, South Bethlehem, Pa., May 4th and 5th. Measures are being taken for the establish-ment of an Alumni Chapter at Pittsburgh, Pa., and it is likely that a charter will be granted in the near future. Bro. David A. Buehler, '90, who at present is with the A. E. Foote wholesale scientific book firm, was in town to attend the funeral of his uncle, the late Alexander D. Buehler. PHI DELTA THETA. Bro. Cook, E. J., Principal of Bel Air Acad-emy, Md., was the guest of his brother over Sunday last. Bro. Maynard, '95, was initiated into the mystic brotherhood on the 20th inst. Bro. Gilroy, of Dickinson College, recently spent a few days in our midst as the guest of Pennsylvania Beta. Bro. Brallier will have the honor of being the Latin Salutatorian at the coming Com-mencement exercises of the class of '93. ALPHA TAU OMEGA. Bro. John W. Cable, Jr., '97, of Smithsburg, Md., was initiated April i8th, 1893. 7° THE COLLEGE MERCURY. Bro. Gco. A. Kyner, '89, attorney-at-law in Chambersburg, Pa., paid Gettysburg a fly-ing visit lately to see old friends. Bro. H. H. Jones, '92, who has been pur-suing a course of medicine at the University of Maryland, Baltimore, visited his Alma Mater on his way home. Bro. H. W. Jump, whom all will remember as the very able trainer of last year's success-ful foot-ball team at Gettysburg College, lately graduated from the medical department of the University of Pennsylvania. SIGMA ALPHA EPSILON. On the evening of the 10th inst, Pennsylva-nia Delta, the first chapter established north of the " Mason and Dixon line," was re-estab- Jished at our institution with the following charter members : John C. Grimes, '93 ; Geo. D. Danner and Jas. T. Povall, of the Fresh-man class, and Wm. R. McCartney, '97. Bro. Danner, '96, attended the Commence-ment exercises of the High School at his home, Manheim, Pa., on the nth and 12th of May. He presided over the annual meeting of the Alumni Association on the evening of the nth, held in the Reformed Church. Bro. Chas. G. Smith, '97, of Beaver Springs, Pa., was initiated on the 27th of May. Sigma Alpha Epsilon, of Gettysburg Col-lege, sends greeting to THE MERCURY. May it ever be a thorough representative of our in-stitution. Thanks to members of our sister fraternities for their congratulations. ATHLETieS. H. E. CLARE, Editor. THE present base-ball season opened April 29th with unprecedented interest. The team by its admirable playing has aroused general enthusiasm, each succeeding game raising the interest to a higher pitch. So far not a game has been lost, and the expecta-tions of the most ardent have been gratified. The sincere hope of THE MERCURY is that the season may close as auspiciously as it has opened, and from present indications we feel safe in saying that this hope will be realized. The first game of the season was played on the home grounds Saturday, April 29th, with Franklin and Marshall, but, owing to the in-clement weather, the teams were unable to play upon the grounds until 3 p. M., and as the visiting team was compelled to leave for the train at 3.30 P. M., the game was called in the second inning. Enough was seen to show what the home team could do, the score when the teams ceased playing being: Gettysburg, 11 ; Franklin and Marshall, o. On May 6th, the Indians of the Carlisle Training School played with our team on out-home grounds. The game was very close and interesting, especially during the first six inn-ings, neither side having scored a point. Then the tables turned, and the home team, by superb playing, scored six points and won the the game. Annexed is the score : GETTYSUUItG. INDIAN SCHOOL. Gies, c. f., . . Nicholas, i b., Kcefer, 3 b., . Hill.p Lcisenring, I. £, Tate, c, . . . Gilbert, 2 b., . , Hoffman, s. s., Erb.r.f.,. . . Totals, H. O. A. E. 3OOO Sh'na'do'h, 1 b., Toprock, 2 b., . Turkey,c. f., . . Lufkin, 1. f., . . Chief Eagle, r. f, Silas, s. s. and p., Taylor, 3 b., . . Eagle Feather, c, Nori, p. and s. s., H. O. A. E. O7O0 6 11 27 13 2 I Totals, 1 6 27 9 INNINGS. ■ Gettysburg, 00000041 1- Indian School o o o o o o o o 1- Summary—Earned runs, Gettysburg, 2 ; Indian School, 1. Three base hit, Turkey. Bases stolen, Gettysburg, 7; Indian School, 1. Base on balls, by Hill, 1 ; by Silas, 2 ; by Nori, 1. Hit by pitched ball, Toprock. Struck out, by Hill, 3; by Nori, 4; by Silas, 3. Passed ball. Eagle Feather. Time of game, 1.30. Umpires, Vastine and High Horse. Scorer, Keffer. All looked forward to May ioth with eager expectation, that being the time scheduled for our first game with Dickinson College. The expected day came and with it the game, but it proved to be so one-sided an affair that we were disappointed. From beginning to end Dickinson wasn't " in it." Himes made a miserable excuse for pitching, the home team knocking him all over the field to the intense delight of the spectators. The only playing done by the visiting team was in the field. Hill pitched a superb game, strik-ing out eight men. He amused himself with the visitors, three times hitting their bats, thereby giving them their three hits. When the last man was put out in the ninth inning, the spectators fairly rent the air with their cheering. .The crestfallen visitors slowly wended their way to the train that was to carry them away from the scene of defeat, while the dolefully tolling bell sent forth its THE COLLEGE MERCURY. 7% melancholy reverberations. Following is the score: GF.TTYSHURG. Gies, c. f., . . . • 3 Nicholas, 1 b., . . 2 Keefer, 3 b 3 Hill, p., ■ • ■ ■ 3 Richardson, r. f, . o Leisenring, 1. f., . 1 Gilbert, 2 b.t . . . 1 Hoffman, s. s., . .2 Tate, c, 2 Totals, . 17 16 27 13 2 DICKINSON. R. H. O. A. B. Himes, p., . o o o 4 o Davis, 1. f., . 1 1 2 o o Gilroy, 2 b., .01642 Curry, 3 b., . . - o 1 2 30 Bowman, c, .002 4 a Goodall, ib o on o 1 Lantz, c. f., . o o 3 1 1 Cramer, r. f., . . . o o 1 o c Makely, s. s., . .000 1 3 Totals, .1 3 27 17 7 Gettysburg, 4 J ° « « 3 2 2 3—'7 Dickinson, 1 o o o o o o o o— 1 Summary—Earned runs, Gettysburg, 9; Dickinson, 1. Two base hits, Hill, Nicholas, Hoffman. Bases stolen, Gettysburg, 14; Dickin-son, 2. Double play, Hill and Nicholas. Bases on balls, by Hill, 3; by 'Himes, 3. Hit by pitched ball, Gies and Tate. Struck out by Himes, 1 ; by Hill, 8. Passed balls, Bowman, 2. Time of game, 1.45. Umpires, Vastine and Vail. Scorer, Keffer. Another victory was added to our list, May 13th. After a drive of twenty-three miles over rough roads, our team met the Western Maryland College team upon their grounds at Westminster, Md., and defeated them. The game was close and interesting. Fine work was done on both sides, especially by the batteries and the Gettysburg fielders. Although the Gettysburg boys were somewhat exhausted by the long drive, they kept up their record to the end. The score was not as high as it would have been had the conditions been more equal. Following is the score: GETTYSBURG. Gies, c. f., . . . Nicholas, ib., . Keefer, 3 b., . . Hill, p., . Richardson, r. f., Leisenring, I. f., Gilbert, 2 b., . . Hoffman, s. s., . Tale, c R. H. O. A. E. WESTERN MARYLAND. K. H. O. Sellman, p., .001 Danner, 2 b., . . . o 2 2 Kurgeson, c, . . . o 1 4 Lewis, s. s., . . . o c 1 Gilbert, 1 b., . . . o o 9 Stull, 1. f. o o 3 Story, c. f. 1 o 4 Keen, r. f., . . . . o 3 1 Miller, 3 b., . . . o 1 2 score of 23 Totals, . 4 5 27 11 1 Totals,.i 7 27 11 6 | INNINGS. Gettysburg 10030000 0—4 1 Western Maryland o 1 o o o o o o o—1 | Summary—Earned runs, Gettysburg, 2; Western Maryland, 1. | Bases stolen, Gettysburg, 8 ; Western Maryland, 4. Double plays, Gies, Keefer, and Gilbert : Hoffman and Nicholas. Bases on balls, I by Sellman, 2. Hit by pitched ball. Hill. Struck out by Hill, 7; by Sellman, 3. Passed balls, Furgeson, 2. Time of game, 1.50. Umpires, Vastine and White. Scorer, Keffer. The game of May 20th with New Windsor College, on our home grounds, proved to be a very one-sided contest. Mr. Whitehill wasn't " in it" with Gettysburg's Hill. The game became rather monotonous toward the end. The home team did good playing. More need not be said—the score speaks for itself: Gettysburg, 27 ; New Windsor, 2. Much base-ball skill is developing in Prep., an example of which we had on Saturday, May 20th, when the Sub-Freshman team de-feated the Freshman team by a to 9. On Saturday, May 27th, the Sub-Freshman were again victorious. This time they de-feated the Sophomores by a score of 15 to 9. Their skill and coolness is to be commended, and Gettysburg need not tremble for her laurels for the next few years. The return game with Dickinson,.scheduled for May 24th, has been postponed to a future date. The return game that was to be played with Franklin and Marshall has been declared off on account of their team disbanding. At no time in the history of the college has so much interest been awakened in tennis. Every one seems to be infected with the fever. The absorbing topic in tennis circles is the tournament to be held during Commence-ment week. The entries for " doubles " are closed with thirty-six names. The " singles " are still open, but will be closed shortly. Practice is now in order for the preliminaries, which will be held in a week or two. At present the outlook for the tournament is very favorable, and if nothing unexpected occurs, it will be one of the most pleasant features of Commencement week. Base-ball and tennis have not entirely over-shadowed the interest in foot-ball. The appli-cants for next year's team practice weekly. Some new and promising material has been developed since last fall, and we look forward to a strong team for next year. Arrangements are being made for the Field Sports to be held during Commencement week. The sports will consist of dashes, races, jumping, kicking, throwing, etc. Mana-ger Nicklas, '94, is doing all in his power to make the affair a great success. We hope that his efforts will not be in vain. Keefer, '95, represented Gettysburg College at the annual athletic games held at Philadel-phia, May 20th, under the auspices of the Inter-Collegiate State Athletic Association. TOW/N AND SEMI/NTVRy. ROSCOE C. WRIGHT, Editor. SEMINARY. THE annual meeting of the Bible Society of Gettysburg was held April 29th. Dr. Hay was re-elected President. 72 THE COLLEGE MERCURY. Mr. Foster U. Gift, of the Junior class, will act as English Assistant to Dr. Wenner, of New York, during the coming summer vaca-tion. Rev. Ellis B. Burgess has accepted a call to Avenmore, Pa. He will enter upon his work in June. Appropriate Ascension Day services were held in the Seminary chapel, May l ith. Ad-dresses were made by Drs. Hay, Wolf, and Richard. Rev. W. Eichmann, of Westphalia, Ger-many, arrived here on the 29th of April. He studied theology five years in Germany, and came to Gettysburg to learn something about American church life. At the close of the term, he will go West to take a charge. We wish him success. Rev. C. H. Gruver has received a call from the Lutheran Church at Sparrow's Point, Md. Dr. Butler, of Washington, and Rev. H. R. Geiger, Ph. D., editor of the Lutheran Evange-list, visited the Seminary April 27th. Dr. George Scholl, Secretary of Foreign Missions, was with us April 23d. Dr. Hay delivered the address at the laying of the corner-stone of St. John's Lutheran Church, at Stcelton, April 30th. Mr. J. Braren, of Holstein, Germany, a member of the Middle class, expects to go West this summer to do mission work among the Germans of Nebraska. Drs. Valentine and Wolf are delegates to the General Synod. Rev. A. Stewart Hartman, Secretary of Home Missions, has appointed Mr. A. C. Stup as missionary for the summer vacation to Riverside, Cal., and Mr. A. A. King to Bangor, Pa. Messrs. Axe, Bergstresser, Hesse, Dunlap, and R. B. Wolf, have been appointed as colporteurs for the Pennsylvania Bible Society. On Sunday, May 21st, Rev. D. Frank Gar-land's church, in Baltimore, was dedicated. Dr. Richard preached the dedicatory sermon. Rev. F. S. Schultz has received a unanimous call to Morellville, a suburb of Johnstown, Pa. Dr. Richard entertained the Senior class of the Seminary at his home, Thursday evening, May 18th. A very enjoyable time is re-ported. Rev. Wolf, the missionary who recently returned from India, addressed the students, Sunday morning, May 21st, on "The kind of men needed in the foreign field to-day." The address was an excellent one, timely, and full of many important suggestions. Rev. Wolf intends to remain in this country about three months. TOWN. April 30th was the one hundredth anniver-sary of the independence of the Reformed Church in the United States, that body having separated from the church in Holland, April 30th, 1793. Rev. Barkley delivered an his-torical sermon in Trinity Reformed Church in the morning. Mrs. Harriet Brown Krauth, widow of Rev. Dr. C. P. Krauth, the first President of Gettys-burg College, died April 27th. S. S. Neely, Esq., has been appointed statis-tical agent of the State for the Agricultural Department. Arrangements are being made for the semi-annual encampment of the Department of Pennsylvania, G. A. R., at Gettysburg, July 15th to 21 st. Large delegations from the De-partments of New York, Maryland, and Dela-ware are expected. The New York monument in the National Cemetery will be dedicated July 3d, the anni-versary of the battle. That State has ap-propriated $50,000 for the transportation of the Governor and staff, members of the Legis-lature, and surviving veterans. THE COLLEGE MERCURY. n A distinguished party, consisting of General James Longstreet, General E. Porter Alexan-der, artillery leader of the Confederacy, General Mahone, of Va., Major-General O. O. Howard, of the U. S. Army, Generals Sickles and Tre-main, of New York, Governor Pattison and Auditor-General Gregg, of Pennsylvania, visited the battle-field April 28th-2C)th. On May 6th the oratorical contest between six members of the College Prohibition Club was held in the Court-House. This contest is preliminary to the State Inter-Collegiate Prohibition Contest, to be held at Harrisburg, June 6th, to which the winner will be sent. The winner at the State Contest will take part in the National Contest to take place at Chi-cago. The following is the list of the contest-ants, and the subjects of their respective orations: I. O. Moser, "Our Public School System ;" O. O. Leidich, " Monopolies ;•" M. Kemp, " The Effects of Prohibition on Na-tional Character;" L. F. Miller, " Arbitration vs. War;" W. D. Ernest, " The Curse of the Nineteenth Century;" C. E. Sanders, "Pro-hibition the Safeguard of our Social Fabric." The judges, Dr. Swartz, and Revs. Black and Good, decided that Mr. Sanders was the win-ner of the contest. THE MERCURY extends congratulations. Dr. Geo. E. Reed, President of Dickinson College, delivered the Memorial Day oration at Gettysburg. The electric railway company is meeting with much opposition. The pike companies brought suit, claiming that if the electric road was built it would interfere with traffic over their roads. This was settled by paying the pike companies $100. Recently the veterans have taken the matter in hand. Not wishing to see Devil's Den, Peach Orchard, Valley of Death, and other places of historic interest defaced by the blasting and filling in for the road-bed, they are petitioning the Secretary of War to prevent a further desecration of the battle-field. The railway company maintains that the new road will not mar the scenery at the foot of Round Top, and that the battle lines will remain intact. The War Depart-ment sent Major George B. Davis, Advocate General Judge of that department, to look over the proposed route. The decision of the Secretary of War will doubtless be based upon his report. Rev. Hugh Gilchrist has accepted a call to the Presbyterian Church. At the recent session of the State Medical Society it was decided to hold its next meet-ing at Gettysburg. We are again called upon to note the death of one intimately connected with the college. On Friday morning, May igth, Alexander D. Buehler died after a very short illness. Mr. Buehler succeeded his father as Treasurer and Trustee of Gettysburg College 37 years ago. During his long residence in Gettysburg he was identified with the Gas Company, the Adams County Fire Insurance Company, and the Water Company. Since 1867 he has been one of the proprietors of the Star and Sentinel. A large circle of friends will mourn his depar-ture. He bequeathed $2,000 to the college. On Thursday, May 18th, Hon. Chris. Magee, of Pittsburgh, and State Senators William Flinn, Walter Lyon, Wm. Penn Lloyd, Grant Herring, and Samuel Steele were here to look over the battle-field. Senator Flinn is the author of the bill giving electric roads the right of eminent domain. LITE-RTVRy SOCIETIES. WALDO D. MAYNARD, Editor. OWING to so many attractions out-doors, there is not so much interest manifested in society work as there should be. This is a matter to be regretted, for our work in the literary societies is of so much importance that 74 THE COLLEGE MERCURY. we cannot afford to neglect it. The time and labor required for preparation in this work is but comparatively little, so much the more is it needful then that we should not shirk our work when we are on the programme for per-formance. Let us then arouse ourselves to greater activity and make our society work of as much importance during the spring term as any other term of the year. With a little self-denial and restraint this can easily be done. Nearly all of the men in college now belong to the societies. This is very encouraging, but the members should keep at work until every man belongs to a society. PHRENA. NOTES. Phrena. has made valuable additions to its library, over 50 volumes of standard works having been purchased recently. The following will be the contestants in the Junior Oratorial Contest, to be held during Commencement week: Messrs. Lantz, Bush, Barndt, and Stahl. Mr. R. N. Stahle, '97, has been elected a member of Phrena. The following action has been taken by Phrena. upon the death of one of its members, Mr. Charles S. Wolf. WHEREAS, God, in His all-wise providence, has seen fit to remove from our midst Charles Stark Wolf, a true and faith-ful member of Phrenakosmian Literary Society; and WHEREAS, In this sudden departure from a life, rich with promise, we deeply mourn our great loss of one who has always been a loyal Phrena.; therefore, be it Resolved, That in his untimely death we have lost an active worker, an ardent supporter, and a congenial asso-ciate ; and also Resolved, That though his seat be vacant, and we shall meet him no more here, we have the assuring hope and belief that our loss is his infinite gain ; and Resolved, That though we are saddened by the loss of our associate, recognizing that His ways are not our ways, we bow in humble submission to Him who doeth all things well; and also Resolved, That a copy of these resolutions be presented to the family of the deceased; that they be recorded in the minute-book of the society ; and that they be printed in the college journals, church and town papers. VIRGIL R. SAYLAR, FLAVIUS HILTON, EDGAR SUTHERLAND, GELLERT ALLEMAN, ROSCOE C. WRIGHT. PHILO. NOTES. Philo. has finished its course in the discussion of authors. The society was very successful in this new undertaking. The hall was crowded every evening, while this plan was pursued, by the people from town as well as by the students. The following noted authors were some of those considered : Tennyson, George Eliot, Oliver Wendell Holmes. Fifty volumes of standard works have been added to the library, and a committee has been appointed to re-catalogue the books in the library. The following have recently been elected members of Philo.: Messrs. Ibach, '94; Wiest, Madara, Hoffman, Feldman, '95 ; Shaar and Heindel, '96; Smyser, Lutz, Culp, McCartney, Misses Tipton and Hess, '97. Oliver Wendell Holmes and Mrs. H. B. Nixon were elected honorary members. On Friday, May 26th, Philo. Society elected new officers to attend to her business. The officers elected were as follows : President, D. W. Van Camp ; Vice-President, W. A. Kump ; Recording Secretary, G. Z. Stup; Treasurer' W. B. Duttera ; Critics, J. F. Seebach, F. H. Bloomhardt, R. W Mottern ; Janitor, H. D. Newcomer. Philo. will hold its preliminary to the Junior Oratorial Contest on June 9th. A maiden fair of Boston town, Whose hose were azure as her eyes, Who'd ranged the scale of all the fads, Woke in my heart the god of sighs; She loved me, and I thought to hear Some erudite endearing name, But no, the learned darling called Me " lovie-dovie," just the same. —Life. ADVERTISEMENTS. Wanamaker's. Sporting goods of every sort. Sporting wear of every sort—Coats, Trousers, Caps and such a gathering of Shoes for every indoor or outdoor game as was never before seen in America. And Wanamaker prices—as low as anybody's, very likely lower than any-where else. ATALANTA was the swiftest girl of antiquity. The myth has come true to-day in a Wheel. Our ATALANTA is a Bicycle as fast, as strong, as simple as any on the market; faster, stronger, simpler, safer, better than most of the "first-class" machines. And lighter—weight Z°V\ l°s- But the best part is the price—$120 for a bang-up $150 Bicycle ! JOHN WANAMAKER. PROFESSIONAL CARDS. SEND FOR CATALOGUE OF NEAR. BALTIMORE, IVID, This widely known, thoroughly equipped, and extensively patronized School will open its 41st Annual Sesson, Sept. 13th, 1893. All the Departments of a High Grade Seminary. Address, Rev. J. H. TURNER, A. M., Principal, LUTHERVILLE, MD. CH^LlES S. DU^iCR^, '82, ATTORNEY AND COUNSELLOR-AT-LAW, Baltimore Street, GETTYSBURG, PA. CHRS. E. STAflLtE, '87, ATTORNEY-AT-LAW, Baltimore Street, GETTYSBURG, PA. DR. CHAS. B, STOUFFER, OFFICE, STAR AND SENTINEL BUILDING, GETTYSBURG. PA. ftWber's Drag Store, Baltimore Street, GETTYSBURG, PA. Prescriptions Carefully Compounded. matest Styles ii} Hats, Shoes, AND Gents' Furnishings, R. M. ELLIOTT'S. N. B.—Stiff Hats made to Fit the Head in two minutes. A. D. BUEHLER&CO., Headquarters for B©©^s a^d Brags, Stationery and Blank Books. LOWEST CASH PRICES- VI ADVERTISEMENTS. DECKER BROTHERS' PIANOS. Absolute .Evenness of Touch, Richness and Brilliancy of Tone, Extraordinary Singing Quality, Unequaled Workmanship, Power of Standing in Tune longer than any other Piano made, are among the characteristic qualities of DECKER BROS. PIANOS, 33 Union Square, Heuu York. Used in Philo. Hall at Gettysburg College. GO TO C.A.BLOCHER'S Jeujelpy Stove fot» Souvenir * Spoons, . Sword * PTVins, &c. DKEKA Fine Stationery and Engraving House, 1121 Chestnut St., Philadelphia. J^pari-rnS a SPecraTty. COLLEGE INVITATIONS CLASS STATIONERY SOCIETY STATIONERY PROGRAMMES, BADGES WEDDING INVITATIONS VISITING CARDS BANQUET MENUS DIPLOMAS AND MEDALS Post Office Corner, Centre Square, STEEL PLATE ENGRAVING FOR FRATERNITIES, CLASSES AND COLLEGE ANNUALS. All work is executed in the establishment under the personal supervis-ion of Mr. Dreka, and only in the best manner. Unequaled facilities and long practical experience enable us to produce the newest styles and most artistic t fleets, while our reputation is a guarantee of the quality of the productions of this house. ADVERTISEMENTS. Vll R. H. REININGER, Merchant % Tailor. * & X *c THE BEST WORK AT THE LOWEST PRICES. Suits from $12.00 to $40.00. Pants from $4.00 to $12.00. NEXT DOOR TO POST OFFICE, UP-STAIRS. CENTRAL SQUARE. PETE THORNE, Shaving $ Hair Cutting Parlors. Pl-RST eLASS 7VRTISTS. CENTRAL SQUARE. AJVIOS EC^EHT, DEALER IN FLEMMING & TROXEL, Billiard AND Pool 'Rooms. BALTIMORE STREET. Hats, Shirts, Shoes, Ties, Umbrellas, Gloves, Satchels, Hose, Pocket Books, Trunks, Telescopes, Rubbers, Etc., Etc. AMOS ECKERT. SPECIflli TO STUDENTS. Fine Tailoring. JOSEPH JACOBS, Merchant Tailor, Shambersburg Street, (Mow Eagle Hotel) GETTYSBURG, PA. Red Front Cigar Store R. H. RUPP, Proprietor. flo. 8 Baltimore St., Gettysburg. The place for a fine Cigar or a good chew. Solid Havana filler, 5 for 25c. An elegant article. A FINE ASSORTMENT OF PIPES AND SMOKING MIXTURES. j V111 ADVERTISEMENTS. ESTABLISHED 1876. PE/NKOSE MgE-RS, \Y/dTCHndKER ™ jEWELER. Liarge Stock of LUatehes,Cloeks, Jeuuelpy, etc., on Hand. That Man is Out GETTYSBURG SOUVENIR SPOONS COLLEGE SOUVENIR WHO BUYS HIS BASE BALL, . BICYCLE, . . LAWN TENNIS -^2-3 10 BALTIMORE STREET, GETTYSBURG, PA. Students' Headquarters IS AT J. R.STINE & SONS CLOTHING STORE The Cheapest Clothing and Gents' Furnishings in Gettysburg. 1 IP-OUTING, ELSEWHERE . THAN AT . YACHTING AND BOATING SUPPLIES, A. Q. SPALDING & BROS. CHICAGO, NEW YORK, PHILADELPHIA, loS Mnclison St. 243 l'.roatlwny, 1032 Chestnut St. MERCHANT TAILORING DmTLEflELD LlVERT. Rear of Washington House, Opposite W, M. R. R. Depot. GETTYSBURG, PA. ^~ All Kinds of Teams. Good Riding Horses. A SPECIALTY. COME AND SEE US. J. R. STINE & SON, THE LEADING CLOTHIERS, MAIN STREET, GETTYSBURG, PA. :o:- The Battlefield a Specialty, With First-Class Guides. DAVID McCLEARY, Prop.

FEBRUARY, J900 ■ Gettysbur Mercury CONTENTS. Puzzles and their Value in Men-tal Training, 261 How Obtain Equilibrium be-tween Production and Con-sumption, 265 Scene in the Forest, Orlando Soliloquizing, 271 Education more than a Means of Gaining a Livelihood, 272 A Comparative Study in Ruskin, 274 Editorials 278 Economic Results of Gambling, 279 Results of the Art of Healing,. 282 Public Control of Industries 285 The Power of Ignorance; 292 KAVOR THOSE WHO FAVOR US. For Fine. Printing go to p o ,,0 CARLISLE ST. GETTYSBURG, PA. C. B. Kitzmiller Dealer in Hats, Caps, Boots and . Douglas Shoes GETTYSBURG, PA. J. H. Myers Fashionable Tailor, Clothier and Gents' Furnisher. The best place in town to taaveyourCloth-ing made to order. All workmanship and Trimmings guaranteed. No charge for re-pairs and pressing for one year. Dyeing and Repairing a specialty. Ready-made Clothing the largest stock in town. Up-to-date styles. Bicycle Suits and Breeches Headquarters. 11 Baltimore St., Gettysbarg, Pa. EDGAR 5. MARTIN, F^CIGARS AND SMOKERS' ARTICLES. ijr* l2r* i£?* Chambersburg St., Gettysburg. Do you :::;:: ever write ? No doubt you do. Bat 1B your spelling alwayx correct ? Do you have to watch out BO as to avoid thouc humiliating "break*" which convict one of "bad English"? Are you sure of vour punctua-tion ? DoeB compogition writing Vonie easy to you?— letter writing? — any kind of writing? Are ynu glib with the different word* of similar meaning ? Are you up on the etiquette, the amen-ities, of polite letter-writing and businesi corre-spondence? Well, with the following up-to-date works BO readily obtainable, no one need be lem than an adept: Hindu fy Noble's New Spelter, 25c. How to Punctuate Correctly, 25c, Bad English Corrected. RQe. Composition Writiny Made Easy. 7.1c, Liies and Opposite* {Synonyms and Anto-nyms). 50c. Hinds » Noble's New Letter Writer. 75c. HINDS & HOBLE, Publishers 4-5-13-14 Cooper Institute H. Y. City Schoolbnohs of all publishers atone store. R. A. WONDERS, Corner Cigar Parlors. A full line of Cigars, Tobacco, Pipes, Etc. Scott's Corner, Opp. Eagle Hotel. GETTYSBURG, PA. JOHN M. MINNIGH, Confectionery, Ice, andIee Cpeankjj-* Oysters Stewed and Fried. No. 17 BALTIMORE ST. I .THE. GETTYSBURG MERCURY. Entered at the Postoffice at Gettysburg as second-class matter. VOL. VIII. GETTYSBURG, PA., FEBRUARY, 1900. No. 8 Editor-in-Chief. J. FRANK HEILMAN, '00. Assistant Editors. LUTHER A. WEIGLE, '00. S. A. VAN ORMER, '01. Alumni Editor. REV. F. D. GARLAND. Business Manager. JOHN K. HAMACHER. '00. Assistant Business Manager. CLARENCE MOORE, '02. Advisory Board. PROF. J. A. HIMES, LIT. D. PROF. G. D. STAHLEY, M. D. PROF. J. W. RICHARD, D. D. Published monthly by the students of Pennsylvania (Gettysburg) College. Subscription price One Dollar a year in advance, single copies Fifteen Cents. Students, Professors and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE GETTYSBURG MERCURY, GETTYSBURG, PA. PUZZLES AND THEIR VALUE IN MENTAL TRAINING. [GIES PRIZE ESSAY, FIRST PRIZE.] OF all the powers of the human soul, the imagination is one of the most universal in its application and pleasing in its products, the earliest activity of the infant mind, and the last to cling to old age. Without the exercise of this faculty, the world would be a barren waste of material facts, in which would dwell the human race, passive recipients of objective im-pressions, without the power to revel in the beauties of imaged thought and conception of the Divine. Poetry, philosophy, art, science, invention, religion—all would be lost to mankind. L,ittle wonder, then, that the products of the imagination have ever been present and cultivated among men. The word "puzzle" has been variously defined, and the objects of thought and action to which it may be applied are widely different. But a common ground may be assumed—a puzzle is an invented contrivance, either intellectual or material, mtmllM - 262 THE GETTYSBURG MERCURY. whose solution requires time and ingenuity. It will be seen that the puzzle is pre-eminently the product ot the inventive imagina-tion and in turn its highest application is in the exercise of that power for its solution. Intellectual puzzles are in many senses the most important and also most ancient, being generally cast in the form of riddles. From the earliest times of history we can find evidence of the existence of puzzles, either as a form of intellectual amusement or didactic discipline. Among the Eastern nations obscure forms of expression were the inevitable associates of their symbolical modes of thought. It is certain that such methods of statement were in use among the Egyptians, while several books of riddles exist in old Arabic and Persian. One of the most well-known of puzzles is the riddle which Samson propounded to the Philistines, and many other examples are found in the Bible. The proverbs of Solomon are at times excellent types of the didactic form of the riddle. The parables of the Savior were skillful methods of teaching important truths veiled under an interesting narrative which drew the attention of the crowd, and would be very accept-able to an Eastern mind. In Greece the riddle was a favorite mode of intellectual enter-tainment at symposia. To the active mind of the Greek nothing was more pleasing than a well-directed turn of expression which would give room for play of the imagination. There is abundant evidence of this among their writers. Some of their poets even did not hesitate to write whole books of riddles, and Kleobulus, one of the seven wise men, was especially noted for his composi-tions along this line. The famous riddle of the Sphinx as told in the Oedipus Tyrannus, is probably the best known puzzle of Greek literature, though the most interesting form was a part of their very religious life and character—the oracles of the inspired priests, on which hung sometimes the fate of nations, even of the world. The raveling of such obscurities of expression was a source of the keenest pleasure to the Greek mind, and, while a product of the imagination, was an efficient agent in bringing it to that perfection shown in attic literature, thought and philosophy. The Roman mind, more earnest and grave, found small pleas-ure in these modes of intellectual activity, and very little is known of their use of puzzles until the later republic and empire, when they were introduced with the passion for everything Greek, and ■■■■HH THE GETTYSBURG MERCURY. 263 professional riddle-makers soon began to take a prominent part in their entertainments and banquets. During the middle ages puzzles were cultivated more as a pleasant means of entertainment than for any other purpose, and until recently the same idea has clung to them. Many manu-script and printed editions of collections of puzzles, riddles and conundrums are in existence. Much of their content consists of coarse jests, but there are some real gems of wit and valuable aids to a true estimate of mediaeval life. The Reformation put a stop to this merry jesting for a time, but it soon crept into favor again, and during the eighteenth century the most brilliant minds of Europe were engaged in the intellectual pastime. At the present day puzzles are still in great favor with both young and old, and their educational worth is becoming more and more realized. As a mental training the value of the puzzle lies chiefly in its power of cultivating quickness and strength of the constructive imagination. An obscurity of expression or mechanical con-struction may require time to solve its intricacies, but the mind is certainly the better for having mastered it. All the faculties of memory and imagination are brought into play, and side by side comes development of the reasoning power as we attempt to deduce from our problem its elements, or to arrive by induction at the result of certain assumed forces. These are the things which made the riddle so attractive to the Greek, with his quick imagination and active reasoning power. When we solve a dif-ficult puzzle, we in fact repeat the very processes by which as children we began to learn, for then everything was a puzzle; and in doing so we strengthen the faculties of the mind which are most essential, and besides strength impart to them a facility and quickness of action, which is in itself most valuable. The subject-matter of the puzzle may be another source of con-siderable benefit. The didactic riddles of the East have already been mentioned as examples of what may be taught in this way. A truth given an obscure expression which requires mental effort to unravel will be impressed upon the mind when it has been gained. A mechanical construction whose every portion has been carefully studied with a view to its possible part in the function of the whole, will not soon be forgotten. In this fact alone may be grounded a strong argument in favor of the puzzle's part in mental training. 264 THE GETTYSBURG MERCURY. Puzzles are beginning to play a more and more important part in the education of the child. Almost the first book placed in its hands, "Mother Goose," is full of simple riddles. Froebel's kindergarten method, so generally acknowledged now-a-days, em-bodies the puzzle idea to a great extent, developing as it does the powers of observation, invention and reasoning. As the child passes into school, puzzles of graded difficulty are used for several years, and his toys always include a number of puzzles and games, many of which contain subject-matter of educational value. Many firms now publish educational games, whose benefit to the child will be revealed by even a superficial examination. The use of puzzles may be carried too far, however; for they may be made an end in themselves. Men may become so infatu-ated with the delicacy of reasoning and exhilaration of discovery as to lose sight entirely of the practical use of the mind. So did the School-men of the middle ages, who waged long controversies on trivial and absurd questions merely for sake of the argument. Neither should puzzles take the place of more legitimate means of education, for it must be kept in mind that they are for the more developed merely an intellectual pastime which will benefit instead of harm ; and for the child a means of starting its mind upon the path which it must shortly travel with the more able guides of language, art and science. Puzzles seem to be trivial things, and are so in a certain sense. But they present wonderful capabilities to the student of Psy-chology and the teacher of the child's mind. Used within proper bounds, as a means and not an end, they may become, in devel-opment of strength and facility of the imagination and the reas-oning power, and in didactic force, a powerful factor in mental training. —L. A. W., '00. Hold fast to the Bible as the sheet anchor of your liberties; write its precepts in your hearts, and practice them in your lives. —U. S. Grant. A broken reputashun is like a broken vase—it may be mend-ed, but alwuss shows whare the brak waz.—Josh Billings. THE GETTYSBURG MERCURY. 265 MOW OBTAIN EQUILIBRIUM BETWEEN PRODUCTION AND CONSUMPTION. AS a matter of course, the first thing to consider in searching for a remedy for any evil, whether in economics or else-where, is to seek to find the causes of that evil, and to discover a means of removing these causes. Whether the means proposed be beneficial in other respects or advisable upon other grounds we do not need to inquire in this paper. All that is necessary is to find some measure which gives fair promise of bettering matters in this one department of economic life which we have under consideration, namely, of establishing a more stable and more nearly correct relation between the producer and consumer. Briefly and roughly stated, it seems to us that the whole difficulty arises from the fact that the producer is not able to foretell how much of a demand there will be for his goods and incidental to this, how many of those who create the demand will be able to pay within a reasonable time, provided he is willing to sell on credit. As to the second point, demand un-doubtedly is defined to be how much certain persons are ready to take at a certain price. But we must remember that an enormous part of economic operations are conducted on a credit basis and we cannot overlook this as it exercises such a potent influence in increasing or lowering the demand or supply at any time. For if a man believes the credit of his purchasers is good, he will be willing to sell a greater quantity of goods on credit and at a lower price than if he is doubtful as to their credit, and so we might illustrate further. This second point then is incidental to the first, but it is so important in the view we take of the matter that we mention it at once in connection with what we regard the leading difficulty, namely, the producer's ignorance of the con-sumer's future demand for his goods. For he must anticipate the future. It is possible in so few industries to carry on production by filling orders already filed, that we may almost neglect them. And where there are such, the difficulties which we find elsewhere between producer and consumer do not exist, since they work on a solid basis with regard to the future, and are not compelled to base their output upon a supposed state of the market. In other words, they know 266 THE GETTYSBURG MERCURY. what the market will be and this is the element which is ordinar-ily lacking and which is the cause, as we believe, of the mis-understandings. Now it becomes important to try to answer the question "Why are these producers in ignorance of the future demand for their goods ?" Necessarily an important factor, in all economic life, is the large mass of natural products which are so dependent on the forces of nature, and as it is impossible to control the workings of these to any appreciable extent, the period between the planting for the future and the realization of it, between "seedtime and harvest," must always be one of doubt. It is apparently impossible to control the amount of production in this sphere, and, so far as this operates as an agent in causing misunderstandings between the producer and consumer, we do not attempt to suggest a remedy. As long as it is impossible for a man to know that he can meet a certain demand, even though he is sure that demand will exist, and that impossibility depends on the fact that the agents which cause the uncertainty are beyond human control, the cure seems also to be without the bounds of human power. From this class of cases where there is an impossibility for the producer to tell what supply he can put upon the market, we pass, by almost imperceptible gradations, to cases where the producer needs only know the demand and he can meet it with an ample supply. No doubt there are natural products which lie on the line between these extremes, as, for example, the output of mines which can be regulated to a fair extent, and there are products, not strictly natural, which are very uncertain as to the possible supply, but as a rule the further removed the product is from the soil, the more completely is the extent of its production within the control of man. It is to this class of products that we wish to direct particular attention. Assuming then that the demand could be met if it could be known, we come again to the question "Why cannot the demand be known ?" The producer can find from his table ofstatistics how many producers there are in the same business with him, how large an amount of their products has been sold during the year previous to that one, and the year previous and soon back, and then, by dividing his capital into the total capital invested in the business, he can find how much of that output should belong --. Sira :-:.'; . THE GETTYSBURG MERCURY. 267 to him. A simple problem, no doubt, but with no correctness in its application, and why not ? Simply because no one of his fellow producers, nor himself either, will be satisfied with the amount as he would thus work it out, but partly through natural aggressive-ness, partly though a desire to protect himself against aggressive-ness on the part of his competitors, he will seek to produce and to sell a little more than his share. He will devise new means by which he can bring his goods a little more in favor with the pub-lic than his rivals. He will reduce his prices, allowing himself a narrower margin of profits, hoping to make himself even by larger sales. No doubt in this way he will sell more goods than his slower going neighbor and will get some of the trade which would otherwise have gone to him. His neighbor's trade falls off and he finds that he provided for more trade than he is getting and is burdened with an unsalable stock. This is so much idle capi-tal and makes him so much less able to carry on a successful business. This single illustration, on a small scale, though it is, shows the inherent tendency of competition to make uncertain what share of a given demand will fall to a producer's lot. The same amount of goods may be sold, as he had anticipated, but he has not sold his share, for some one has succeeded in selling it ahead of him. We believe, therefore, that competition is the main reason. why the producer cannot foretell what the demand for his goods will be, and as it is this inability to foretell which leads to the mis-understandings between producer and consumer, the natural conclusion is that we should remove competition. We wish to make mention again that we do not argue that this is necessarily a beneficial or advisable means generally. ■ All we are concerned with is the question whether it will tend to remove the misunderstandings we have been speaking of. Of course it is not far to seek a means of accomplishing this. The means have been thrust upon us rather generously during the past few years. The tendency toward industrial combination, seeming to be the logical outgrowth of competition, appears, like Zeus, to threaten the reign of its progenitor. No doubt, it ap-pears startling to those economists who have been accustomed to regard competition with a kind of solemn awe, as containing a remedy for "all the heartaches and the thousand natural shocks 268 THE GETTYSBURG MERCURY. that flesh is heir to ;" but perhaps its partial disappearance may be attended by some results not altogether detrimental. The trust can estimate the demand which it will be called upon to meet. The total demand for a given article during any given period, does not vary through so large a range as to render this estimate one of great uncertainty. No doubt seasons of unusual depression or excitement may render calculations imperfect, but, all in all, the total output which the consumer stands ready to dispose of, is a matter of far higher certainty than the numerous possibilities existing when the producers are multiplied. By the immense amount of capital invested, the trust is better able to adapt itself to an unusual season of excitement or depres-sion. For example, the American Sugar Refining Company a few years ago built a new refinery furnished with the newest techni-cal improvements, to serve only as a safeguard in the case of a suddenly increased demand, or of stoppage in other factories. President Hadley in an article on Trusts, says, " A consoli-dated company has advantages in its power of adapting the amount of production to the needs of consumption. Where several con-cerns with large plants are competing and no one knows exactly what the others are doing, we are apt to have an alternation between years of over-production and years of scarcity, an alter-nation no less unfortunate for the public than for the parties im-mediatety concerned. A wisely managed combination can do much to avoid this. By making its production more even, it can give a constant supply of goods to the consumers and a constant opportunity of work to the laborers; and the resulting steadiness of prices is so great an advantage to all concerned that the public can well afford to pay a very considerable profit to those whose organizing power has rendered such useful service. Morever, the consolidation of all competing concerns avoids many unnecessary expenses of distribution. Under the old sys-tem, these expenses are very great. The multiplication of selling agencies involves much waste. Competitive advertisement is often an unnecessary and unprofitable use of money. Delivery of goods from independent producers, whether by wagon or by rail-road, often costs more than the better organized shipmeuts of a single large concern. All of these evils can be avoided by con-solidation." The same writer compares the trusts with an army, and the THE GETTYSBURG MERCURY. 269 comparison is apt for more purposes than one. The effectiveness with which a thoroughly organized and wealthy trust can meet an unexpected crisis, as compared with a large number of disorgan-ized and quarrelsome companies or individuals,is well paralleled by the difference between the manner in which a thoroughly equipped and organized army will overcome a sudden and severe attack, where a host of stragglers would have been cut to pieces. The very organization constitutes an element of tremendous strength. It must be concluded, we think, then, that trusts, would, or rather do furnish a means by which the future demand for the goods of the producer may be rendered more certain and hence they tend to remove the misunderstandings between the producer and the consumer. And now, how would such a remedy apply when we consider the matter of selling on credit. The man who sells, necessarily is not satisfied merely because he can tell how many goods his cus-tomer will buy. He wants to know how many he can and will pay for. Here in addition to the fact that their superior mastery of all the details of their business renders them more capable of judging of the credit of their purchasers, we seem to find another and very important fact. When competition exists, the producer is all the time seeking to hold out more inducement than his com-petitor. One of the common forms these inducements take is a sale on credit, and then competition arises as to extending the time of credit. Now, when the backbone of competition is broken, the trust no longer needs to use such means to secure purchasers. It stands in a position to dictate, to a great degree, its own terms, and can provide much more fully against dangerous credit than can be done where competition has full play. It is worth while, too, to mention the indirect effects flowing from those above mentioned. As the future is more closely anti-cipated, and as the sales made are more fully realized on than formerly, the financial embarrassments of various producers, under the old regime become a gradually disappearing quantity in the disturbing influences on trade. Of course the increased danger from the possibility of the trust must be omitted, but we believe it is overbalanced by the failures due to competition. When we entered upon the analysis of the causes which ren-dered demand uncertain, we supposed for the time being that the 'JO THE GETTYSBURG MERCURY. demand, if known, could be met. We now return to that point to inquire briefly how the trust would effect that side of the ques-tion, though we have already incidentally touched upon it. Necessarily, one thing which renders uncertain the ability of the producer to meet a given demand is the possibility of dissatis-faction among his employees, leading to a strike. The same argument applies here as applies to selling on credit. The employee is, to a certain extent, able to make more at the kind of work he is engaged in than at any other, for the simple reason that he knows more about it. Now when there are a number of producers in the same business he knows, if he leaves one, he can probably find work with another, while, where there is but one employer, he loses this advantage. But writers on Trusts and Industrial Combinations in the United States agree that the information given by the working-men, themselves, seems to prove that generally a reduction of hours for labor, seldom a reduction of wages and occasionally, an increase, have taken place, especially where the workingmen were well organized themselves. "It is pretty clear that the laborers in centralized undertakings have not been worse off than in decentralized ones." So that it appears that there is less likeli-hood of a strike under such organization than under the decen-tralized form, so that less opposition to the free course of produc-tion would be met with here. And again the indirect results would be beneficial. For, as the demand becomes more certain, and there is less waste from imperfect attempts to meet it, more and more the production of the trust becomes near to a uniform standard and thus tends to give the workmen steady employment at regular wages, which is a strong barrier against a strike on their part. From the direct and indirect results, therefore, of the consoli-dated form of production, we are led to believe that it presents a means of establishing a far better understanding between the pro-ducer and consumer. That in some minor details the result might be otherwise we do not deny, but looking at it in its broad out-lines and confining our attention carefully to theparticularsubject we have under discussion, we conclude that trusts furnish a method for removing much of the friction between the producer and the consumer. 'oo. ItttfSM&B&iSaSB THE GETTYSBURG MERCURY. 271 SCENE IN THE FOREST, ORLANDO SOLILOQUIZING. IS it so that in this guise she sought me? My heart is sick within me. I'll take me back to a wilder region in the forest and there the remainder of my days I'll spend in mourn-ing for my lost love. Aye, virtue is modesty and modesty is a virtue and in that is she lacking. Seek her ? Speak with her ? But strike me dead if I may speak one word with her, I'll write it, fold it, give it to her and fly. 'Twill be a testimony of my love that was, that is no more. She merits now nothing but my scorn. If I had wit, I'd make her blush for very shame, if shame there be in her. But my last breath is drawn. Oh how I loved her to distraction ! I ought to go, but how to move? What is this feeling within me that holds me back ? Is it because the road is long and I am tired. No, 'tis an accursed lingering of that love that once so filled me that I knew naught else. Will it never be in my power to shake it off? 'Twassent from Heaven and not from earth; 'twas given by God and not by man. And yet I'll rid me of it. Can one so unworthy hold my affections thus ? I have a dim vague unrest, can it be removed ? I hear a rustle in the autumn leaves. Ay, here she comes, do I love her yet ? I know not how strong my passion is. I faint from fear. I see her so plain, yet must seem to see her not. She speaks— Enter Ros. and Alia. Ros. (Dressed as a woman.) I am much distressed and faint for succor, must I fall with my true love standing near me and aiding me not ? Alia. Perhaps he sees us not. Shall I go touch him on the arm ? Ros. Yes, ask him if he loves me still. Tell him if when I need it his love fails me it is not love. ' Alia. (Goes up and touches him.) Rosalind has come to seek her lover. Do you not. see her ? She is in need of your aid ? What ails you ? Your eyes look wild and you seem to know me not. Orl. If any of pity exists in your heart for me leave me alone. Alas, I know not what I say; I want you to leave me and yet I fain would have you stay. Ros. (Coming up.) Pray pardon me for calling you my lover, you received it with such melancholy dignity, methinks 272 THE GETTYSBURG MERCURY. you do not half appreciate the honor placed upon you. Can I relieve you of the burden of the title? But why do you look at me thus ? Have I done aught against you ? Orl. I show no bravery by standing before you thus. I would that I could die before your very eyes to let you know what havoc you have wrought. But I leave you now this very minute to go far into the forest, perchance to take of my abode with a shepherd and thus spend my remaining days. I leave yet I stay. I cannot stir an inch, (aside.) Sweet Rosalind, has turned my head, Howl love her! Despite her faults, despite her lack of modesty.' Why came you to me thus? Tell me wished you again with your wiles to torment my morbid feelings. Ah, Rosalind, I still shall call you mine. Ros. Orlando, why did you think so ill of me ? Could you not see in my glowing eyes the story of my love. I would rather have had you woo me but bashful man makes maidens bold and love will find a way. We were parted but I could not abide far from thee. Wherever fate led I followed swayed by love alone. And as the days grow brighter and our hearts grow lighter we shall sing for joy, yes, joy without alloy. EDUCATION MORE THAN A MEANS OP GAINING A LIVELIHOOD. THAT education is a means of gaining a livelihood is a fact that needs no proof. Almost every day we are brought into contact with those who are gaining a comfortable liveli-hood by means of their education. In our day there are many others who are striving to get possession of the same means for no other purpose than that of making a living. It is to be regretted, however, that too many look at education as if it were a mere instrument for easily securing the things which satisfy their physical wants. Through this motive men have lost sight of the real and lasting value of education. I would not say that it is wrong to consider education as a means of gaining a livelihood, but I think that it is a very grievous error to consider education as having no other use or value. Indeed, education without any other purpose than that of a means of gaining a livelihood would be of little value to beings created as we are. THE GETTYSBURG MERCURY. 273 Herbert Spencer in his work on Education says, "In education the question of questions is how to decide among the conflicting claims of subjects and determine the relative values of knowledge. Every one in contending for the worth of any particular order of information, does so by showing its bearing upon some part of life. All effort, either directly or by implication, must appeal to the ultimate test of what use is it?" In other words, the writer affirms that the essential question for us to ponder is "How to live." Not how to live in the mere material sense only, but in the widest sense. The general problem which comprehends every special prob-lem is the right ruling of conduct in all directions, under all circumstances. In what way to treat the body; in what way to treat the mind; in what way to manage our affairs; in what way to bring up a family; in what way to behave as a citizen; in what way to utilize all those sources of happiness which nature supplies—how to use all our faculties to the greatest advantage of ourselves and others—how to live completely! And this being the great thing needful for us to learn, it is, by conse-quence the great aim of education. The leading kinds of activities which constitutes human life are: (1) Those activities which directly minister to self preserva-tion; (2) Those activities which, by securing the necessaries of life, indirectly administer to self preservation; (3) Those activities which are involved in the maintenance of proper social and political relations; (4) Those miscellaneous activities which make up the leisure part of life, devoted to the gratification of tastes and feelings. Is it not education which prepares the individual for direct and indirect self-preservation, for parent-hood, for citizenship, and for the miscellaneous refinements of life? Of course ideal education is complete preparation in all these divisions. Some one has said that education is to the soul what sculpture is to the marble. As the sculpture brings out of the marble the god-like form, the symmetrical proportion, the life-like attitude of the finished and polished statue, so education brings out of man as an animal man, a rational being, making him a complete creature after his kind. To his frame it gives vigor, activity and beauty; to his senses correctness and acuteness; to his intellect, power and truthfulness; to his heart, virtue. r

CRITICAL DISCOURSE ANALYSIS OF RACISM IN DJANGO UNCHAINED MOVIE Tiara Magda Amelia English Literature Study Program, Faculty of Languages and Arts, Surabaya State University Tyara_46@hotmail.com Widyastuti, S.S., M.Pd. English Literature Study Program, Faculty of Languages and Arts, Surabaya State University Wid_unesa@yahoo.com Abstrak Rasisme masih muncul seperti halnya membandingakan antara ras orang jawa dan ras cina. Rasisme muncul karena dalam masyrakat, ada yang memiliki kekuasaan banyak ataupun sedikit. Jadi, dalam jurnal yang berjudul "Analisa Wacana Kritis Rasisme pada film Django Unchained" akan berfokus pada (1) tipe rasisme apa yang muncul pada pengucapan orang kulit putih sebagai grup yang dominan dan (2) bagaimana kekuasaan bisa mengontrol masyarakat yang di lakukan oleh orang kulit putih sebagai grup dominan. Analisa Wacana Kritis mempunyai hubungan istilah dengan kekuasaan, kesinambungan dan dominasi. Jadi, Analisa Wacana Kritis merupakan teori yang tepat untuk menganalisa tutur kata. Jurnal ini menggunakan metode qualitative untuk memberi penjelasan yang lebih jelas melalui teory Van Djik. Jurnal ini berfokus pada rasisme di film Django Unchained. "Django Unchained" berisi tentang rasisme yang dilakuakan orang kulit putih sebagi dominan grup. Jurnal ini berfokus pada tutur kata rasis yang dilakukan oleh orang kulit putih. Hasil dari jurnal ini yaitu ditemukan tutur kata yang mengandung representative, expressive, commisive and directives. Orang kulit putih menggunakan dasar kekuasaan mereka dan juga menggunakan kekuasaan akses dan discourse, dan pengontrol pikiran untuk mengontrol masyarakat. Selain menggunakan kekuasaan, orang kulit putih juga sosial dan kesadaran manipulasi untuk memanipulasi masyarakat. Keywords: rasisme, analisa wacana kritis, kontrol, kekuasaan dan manipulasi Abstract Racism still appears such as comparing race between javanesse and chinesse people. Racism appears because of having less or more power in society. So, this journal which title "Critical Discourse Analysis of Racism in Django Unchained Movie" will be focused on (1) in what way white people as dominant group show their racism and (2) how power can control society which is done by white people as dominant group. Critical Discourse Analysis has a great deal with the names of power, inequality and dominant. So, Critical Discourse Analysis is a good scholar to analyse the utterances. This study uses qualitative method in order to get clearer explanation through Van Djik's theory. This study focuses on racism in society in "Django Unchained" movie. "Django Unchained" movie contains of racism which is done by white people as dominant group. Thus, this data focuses on the utterances of dominant group as exerciser of racism. Here, the result of this study is white people as the dominant group utter racism in representative, expressive, commisive and directives. They also use the base of power rosurces, access and discourse and mind control to control over society. Besides using power, they also use social and cognition manipulation to manipulate society. Kata Kunci: racism, critical discourse analysis, control, power and manipulation INTRODUCTION Racism is not abstract systems of social inequality and dominance. Power abuse can be defined as dominance, for example in terms of the violation of norms and human social rights. Racist can be defined as ideology of racial thinking of people who have more power to do their belief in society. Fiske (1994) says racist discourse is in the media consists of a list of words, images and texts that threaded together, produce an understanding of the world and position and status of people of color in that world. Changing nature is the most complex aspect in racist. The racist behaviour can see by insulting, harrasing each other in the school, workplace or in public, doing racial graffiti, and similar aggressive anti-social acts. However, the beliefs and behaviours of social deviants are not limited in individual racism. Racism can be seen by how people act each other by their behaviour and talk. For example mocking, saying bad thing to other people, threatening or the other else by using their utterances. Yule (1996) says speech act is action which is done via utterances. According to Searle (1979) there are five kinds of classification speech act, they are : Declaration Declaration is the word which can change the world by using utterance. In declaration usually use expression of "I bet", " I declare", "I resign". For example : " I baptise this boy Michel Meyer". Representative Representative is type of speech act which is contain of believe. The statement consist of assertions (someone who say something clearly without any hestitation), conclusions (someone who has say everything all of the conversation, he or she conclude his conversation by saying "so" or "it means that" or "it can be said"), and description (someone who wants to describe something for example describe person, personality, events, news etc). Expressive Expressive is type of speech act which is about speaker's feel. The statement is like pleasure (someone who feels happy or exciting, joy ), pain ( someone who feels hurt by somebody else, the words which are usually used "hurt" and "sick" "pain"), like (someone who love or pond of something) , dislike (someone who does not like something and the words are usually used "dislike", "hate", "can not stand", "can not bear"), or sorrow (someone who is in bad condition or uncomfort zone ). The word of expressive such as: happy, sad, upset, love, like, hate, fear, and so on. For example "being rich is wonderful". Directives Directive is type of speech act which want to someone do something. Usually the word of directives contains of requesting, (using question words such as who, what, why, which, whose, and how), commanding is about how to people give a command to someone to do something, usually in imperative sentence like "open the door!"), inviting (a person who wants to invite someone to join or attend his or her event), forbiding (usually to ask someone not to do the harm thing), suggesting (the word, usually use in suggesting is should or ought to). Commisive Commisive is type of speech act which speaker wants to commit himself to some future actions. Like promising (the word which is used in promising is "promise", "will"), threatening (threatening is like someone who wants to say something rude and harm to person, it has impact to the future), refusing (the word which is usually appeared in refusing sentence is "no", it is like person who does not want to do something of accept a thing). For example : "I will pick up you tomorrow". Critical Discourse Analysis Critical Discourse Analysis (CDA) deals with social power abuse, dominance, inequality and the way these are reproduced by the social group member through text and talk (Van Djik, 1998a). Wodak and Meyer (2001) say that Critical Discourse Analysis is the term of language as social practice. CDA focuses on between discourse and society, the social problem is about rising inequality in the society. Moreover Fairclough (1941) explains more about CDA that CDA not only shows how to investigate language which has relationship with power , but also shows the discursive nature of much contemporary social and cultural change.In CDA, language is not the most powerful part but language can reach power which is done by powerful people who use power to maintain society for their interest. That is why CDA often chooses the perspective of those who suffer (powerless group), and critically analyses the language use of those in power, who are responsible for the existence of inequalities. Power Critical Discourse Analysis deals with power abuse. The meaning of power is, according to Max Webber in Empowerment and Community Planning, power as probability that someone follow somebody's will, eventhough his will resistance to it in social relationship. In addition, Robert Dahl (1961) argues that power is exercised which done by individuals who are prevented from doing what they want prefer to do in community. Access and Discourse The dominance can control society because they have the base resources. These are the base resources of power such as wealth, income, good job, status, knowledge and education. Social power has relation with access and discourse. In this case the language users or communicator or speaker can have more or less in the use special discourse or may be in specific communicative events and contexts. It means that the speaker have more or less to control and access the discourse. Mind Control Influencing mind, somehow influence readers and hearers in news report, political propaganda, advertising, religious sermons, corporate directives or scholarly articles. They influence by knowledge, affecting opinion or changing attitudes. In specific context, the hearers or reader who given knowledge and belief reject, disbelieve, or otherwise mentally act in opposition to the intentions of powerful speaker or writer. The powerful speakers or writers have relative freedom to use discourse in their own interest. There are points of discursive mind control is a form of power and dominance if such control is in the interest of the powerful and if the recipients have 'no alternatives', i.e., no other sources (speakers, writers), no other discourses, no other option but to listen or read, and no relevant other beliefs to evaluate such discourses. Eventhough, the speaker or writer has many freedom, in other hand in the recepients are many coercion. The status of powerful writer and speaker is the function of properties of text and talk. The powerful speaker may be lied to, manipulated, persuaded to influence in their interest. The "victims" who have lack of knowledge or lack of power resources, they can not detect lies and manipulation from powerful people. For example journalist or writers have enough experience to influence society by message in their mind idea. They know how to change opinion and knowledge of readers. It is notion of changing people's mind. They change opinion and knowledge by emphasizing specific topic (headline and summaries in newspaper). They may influence mental model structure include discourse comprehension. Manipulation Influencing people's mind by controlling their action and attitudes needs persuasion and manipulation way to do it. But in Critical Discourse Analysis, manipulation needed to require as further theoritical analysis (Van Djik, 2006). Besides using power to control society, some speakers do manipulation to affect people's opinion and belief. Manipulation is a form of talk in conversation or interaction among people, manipulation deals with power abuse. Manipulation is illegitimate notion because, manipulation not only consist of power but also power abuse which is done by dominance. Thus, manipulation has negative sense rather than persuasion. Pictures, photo, movie or other media are exercised of manipulation by influencing the "victim". Manipulation in Society Power dimension in society takes apart to involve control people who exercise over other. In exercising control over other, manipulation needs social actor to satisfy personal and social criteria which can influence other. The group membership can define their power by their position, profession, and material. For example, parent can manipulate their children because of their power and authority in the family and professors can manipulate their student because of position and their knowledge. Everyday, in society, people may practice the kind of social manipulation in their group rather than personal Cognition Manipulation Manipulating people, it can be called manipulating their mind. People's mind is about people's belief like their knowledge, opinion and ideology which reflect to their actions. The mind is very complex process. So, it needs real time and action to apply it efficiently. The manipulator will decrease understanding their explanation while speaking, by speaking faster, less clearly and speaking with complex sentence, difficult word and confused topic. So, the hearer will get no idea what manipulator say or get a weak understanding from manipulator. In the one hand, the dominant group will facilitate their understanding with their interest in their information while doing manipulation. It is mean that the context model of the speaker has a clear plan to hamper the understanding. This research uses 2 research questions. They are in what type of speech act white people as dominant people show their racist utterances and how white people control society by using their power. the puposes of this study is to describe and show white people do racism and to describe how white people control society by using their power. all of the research questions are about in "Django Unchained" movie. METODE This research uses descriptive qualitative. The differentiate qualitative and quantitative is qualitative concerned with how and why something is, while quantitative focused on how much or how many (Litosseliti, 2010). The use of qualitative method is to analyse in what type utterances which contain of racism utter by white people as dominant group, second to analyse how white people as dominant group control society by using their power. The data is taken from the movie of "Django Unchained", the source of data is taken from utterances in "Django Unchained" movie. The data is movie which contain of racism. The movie is directed by Quentin Taratino. Data collection techniques are done by observation. In this case, the writer using non-participation technique in which the writer observes the data through taking notes of the object and without making interview or questionnaire as what Wray, Trott, Bloomer, Reay, & Butler (1998) had said that observing data is consisting of recordings, transcriptions, and notes relating to your subject's behaviour and language (spoken and or written). In this study, the data are from the utterances which contain of racism and power in "Django Unchained" movie will be observed. By doing observation, the use of transcription is important to support the utterances of data. According to Miles and Huberman, they defined analysis as consisting of three current flows of activity: data reduction, data display, and conclusion drawing or verification (1994). In this data analysis, the writer also uses these three activities. Data Reduction. In this research, the writer reduced the data that she does not focused on and need. There are so many conversations that produced by the characters in this "Django Unchained" movie. In this case the writer reduced the conversation which does not contain of power and racism. Data Display After reducing the data, analysing will be the next step. The analysis will be display as in data display. The data is displayed by using two tables in first and second research question. The tables are used when collecting the data. The first (1) contains of scene, utterances, utterances of racism and types of speech act. The writer identifies the appearing racism in that movie. The racism utterances are like how white people behave to black people with racism behaviour such as mocking insulting, harrasing each other, doing racial act, and similar aggressive anti-social acts. After indentifying the writer will analyze appearing racism by using what types of speech act which related to utterances of the conversation. The table (2) contains of scene, utterances, power and manipulation. The writer tries to analyze how white people as dominant group controls society. The dominance group is white people who have more power than black people. So, the dominance group's conversation will analyze in concept how power can control society. After knowing conversation which contain of power, the writer will analyze how and which power of white people use to control the society. After that analyze the power by using manipulation way is taken from Van Djik. Table 3.1 Speech act of racism utterances by white people. No. Scene Utterances Utterances of Racism Types of Speech act Table 3.2 The use of power and manipulation by white people. No. Scene Utterances Power Manipulation Conclusion Drawing and Verification No. RACISM KIND OF SPEECH ACT R1 Poor devils Representative In data analysis technique, the data are obtained through several steps based on the research questions. Finally, after doing reducing and displaying data, the researcher can be drawn and verified by using theory which used are power and manipulation, racism by Van Djik. RESULTS AND DISCUSSION Table of Racism R2 It's against the law for niggers to ride horses in this territory. Representative R3 They ain't never seen no nigger on a horse before. Expressive R4 Not on my property. Not around my niggers, he can't. Expressive R5 your fancy-pants nigger Expressive R6 Get that nigger outta here Directives R7 your loveliest black creatures Directives Table of Power No. UTTERANCES POWER MANIPULATION P1 Mr. Bennet : You and your Jimmie rode from Texas to Tennessee to buy one of my nigger gals? No appointment, no nothin'? Access and dsicourse - P2 Mr. Bennet : Betina, sugar, could you take Django there and take him around the grounds here and show him all the pretty stuff. Betina : As you please, Big Daddy. Access and dsicourse - P3 Mr. Monsieur Candie : - No, no, no, no, no. no beggin'. No playin' on my soft heart. I done paid $500 for you. When I pay $500, then I expectto get five fights out of a nigger, - 'fore he roll over and play dead. Black people : sir. . Mr. Monsieur Candie : Mr. Stonesipher?, Let Marsha and her bitches, send D'Artagnan to nigger heaven. Access and dsicourse - P4 Mr. Monsieur Candie : One more moment, doctor! Dr. King Schultz : What? Mr. Monsieur Candie : It's a custom here in the South. once a business deal is concluded that the two parties shake hands. It implies good faith. Dr. King Schultz : - I'm not from the South. Mr. Monsieur Candie : - But you are. in my house, doctor. - So I'm afraid I must insist. Dr. King Schultz : -insist. On what? That I shake your hand? Access and dsicourse Social Manipulation and Cognition manipulation P5 Dr. King Schultz : Is there one amongst you who was formerly a resident of the Carrucan plantation? Djanggo : I'm from the Carrucan plantation. Dr. King Schultz : Who said that? What's your name? Django : Django Mind control - Based on the result, the data proved that racism appear in "Django Unchained" movie. Racism is kind of belief that ignoring people who have different color of skin and the status of them. In this case, white people are drawn as the dominant group who has more power than black people. The dominant appear in society because of having differences power. Having differences of power reproduces inequality. Reproducing inequality in society can make racism, as in "Django Unchained" movie. Appearing racism is because of having inequality of power in the movie. Because of inequality, white people in "Django Unchained" do power abuse in order to they want to control black people and society in their interest. White people do power abuse, because they have more power than black people and white people has more than one in the base power resources like money, status, and job. Thus, they have more access to control black people and society. The word inequality and power abuse make a deal with the theory of Critical Discourse Analysis (Van Djik, 1998a). CDA tents to power, inequality and dominant. In this case, the function of CDA is to improve the way of thinking of society through "Django Unchained" movie. "Django Unchained" movie contains of racism. Van Djik (1995) adds that CDA focuses on text and talk especially in discourse and society. Text and talk contain of words and utterances. Utterances have relationship with study of speech act. According to Yule (1996) speech act contains of action which is done by utterances. Deborah (1994) adds that specch act is basicly concerned with what people "do" with language. So, people can do act by using language via utterances. There are many utterances appear in "Django Unchained" movie. So, in this case, speech act takes apart in analysis utterances. The use of speech act is to describe the conversation of the actors in "Django Uncahined" movie. Why describing conversation through speech act, because speech act can explain the action of the speaker through utterances. According to Yule (1996) people do not only produce utterances which contain of grammartical structure and words, but also show their action through utterances. Searle (1979) adds that people express their feeling and attitude, and they do all of them via utternaces. Speakers will emphasize what they want to speak by using the clearer words. According to Searle (1979), he does classification speech act into five, they are declaration, representative, expressive, commisive, and directives. By using classification of speech act, the reseacher can analyse the type utterances of speech act which white people as dominant group do racism. Thus, as the examples of classification of speech act, in R1 shows that the utterances contain of racism in representative speech act. Like, white people mock black people with uncommon utterances, as in R1 the white people called black people with "poor devil". The word "poor devil" in this utterance means that black people as poor people, because job of black people is only as slave. White people are always under or lower than white people, so white people mock black people as a poor. The word "devil" is a part of the satan who never does a good thing in their life. White people describe the life of black people as a devil. The others example of racism in the data is like R8, racism appear in the rules of law, the law forbids the black riding a horse, the reason is the status of black people, and only white people can ride a horse. In the R1 and R2, show racism through the status between white people and white people. The status between them makes an inequality in society. From the data R1 and R2, those are the prove that racism show by doing discrimination which done by white people. According to Essed (1991) racism is done by discrimantion through intimidation minority group and law. Pendakurs (1995) adds that racism can do by insulting, harrasing minority group. Those can happend because dominanted group use their power to do power abuse. According to Van Djik (1998a), inequality in society appear because a group or people who have more power than other group do power abuse. It implies that the dominanted group can control other group in order to follow the interest of dominanted group. Like in P3, white poeple who have the base resources of power show such as money, job, and status acn control society by using their the base of power resources. The conversation shows that Mr. Candie has more money to pay the black people. The status of black people is lower than Mr. Candie because Mr. Candie is the boss of black people. Having all of the power white people do power abuse. Besides having the base of power, white people have power of access and discourse and mind control in order to get good way to control society. Here in P1 conversation shows that Mr. Bennet as the owner of plantation has the base resources of power. He has higher status than others, because he is the boss of the plantation. Absolutely, he has a good job than others. It means his financial is better than others. P1 shows, Mr. Bennet as the owner of plantation, he can do many things in his plantation because he has access in his own plantation to control his plantation and society around the plantation. In P5, Dr. Schultz do mind control by changing his attitude in good attitude in order to Django will do what he wants, usually white poeple do bad thing in black people but in this case white people do a good thing in order to get his interest. Besides controlling by using the base resources of power and, access and discourse and mind control, white people use social manipulation and cognition to manipulate society by using good actor in order to society can not detect the lie from the white people. Doing manipulation, according to Van Djik (2006) that manipulators make others believe do things that are in the interest of the manipulatorinterests of the manipulated. It can againts the interest of the victim of manipulation. Lacking of knowledge can make manipulator do his manipulation well. Because the "victim" has no choice to belief or accept the knowledge itself. Like in P4 Mr. Candie do social and cognition manipulation, he does manipulation to his interlocutor follow his will. Mr. Candie is good social to do manipulation, because he succes does manipulation, he also use their knowledge to manipulate his interlocutor, it supports by his interlocutor does not about custom knowledge in South, so his interlocutor has no choice to reject what Mr. Candie wants. The term of racism can not be separated from power. People who use racism will deal with power. They use power in order to control society, controling society has purpose is to get their will through society. CDA is the key to know how power, inequality and dominant take apart in this movie. After discussing how power works in "Django Unchained" movie, people know how to use power in order to avoid power abuse around society. CONCLUSION AND SUGGESTIONS Conclusion This study reveals the relationship between racism and power. Those can not be separated because racism appear because of having more or less power between each group society. White people abuse their power to do bad thing in black people. Thus, CDA is a term to take deeper analysis in order to get improvement among society through text and talk. Text and talk which contain of words and utterances can define what people act. It is term of speech act which scholar analises act through utterances. So, people can know how people act through their utterances. Based on the results of the study, there are some proves that the movie contains of racism utterances. The racism shows through utterances. The white people do racism by mocking them, the way they mock black people are using kind of speech act such as directives, expressive, commisive and representative. White people do racism because they ignore the kind of thing which is different with them like color of skin, status, job and wealth. Inequality in society reproduces racism. Racism contains of power and manipulation. The inequality in society appears because each group has more or less power, for example the base resources of power are job, status, and wealth and also access and discourse power, and mind control. Inequality itself reproduce dominant among society. In addition white people do manipulation instead of using power to get easier to control and manipulate society. Suggestions As sugesstion for the future researcher, needs to take a deep analysis racism in others mass media. In this study the researcher takes a movie as her data. Movie is one of the member of mass media. So, the next researcher ca take others mass media like news, magazine, newspaper, radio, news televison etc. Another suggestion is from the area in Critical Discourse Analysis. Critical Discourse Analysis has many areas such as politic and society. In this data the researcher takes society. It means that next researcher can take other area In CDA. In addition, the way of analysis is so widely in the data. CDA can analyse from the power or even in ideology. In this study researcher takes racism to be analyzed in the scope of power and how the way dominant group utter racism. Thus, the next researcher can analyse the data from the behaviour of dominant group in racism area pschology in racism. REFERENCES Dahl, Robert. (1961). Power In Empowerment and Community Planning. Essed, Philomena. (1991). Understanding Everyday Racism: An Interdisciplinary Theory. Newbury . In Frances Henry and Carol Tator (eds.) Racist Discourse in Canada's English Print Media. The Canadian Race Relations Foundation, 2000. Fairclough, N. L., (1941). Language and Power. New York : Longman. Fiske, John. (1994). Media Matters: Everyday Culture and Political Change. Minneapolis: University of Minnesota Press. In Frances Henry and Carol Tator (eds.) Racist Discourse in Canada's English Print Media. The Canadian Race Relations Foundation, 2000. Litosseliti, Lia. (2010). Research Methods In Linguistics. New York : Continuum. Miles, M. B., & Huberman, A, M. (1992). Qualitative Data Analysis. New Park: SAGE Publications, Inc. Pendakur, Krishna and Ravi Pendakur. 1995. The Colour of Money: Earning Differentials among Ethnic Groups in Canada. Strategic Research and Analysis. Ottawa: Department of Canadian Heritage. In Frances Henry and Carol Tator (eds.) Racist Discourse in Canada's English Print Media. The Canadian Race Relations Foundation, 2000. Searle, J. (1979). Expression and Meaning. Studies in the Theory of speech Act. New York: Cambrige University Press. Van Dijk, T.A. (1998a). Critical discourse analysis. In Jaffer Sheyholislami In Critical Discourse Analysis. Van Dijk, T. A. (2006). Discourse and Manipulation in Discourse and Society. London : Sage Wodak, R,. & Meyer, M. (2001). Methods Of Critical Discourse Analysis. London : Sage. Wray, A., Trot, K., Bloomer, A., Reay, S., & Butler, C. (1998). Project in Linguistics: A Pratical Guide to Researching Language. China: Edward Arnold PublisherLtd. Yule, George. (1996). Pragmatics. Oxford University Press.

MARCH, J900 Qettysbur Mercury CONTENTS. The Power of Ignorance, 1 Remembrance, 8 The Death of King Solomon 8 The Uses of Dreams,. 13 Editor's Desk, 17 A Word Deserved, 18 Meeting of The Pennsylvania College Alumni Association of Harrisburg, 19 The Veil of Separation 20 The Dead on Expansion, 21 The Old Chief and The Black-smith, 22 Why We Broke Camp, 27 At The Breakfast Table 30 GETTYSBURG COLLEGE LIBRARY .GETTYSBU^!§bRG C DUPLiCfA'. i FAVOR THOSE WHO FAVOR US. For Fine. Printing go to CARLISLE ST. GETTYSBURG, PA. C. B. Kitzmiller Dealer in Hats, Caps, Boots and . Douglas Shoes GETTYSBURG, PA. Have you an assured -&&& R. I. ELLIOTT Dealer in Hats, Caps, Shoes and. Gents' Furnishing Goods Corner Center Square and Carlisle Street GETTYSBURG, PA. EDGAR S. MARTIN, F^CIGARS AND SMOKERS' ARTICLES. %/& tgr? Mr* Chambersburg St., Gettysburg. Would you try for a government posi-tion, if you knew just how to am" and the kinds __ positions from which you can choose, and what to do to insure your getting on the list after you have applied 1 The Government of the United States is the best of employers. Fair compen-sation, regularity of payment, reason-ably sure tenure, tasks not too difficult, i ana hours not too long, offer strong at-tractions to young personsof both sexes whohavenosettledincome. Manyenter Government employ, spend their spare i hours in studying law or medicine, or finance, and save enough from their salaries to start In a professional or business career. We have just published a book from whlchemy candidate may learn just what is necessary and wliat tinnecessary in | brushing up his studies for an examina-tion: and what his chancesare, all things considered, for making his way into the I Civil Service, and staying there. The title of this book is "How to Prepare i'or a Civil Service Examination ; U Hh Recent Questions and An- , swers." It contains all Information which any candidate would require to firepare for any competitive office under he Government, and includes a "Ten weeks1 Course of Study,"ln the form of questions actually asked at recent ex-aminations, with the correct answers to , them. Besides the technical require- ' menta. It also covers all the elementary branches, like arithmetic, spelling, pen- | manship, geography, letter writing, civil government, etc., etc., so that one who masters this course of study would not only pass well an examination for o, yov- , ernment position, but would be cure of I preferment over other applicants for a clerkship in a business house. CLOTH—$2.00 Postpaid—560 PAGES Another booJciree(Quick atFigures)if you mention this paper when ordering. mros & NOBLE, Publishers ' 4-6-13-14 Cooper Institute, N. Y. City SchoolbooTcs ofall publishersat one store .THE. GETTYSBURG MERCURY. VOL. IX. GETTYSBURG, PA., MARCH, 1900. No. 1 THE POWER OP IGINORAINCE. [ABSTRACT OF A LECTURE BEFORE THE TEACHERS' INSTITUTE, JANUARY 27TH, BY PROF. O. G. KLINGER.] I AM here to engage your attention for a little while in a sub-ject which is too seldom considered, but rich in educational value. It is the " Power of Ignorance." We often hear of the power of knowledge—it has been the pet theme of platform speakers for many generations ; but who has stopped to consider the power of the unformed intellect, or of the intellect developed but dominated by some blinding prejudice, or pride of opinion ? And yet Ignorance has played as mighty a part in the world's drama as Knowledge. All the domain which Knowledge calls her own has been wrested from Ignorance. Ignorance, dark, gloomy, superstitious, destructive, first; knowledge second—at the beginning a glimmer, a mere insight, a guess, and then a growing light—at the present a great luminary, an hour above the horizon. All that makes our nineteenth century habitable for men and women, such as you, is the product of advancing science. No other age has been so great as our age, because Knowledge has stricken off the shackles of superstition, shaken the obstinacy of bigotry, deepened the sympathies, augmented the value of human life, converted the forces of nature into servants, established the dignity of self-hood, brought freedom to light, conquered the ocean and annihilated space. Her advance has been in the face of Ignorance, which at each moment has con-tested with pen and fire and sword her progress. My object this evening will be to set forth as clearly as I may be able the power of this antagonist of knowledge, that in the light of it you may see more clearly the sanctity of freedom of research, freedom of thought, and freedom of speech. QETTYSBU*G COLLEGE LIBRARY GETTYSBURG, PA^ THE GETTYSBURG MERCURY. Remember, that knowledge is power only when it informs some human will, and directs some human choice. Knowledge concealed within the lids of books is not power—it is so much waste paper so far as the world's progress is concerned. It must possess the mind, illumine the intellect, impel the will in its choices, and become a human force. And by ignorance I mean the mind that is not informed, a will that makes its choices in the dark ; a htiman force without direction. But this is not the only kind of ignorance. It has happened in the world's history that men and nations of large culture have been so dominated by pre-judice, by pride of opinion, by love of party, by bigotry, as to avert from themselves the best blessings which the merciful Father had designed for them. There are wise fools in the world as well as dullones, and bigotry, which is but a form of ignorance, has been a great obstacle in the path of progress. Our thought must search for its illustrations in the cabinet of History, and they will not be difficult to find. Every page is re-plete with them. We take those that strike the eye first, because of their magnitude—conspicuous examples of the blighting effects of gross ignorance, and the more refined but less hopeful bigotry. I refer to the Barbarian invasion of Rome, the fall of Alexandria, the massacre of St. Bartholomew, and England's loss of her American Colonies. The tidal wave of ancient civilization, which took its rise in Egypt and the Mesopotamia, never flowed farther north than the Black Sea, the Carpathian mountains, and the Rhine river. Be-yond these boundaries lay in dark obscurity the terra incognita. Of this whole, vast, indefinite stretch the ancients had only the most meagre information, and they peopled it with the most hor-rible, most fantastic creatures of the imagination, as children fill the dark with hobgoblins and spooks. And as though their fears had been prophetic, out of this very region were to come the forces which would overturn their government, raze their cities, crush their pride, and extinguish their culture. The old civilization reached its maximum development in Greece and Rome—the former leading and the latter following in the sequence of history. In Greece it was expressed in a litera-ture and art the most perfect the world has ever enjoyed ; in Rome it took the form of an architecture, " full of expression of gigantic power and strength of will." The former gave to the THE GETTYSBURG MERCURY. world the Parthenon ; the latter the Coliseum. The former fur-nished ideals of the beautiful; the latter ideals of social order. Greece has since been the teacher of all that pertains to the aesthetic nature ; Rome of all that pertains to government and jurisprudence. ?j£ ?|s *f% yf* 5|* 'J^ *f* *"p While Greece was achieving her greatest triumph—while adorning her cities with the most exquisite art, perfecting her language, and evolving her beautiful philosophy ; while Rome was rearing triumphal arches, sending nation after nation under the yoke, and welding together the whole civilized world into one massive empire—up in this region of the north there was a strange restlessness, of which the southern nations never dreamed, but which forbode for them the most direful consequences. A dreary stretch of forest, reaching from the Rhine to the North Sea, unbroken save here and there by patches of cultivated land—a wilderness of mighty trees, which bowed their heads be-fore the Blusterer of the north, or sank beneath the weight of years, but at whose root the woodman's axe was seldom laid— whose deep recesses furnished safe retreats for bear and the wild-boar— such was Europe in the third century Anno Domini when the Goths first emerged from its retreats and stood upon the banks of the Danube. Great people they were, tall and massive of shoulder, with great swelling muscles—a giant each one, whose tawny hair, reaching to the shoulder, was his especial pride. From under shaggy eye-brows gleamed eyes which seemed cut out of blue Arctic ice, reflecting every flash of passion, and terrible when lit up with the rage of battle. Great animals, with the germ in them of great souls, true to their word, loathing nothing so much as shame and cowardice, with heart attuned to carnage, afraid to die elsewhere than on the battlefield—whose Heaven even was a Val-halla of eternal conflict—such were the Goths. Beyond them towards the east dwelt the Huns, a Tartar tribe. Let Gibbon describe them : '' These savages of Scythia were com-pared to the animals which walk very awkwardly on two legs. They were distinguished from the rest of the human species by their broad shoulders, flat noses, and small black eyes, deeply buried in the head ; and as they were almost destitute of beards, THE GETTYSBURG MERCURY. they never enjoyed either the manly grace of youth or the vener-able aspect of age." To render them more hideous still, while they were yet of tender age their parents gashed their cheeks with knives that their faces might look more ferocious with the ugly scars. They were so constantly on horseback that their legs received the curve of the horse's body. Their hideous appear-ance was a true index of their character—ruthless, lustful; they struck terror into the hearts of their enemies on the field of battle. Beyond them dwelt another tribe of people, of whose origin we know nothing, and of whose character we know little. The Sienpi were the natural enemies of the Huns, into whose terri-tory they made frequent incursions. Brave and savage, skilled in the use of such weapons as they had, they were able to chill with terror even the hearts of such creatures as the Huns. It is probable that under the pressure of these implacable foes the Huns migrated from their ancient seats, near the Chinese Empire, towards the west. Their coming in countless hordes was an astonishment to the valiant Goths, who trembled before their uncouth enemies and retreated before their onslaught. Thus it happened that in the fourth century of our era, the Goths suddenly appeared upon the banks of the Danube and besought a refuge within the bounds of the Roman Empire. Their petition was at length granted, and the fate of the South was sealed. At once, on the death of the great Theodosius, occurred the revolt of the Gothic tribes. Under the leadership of Alaric, after various vicissitudes, they traversed the country from the Danube southward and sought a rich harvest of fame and treasure in the fair land of Greece. Passing, without opposition, through the pass of Thermopylae, they ravaged the whole country to the plains of Sparta. *A* *A* *1* *±* *1^ *Jf* ^^ *^ *f* ^ *j* *r» *T* *T* *r* 'T* You have read of, even if you have never seen, the devas-tating power of the cyclone. The sun rises upon a stretch of prairie, beautiful with swaying grain, and dotted with towns and villages. The sky overhead is flecked with shredded clouds, which reflect and refract the sun's rays—distant prisms of hazy texture. Suddenly from out the sky, with scarcely a moment's warning, comes a mighty shadow. Your ear is startled by the deep bellowing of winds as they struggle in the upper air. Dower THE GETTYSBURG MERCURY. and lower they force each other in their whirling conflict. The one from the west hurls back the one from the east, and, with in-conceivable rapidity, the storm-cloud, lightning-riven, skims the earth. You know the rest. The sun sets at evening upon a blighted land, filled with ruin and death. \1A *JJ «X* *.IA »L* *±? ^f *!_.* if* if* *f* ^f* *J* ^T* *J* 'I* The passing of Alaric and his Goths left Greece stripped of her beauty ; her temples lying in ruins; her sculpture broken and stripped of its golden plates ; her towns and villages a mass of burning embers. '' The whole territory of Attica, from the prom-ontory of Sunium to the town of Megara was blasted by his baleful presence ; and, if we may use the comparison of a contem-porary philosopher, Athens itself resembled the bleeding and empty skin of a slaughtered victim." The cyclone of ignorance has passed, and what the centuries had achieved of all that ap-peals to the aesthetic nature was in a day destroyed by the barba-rians, whose natures were insensible to the allurements of beauty, except as it was expressed in the grace and symmetry of the female form. Alexandria, founded at the mouth of the Nile by Alexander the Great, and coming under the sovereignty of Ptolemy Soter, and afterwards of his son, Philadelphus, became under their fostering care, and by reason of its location, the foremost city of its day, and the real center of the Hellenistic world. It was from her that the Romans received the Greek civilization, which wrought such a miracle among them ; from her that the literary and artistic in-fluences went forth to mold the taste of Europe ; it was in her that poets and critics wrote and labored in the Hellenistic period. For the Ptolemies were patrons of art and literature, and invited to their court the learned from all parts of the world. To facili-tate research, a great museum, similar in character to our modern university, and a great library were established. Here were gath-ered the manuscripts of all the Hellenic writers, great and small. These the scholars of Alexandria, from the third century B.C. downward, sifted, preserving what was of value and destroying what was worthless. The works of the great thinkers, from Homer to Demosthenes, were edited, and their scholia form the foundations of all modern critical study. This happy state of things continued until the time of Bishop THE GETTYSBURG MERCURY. Theophilus, " the perpetual enemy of peace and virtue ; a bold, bad man, whose hands were alternately polluted with gold and blood." This narrow-minded bigot, caring only for power, knowing little of the glory of Greek literature, and caring less, pillaged the library, destroyed the compositions of ancient genius, and forever impoverished the world of scholarship. " Nearly twenty years afterwards, the appearance of the empty shelves ex-cited the regret and indignation of every spectator whose mind was not totally darkened by religious prejudice." Nor did the exquisite art which adorned the streets, as well as temples and private homes, suffer a less bitter fate. Images of gold and silver were melted, and those of inferior material were broken to bits and cast into the streets. Thus could religious fanaticism, inflaming the heart of an unscrupulous, ecclesiastical politician, and blinding his eyes to the enormity of his crime, subvert and destroy in a few hours what scholarship had accumu-lated during six centuries of labor. *J* 5JC ftfi *jC *fs 3j£ ?JC 5JC The darkest page in the history of France is that which re-cords the power and influence of the Guises. Hand in hand with the Queen-mother, Catherine de Medici, they labored for the ex-termination of the Huguenots. To trace here the intricate schemes, the diabolical plottings, the attempts at assassination, the submission of truth and honor to accomplish their design, would require too great a space. After unwearying effort, con-tinued through several years, they at length succeeded in winning the King's reluctant consent to the massacre of St. Bartholomew. At a given signal, in the early morning, the work of destruction began with the murder of Coligni, and when it ceased three days later, fully thirty thousand Huguenots had miserably perished at the hands of the Catholics. The persecution of the Protestants of France continued with varying degrees of savage intensity until the time of Louis XIV. This monarch, when old, was tormented by the memory of his many evil deeds, and sought some way in which he might atone for them before Almighty God. That way was suggested by his Queen, Madame de Maintenon. In pursuance of her awful plan, L,ouis revoked the Edict of Nantes, and outlawed every Huguenot who refused to embrace the Catholic faith. By this act of religious bigotry '' fully three hundred thousand of the most THE GETTYSBURG MERCURY. skillful and industrious of the subjects of Louis were driven out of the kingdom. Several of the most important and flourishing of the French industries were ruined, while the manufacturing interests of other countries were correspondingly benefited by the energy, skill and capital which the exiles carried with them." Many of them found their way to America, and their descendants have been among our most distinguished citizens. It is hardly too much to say that France has never recovered fully from the disastrous effects of Iyouis' infamous policy. *(£ 5jC 5|C ^|C 5J» *j£ *(> *1^ In the history of the world it has never been the privilege of any other nation to have such colonial possessions as had England in the New World. Her government of the colonies was one colossal blunder from the beginning, but it remained for the ob-stinacy of George the Third to alienate them wholly and convert them into "a government of the people, by the people and for the people." " He had," says Green, " a smaller mind than any English king before him, save James the Second. He was wretchedly educated, and his natural powers were of the meanest sort.'' He had but one idea—to embody in himself all the powers of the government. " Be a king, George," had been the contin-ually repeated exhortation of his mother from his early youth, and to be a king George thought he must be a tyrant. The story of his tyrannical acts which before twenty years had passed by had driven the American colonies into revolution and independence, and brought England to the verge of ruin, is known to every schoolboy, and would be a twice-told tale if repeated before this audience. L,et it suffice that we in America owe the government, of which we are so proud, to the conceit of one who was the most conspicuous failure that ever disgraced the English throne—to him we owe all, but for it all owe him no thanks. *«i* xL* *1* ^U -J-* *£* •& ^S ^^ *X* *T* *T* *T* *T* I am done. My effort has been to suggest to you the de-structive and pernicious power of ignorance in some of its most common forms. In spite of advancing science, superstition and bigotry and fanaticism still persist, though happily their power is limited in our day to the pen. Our eye is set on that day, no longer far removed, when freedom of thought and speech shall no longer be challenged; when the minds of scholars shall be free from prejudice; when the common man of our land, as in ancient 8 THE GETTYSBURG MERCURY. Greece, shall be able to appreciate arid to enjoy the finest art and literature; when in the workshop and on the farm, at the anvil and before the mast, we shall have men who think. The dawn has already broken; the full day will come in its own good time. REMEMBRANCE, If, perchance, in days to come, A truant thought strays back to me, Pray, believe the kindest ones In turn, are entertained of thee. As the sands along- the shore, To-day are thrown upon the beach, And to-morrow waves return To hurl them far beyond our reach; So the friends of yesterday, The ones we always held so dear, Quietly vanish from our sight, And leave us waiting, lonely here. —B. THE DEATH OF KING SOLOMON. THE king paused in his walk and, leaning against one of the tall pillars of the porch of the palace, gazed long at the flashing glory of the temple which rested like a diadem upon the brow of Mount Moriah. The sun had set ablaze the towering pinnacles of the building, and the burnished gold burned and flashed in the red rays of the setting sun. Already the purple shadows were creeping between the columns, and as the king gazed his face was exceeding sad and the shadows on his brow were deep as those between the columns. His waving hair was whitened by the frosts of three score winters. His eyes had not lost their piercing gaze, but his forehead was furrowed by care and his face had much of the sadness which too much self-indul-gence and the too familiar knowledge of the heartless world en-gender. His cheekbones were high and his chin rather promi-nent. The very spirit of majestic command seemed expressed in all his features. Yet withal, there could be traced about the mouth and eyes those delicate markings which are the imprint of a kindly, generous nature, and which contradicted the cynical THE GETTYSBURG MERCURY. expression which sometimes swept like the hand of a demon across his features. In his eyes and towering forehead there was a suggestion of that gigantic intellect which had grappled with all the problems of the universe. Kindly, just and God-fearing, yet self-indulgent, and led astray in his quest of happiness, the sadness which burdened his great soul was mirrored in his coun-tenance. Solomon, the mighty ruler, the matchless judge, the wisest scholar, the profouudcst philosopher and the learned psy-chologist— this Solomon, was old, and weary, and brokenhearted, troubled by the disasters to his great empire, which he foresaw, sad at the thought of many wasted years. As the sun sank below the horizon, he turned away from the temple and cast a momentary glance at the magnificence about him ; then with a gesture of contempt, he walked slowly into the cool, shadowy gardens of his palace. Long but slowly he paced among the shadowy paths, engaged in profound thought. It seemed as if his God, with whom he had once walked very inti-mately, granted him a knowledge of the close approach of death ; for suddenly he straightened his stooping shoulders and lifting his hand beneath a light where the gesture might be seen, he summoned the ever alert attendants. It was the king's will that the court be summoned. Swift runners sped from palace to palace in luxurious Jerusalem. Lords and courtiers rose from banqueting tables and hastened, wonder-ing, toward the palace. For had they not been summoned by the royal word ? And who in all the land might delay when King Solomon called? Surely, none. The great hall of justice was ablaze with light. Throngs of whispering nobles were the evidence of surprise at this night summons. Suddenly all were hushed. The heavy curtains at the royal entrance had been held aside and now the solitary figure of the king moved past the kneeling nobles to the great throne of ivory and gold. The king took his seat between the huge, crouching, golden lions and looked awhile in silence from one face to another. Some were old and tried friends and counsellors who had been with him when as a young man he had received the sceptre from the hand of Israel's God and his father, the royal David. Others were younger, and as his eye glanced from one to another, he thought of their fathers, some of whom were mighty warriors, others wise counsellors. IO THE GETTYSBURG MERCURY. At length bespoke: "Oh Nobles, I have summoned you hither this night, at this unaccustomed hour, to bid you farewell. This evening, for the last time, I saw the red light of the depart-ing sun kiss the house of our God, resting upon it like a beuison from the Most High. "I go unto my fathers. To-night, ere the first rays of the morning sun laugh on the waters of Jordan and wake our queenly city from her slumbers, I go on the last, long journey. I am old and very weary of life, and I go to the grave, whither ye all are hastening. '' Oh Nobles—Counsellors and Warriors—ye whose heads are hoar, and who follow me soon, long have we labored together for beloved Israel. Some, perchance, even knew my father, David. Oh, grey-heads ! your king loves you. " And ye, whose raven locks the frosts of many winters may yet whiten, sons of mighty men, my young men, your king loves you not less. Be ye faithful as your fathers to the God of Israel and your king. " Ye have seen my race, which now is nearly run. To the dominions of my father I have added, and have made Israel ex-ceeding strong and mighty. Ye, too, saw me turn aside from following after Jehovah. Ye know the punishment—how I must have this fair kingdom rent and torn from me. But know that the God of Israel, in his measureless kindness and mercy, which are even as the fathomless space of the whirling orbs, has par-doned my transgression and forgiven my sin. " Now the hour is come and your king goes to the court of the Ruler of the universe. My nobles—counsellors, warriors and statesmen—remember your love for Solomon and stand faithful. Turn ye not aside after riches and honor. 'A good name is rather to be chosen than great riches, and loving favour rather than silver and gold. The rich and poor meet together; the Lord is the maker of them all. A good name is better than precious ointment; and the day of death than the day of one's birth.' " 'Fear God and keep his commandments, for this is the whole duty of man. For God shall bring every work into judgment, with every secret thing, whether it be good or whether it be evil.' " But the night flees and my strength fails. This night, ere the rosy morning descends from the hills and touches the purple vineyards, I will to be borne to my palace which is beyond Giloh. THE GETTYSBURG MERCURY. II For, oh Nobles, know that a weary old man wishes, in his weak-ness, to look once more upon his pleasant palace which gleams in its whiteness, amid the green gardens, and from there be gathered unto his fathers. ' Then shall the dust return to the earth as it was, and the spirit shall return unto God who gave it.' " And now, fare ye well, my Lords ; may the mighty God of Israel be with you. Oh my children, a long farewell." The king stood for a moment with hands outstretched in bless-ing over the silent, awe-struck nobles, then moved with calm and composed step down from the throne at whose base the world had bowed. He gazed a moment longer at the assemblage of grey-headed men, who were separate ; then with a last majestic wave of the hand he passed from the judgment hall and the sight of his nobles forever. He hastened to his waiting chariot and was borne slowly along the road which leads to Hebron. His palace and gardens, with their pools which lay like three turquoise amid a sea of emerald, were his destination. Only once did the king rouse himself from the reverie into which he had fallen. As the white splendor of Jerusalem, bathed in the tropic full-moon, was disappearing behind him, he stood up in the rocking chariot, and with a gesture of matchless dignity, bade a last adieu to his queenly capital. Then he lapsed again into reverie. And of what did he dream? Who can say? Perchance it was of the future, per-chance of the past. Of that past when he ruled at Jerusalem, while the wealth of the world was poured in front of the lions of his ivory throne. The memories of a sacred and glorious past must have thronged upon him. Along this very road the mighty David passed and repassed. Here he had kept his father's flocks as a youth. Back and forth in this vicinity the jealous Saul had hunted him. Yonder, in the velvetry blackness, sleeps Rachel, the beloved of Jacob. There, alone, through the centuries, her ashes rest. A little farther on, at Giloh, the house of Ahithophel, the faithful counsellor of David, suggests its train of memories ; or perhaps some glorious vision of this plain, as it was destined tq appear, bathed in glittering light and echoing to the " Glory, in the Highest" of the angels, may have been vouchsafed to this son of David. And now, beyond Giloh, the chariot approaches the palace, 12 THE GETTYSBURG MERCURY. in the midst of its gardens. The weary old monarch steps from his chariot as he has done so often before at this spot. Hither, in the past, he has come in the dewey morning to find rest and quiet. And now, in the evening of his life, the king comes to his beautiful gardens to die. How the heart of that mighty ruler must have grieved as he looked back over the desolate years of which he had exclaimed "Vanity of vanities, all is vanity!" Slowly the king passes between the sculptured columns of his marble palace which rise, slender and graceful, to the distant roof swimming in dusky shadow; on between the two statuesque guards in their golden armor ; on, into the palace with its purple velvets and its tapestries. Fountains murmur and tinkle about him ; rare birds, strange beasts, gathered from the four corners of the world for the pleasure of this mighty potentate, are all around him. The mingled odors of many flowers float to his nostrils. But they are all unnoticed. In sad and solemn quiet the king paces slowly to his chamber. It has been whispered that the king wishes quiet and to be left alone, and the palace which in the years of the past has been filled with music and oftentimes with the sounds of revelry, seems to be without human inhabitant, and as silent as some great, white mausoleum. Only once, at the break of day, the attendants steal to the chamber of the king, and behold his form outstretched upon the couch, then as if terrified by the sight of the angel of death hovering over the king, they disappear. So, not surrounded by the nobles of the land or by sorrowing dear ones, but alone, the spirit of King Solomon stands on the •brink of the dark waters of the river of death and awaits the sum-mons of the most high God. Thus, while in communion with Jehovah, his spirit unterrified by the approach of death, is con-ducted into the council-chamber of the universe. And Israel's greatest king is dead. For "God's finger touched him," and even as the stars began to fade the mighty spirit of King Solomon had winged its flight into the unknown. Once more the lord of day ascends the dark mountains of Moab, and gleams upon the white palace which rests on the crest of a hill amid its green gardens like the white foam upon the crest of some dark-green wave of the ocean. In this palace, designed only for pleasure and joy, there is sadness and gloom. But the features of the king are tranquil and placid in death. Fven as at THE GETTYSBURG MERCURY. 13 evening the setting sun may break through the clouds and shine over the gray ocean, soothing the tired waters to rest, so now the morning sun lights up the countenance of the king and shows the perfect peace which has taken the place of the sadness and trouble. Amid the grief of a nation the king has gone to his last, long rest. —Max. THE USES OF DREAMS. C. L. '01. IT may be of interest to note at the outset some of the physical and the psychological phenomena of dreams. " A dream is a train of thought, images or phantasies, that passes through the mind in sleep.'' In dreams we lose all voluntary control over our thoughts, and our minds are, as it were, freed from all re-straints, turned out of the boundaries set by will, and left to roam at pleasure through almost infinite areas of thought and imagina-tion. Some claim that the activity of the soul does not cease for a single moment, and that dreams are one of the results of this constant activity. Others affirm, with equal certainty, that the soul has periods of inactivity and rest, when our sleep is entirely devoid of dreams. But does it not seem more reasonable that we forget our dreams, or rather fail to recollect them ? It is true, of course, that the action of the soul during the hours of slumber is much more feeble than during waking hours, but even this statement cannot be made without exception. Un-doubtedly the imagination is, at times, more lively in sleep than at any other time. A person, whose imagination is notably dull and lifeless, can, oftentimes, especially when just lapsing into un-consciousness, picture before his mind the most lovely, Edenic bowers, fairy landscapes, and scenic views that divest even Alpine glories of their rapturous charms. Occasionally the mind is very active also during periods of somnolence. This is proved by the fact that mathematicians, after having worked for days and weeks, perhaps, on a difficult problem, have finally solved it while wrapped in sleep. Again many persons of small originality and creative genius have composed poems of a merit that would have justly surprised them when awake, and have preached sermons and delivered lectures to enraptured audiences. Some persons of little or no musical ability have in their dreams outrivaled Mozart 14 THE GETTYSBURG MERCURY. and Beethooven in their musical productions, and their render-ing of them, and surpassed Jenny Lind and Patti in their vocal successes. The idea that the ancients had of dreams was vastly different from that which prevails at present. When superstition and witchcraft were fastened to everybody's creed, when ghosts stalked to and fro in every graveyard and haunted the scene of every murder, when enchanting sprites, bewitching elves, and diabolical imps jostled each other in the minds of nobleman and peasant, a dream was thought to be something of great import-ance and of good or evil omen. As each succeeding age has broken one or more of the super-stitious fetters with which it was bound and has approached nature and nature's God, and looked at nature not as a blind in-congruous force, but as an orderly and harmonious creation, evil has been traced to its source and found to consist not in the un-accountable and uncontrollable flights of a fanciful imagination, but in natural laws that have been violated or broken. This contrast may be explained by the difference between ancient and modern philosophy in accounting for the origin of evil. In Homer the thought is often emphasized that " Dreams come from Zeus," and a dream often meant as much as the flight of birds or the con-dition of the inspected vitals. The undertaking of an important expedition or of a desperate conflict often turned upon a dream of an officer during the preceding night, and many an unsuc-cessful exploit or disastrous defeat was traced to an ill-omened dream. Just after the expedition of " The Ten Thousand Im-mortals " had started on its perilous journey toward the capital of " The Great King," Xenophon, the leader of the expedition, had a dream in which, in the midst of a terrific thunder storm, he saw a ball of lightning fall upon his father's house, enveloping it in flames. The report following the bolt waked him. He considered the dream favorable because it seemed to be a token sent from Zeus, the author of dreams. On the other hand it seemed like an evil omen in that it might be interpreted that the " Immortals " were to be surrounded by the barbarian hordes as the house had been by the flames. No doubt the wretched failure of the expedition was largely accounted for by the commander's dream. THE GETTYSBURG MERCURY. 15 Possibly no other book is so replete with stories of dreams as the Bible. It is reasonable to suppose that before the dawning of the " New Dispensation " divine communications were often sent to mortals through the media of dreams. Joseph's dreams seemed to his jealous brothers, and also to his devoted father, to be a mere idle, if not presumptuous, fancy of superiority over them. His brothers hated him because of their own interpreta-tion of his dreams. They were unable to free their minds of the unpleasant prophesies which they thought the dreams contained, so they cast him in a pit at Dothan, and then, as if to make more sure against the dreams' fulfillment they bartered him off to an Egypt-bound caravan of Ishmaelites. This " Dreamer " in-terpreted his own dream, and his brorhers were, afterwards, only too glad to make obeisance to his fruitful sheaf. Passing by many significant dreams, let us notice the dream which came to Joseph, husband of Man', the mother of Jesus. He was warned in a dream not to remain in Judea, but "to take the young child and his mother and flee into Egypt." Upon the prompt obedience to this dream depended the life of the infant Jesus. Had Pilate heeded the warning of his wife's dream, he would not have delivered up Jesus to be crucified. In these in-stances dreams seemed to be angelic messengers from God with important dispatches. We recall the dream of the late, venerable Dr. A. J. Gordon, pastor of the Clarendon Street Baptist Church, Boston, which in-spired him to write that popular book, "How Christ Came to Church." In his preface the author states that he is not so sup-erstitious as to believe that every dream has a good or a bad meaning, but he believes, as in his own dream, we may learn val-uable lessons and receive wonderful inspiration even from dreams. Indeed, there are many cases on record where a dream has in-spired the mind to accomplish a skillful and even a masterful fete. Coleridge's " Kubla Khan" was suggested to him by a dream while he sat napping in his chair. Upon awaking, he seized his pen and wrote from memory that composition. The great musician, Tartani, composed his famous "Devil's Sonata" under the influence of a dream, in which his Satanic Majesty en-chanted Tartani by his wonderful exhibition of skill upon the violin, and challenged the dreamer to a match. As soon as Tar- i6 THE GETTYSBURG MERCURY. tani awoke he took up his violin and composed, in answer to the challenge, the above named composition. In the time of Shakespeare dreams were often misunderstood, and one of the most unpleasant aspects of death was the frightful dreams which were thought to accompany it. In Hamlet's So-liloquy on Death, when contemplating suicide, the " dread of something after death"—harrowing dreams, prevents him from becoming his own murderer. "To die,—to sleep ; To sleep ! perchance to dream /—ay, there's the rub ; For in that sleep of death what dreams may come, When we have shuffled off this mortal coil, Must give us pause." It is the thought of these fearful dreams that makes him decide to bear " Those ills we have Than fly to others that we know not of." We owe a debt of gratitude to those promoters of civilization which have unveiled to us those harmless forces which were for centuries enshrouded in an awful mysticism. We recognize that dreams are simply the production of an unbridled fancy, of an imagination uncurbed by will, the "reflections of our waking thoughts." We no longer believe that to dream of gold is good luck, and to dream of silver, bad luck. We reply to such a thought the words of the proverb, " It is as idle as a dream.'' We sometimes gain some inspiration and profit from dreams, but we do not invest them with power to bring us either ill or harm. We see in them a proof of our immortality, and often associate them with our condition after death, but in no terrifying way, and as far as disturbing dreams are concerned, we may meet our death " Like one who wraps the drapery of his couch About him, and lies down to pleasant dreams." .THE. GETTYSBURG MERCURY. Entered at the Postojice at Gettysburg as second-class matter. Voi,. IX. GETTYSBURG, PA., MARCH, 1900. No. 1 Editor-in- Chief, . A. VAN ORMER, '01. Assistant Editors, W. H. HETRICK, W. A. KOHLER. Business Manager, H. C. HOFFMAN. Alumni Editor, REV. F. D. GARLAND. Assistant Business Manager, WILLIAM C. NEY. Advisory Board, PROF. J. A. HIMES, LIT. D. PROF. G. D. STAHLEY, M.D. PROF. J. W. RICHARD, D. D. Published monthly by the students of Pennsylvania (Gettysburg-) College. Subscription price, One Dollar a year in advance; single copies Ten Cents. Notice to discontinue sending the MERCURY to any address" must be accompanied by all arrearages. Students, Professors, and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE GETTYSBURG MERCURY, GETTYSBURG, PA. EDITORS DESK. WITH this issue the ninth volume of THE GETTYSBURG MERCURY begins. The retiring staff, continuing the work of their predecessors, have delivered into our hands a journal that occupies a high place among college publi-cations of the state. Their encouraging words and helpful sug-gestion, together with the kindly expressions of THE GETTYS-BURGIAN, and. the readiness with which contributors have re-sponded to our call for material, give us encouragement. We now fully realize the burden of work that it is ours to bear; neither are we insensible of the responsibilities that rest upon us; hence we solicit a continuation of the same co-opera-tion thus far extended to us, that we may present to the students, alumni, and friends of the institution a literary journal worthy of Pennsylvania College. i8 THE GETTYSBURG MERCURY. The recurrence of the twenty-second of February naturally causes one to look back through the not yet dim vists of Ameri-can history to the days of the Great Commander, whose life is a panorama of noble, self-sacrificing, patriotic deeds. We read with admiration of his boyhood and youth ; we see his growing worth as he delivers Gov. Dinwiddie's message to the French officer ; we gaze upon him with }oy as he tells the British general how to fight the Indians ; we laud his bravery as we see him in the front of many battles, and as he crosses the raging Delaware on that fateful Christmas night; we raise our hats in reverence while he fervently implores the interposition of the God of Bat-tles in behalf of the Continental armies ; but to know his true worth we must follow him further—we must see him cast aside the proffered crown and become a private citizen; we must note his magnanimous spirit at Yorktown, read the record of his suc-cessful administrations, stud}' his farewell to the American people and follow him once more into private life ere we can fully ap-preciate him whom '' Providence left childless that he might be called the Father of his Country." A WORD DESERVED. THE business manager and the assistant business manager of the late MERCURY staff have done so much for the journal that they should receive special mention in its columns. The chief difficulty in the way of the monthly nearly always has been lack of money. Occasionally, but not often, a manager has been found who, at the expiration of his term, could give a respectable report to the literary societies. Two years ago, on account of financial embarrassment, the monthly was changed from a news and literary journal to a journal entirely literary, and its name was changed to "THE GETTYSBURG MERCURY." In the first year, during which at least one issue was not published for want of money, THE MERCURY ran in debt, and serious thought was at times entertained by the staff of giving up the paper altogether. Such was the pecuniary condition of THE MERCURY when it fell into the hands of Mr. Hamacher and Mr. Moore. As regards what was done, it is sufficient to say that at present the paper is THE GETTYSBURG MERCURY. 19 on the best financial basis she .ever has known, and considering the chaotic state in which the late staff received it, we may say-without exaggeration that Mr. Hamacher has proved himself an exemplary business manager. —H., '00. MEETING OP THE PENNSYLVANIA COLLEGE ALUMNI ASSOCIATION OP HARRISBURG. THE annual business meeting and banquet of the Pennsyl-vania College Alumni Association of Harrisburg and vi-cinity was held at the "Harrisburg Club" on the evening of February 27th. At the business meeting the Committee on Or-ganization and By-laws submitted a Constitution which, with several minor alterations, was duly adopted. An election was }hen held for the selection of officers for the current year, the following being elected : President, M. H. Buehler, Harrisburg ; Vice-Presidents, Capt. F. M. Ott, Harrisburg; Rev. D. H. Gilbert, Harrisburg; Rev. F. D. Weigel, Mechanicsburg; Secretary and Treasurer, Chas. Hollinger, Harrisburg. At the termination of the business meeting the members ad-journed to the banquet hall of the Club, the walls of which were gracefully draped with flags and college colors, while numerous palms and other tropical plants were tastily scattered about the hall. In an alcove to one side was seated a full orchestra and mandolin club which rendered classical selections during the pro-gress of the banquet. Covers were laid for forty-two and an ex-tensive menu, served in the highest style of the culinary art, was thoroughly enjoyed. The Association had the honor of entertaining as its guests prominent Alumni of the various educational institutions; Yale being represented by Hon. Lyman Gilbert, Harrisburg; Prince-ton by Charles A. Bergner, Harrisburg; Dickinson by its Pres-ident, Dr. George E. Reed ; Irving by President Campbell; Penn-sylvania College by President H. W. McKnight, Prof. O. F. Klinger and Prof. Chas. Huber ; other guests being Mr. Charles A. Kunkel, Harrisburg, and Dr. Leslie Kauffman, of Kauffman, Pa. The office of Toastmaster was ably filled by Capt. F. M. Ott, '70, and toasts were responded to as follows : "Pennsylvania Col- 20 THE GETTYSBURG MERCURY. - lege," Prof. 0. F. Klinger; "Yale," Hon. Eyman D. Gilbert; "Colleges for Our Sisters," Dr. E. E- Campbell; "Princeton," Charles H. Bergner, Esq.; "Our Rival," Dr. George E. Reed; "Our Alumni," M. W. Jacobs, Esq. Addresses were also made by President McKnightand Rev. Dr. D. M. Gilbert. This initial banquet of the Association proved to be an unqualified success and was one of the most successful and complete functions of the kind ever held in Harrisburg. The members of the association present were : Rev. T. B. Birch, Prof. C. F. Kloss, Prof J. F. Kempfer, Rev. E. D. Weigel, all of Mechanicsburg; Rev. M. P. Hocker, Steelton ; Rev. Benj. R. Lantz, Millersburg ; Rev. G. M. K. Diffenderfer, Newport; Dr. J. F. Staley, Mr. F. W. Staley, Middletown; J. S. Alleman, Esq., Arthur D. Bacon, M. H. Buehler, Jno. F. Dapp, Meade D. Detweiler, Esq., Rev. Luther DeYoe, Dr. C. B. Fager, Dr. V. H. Fager, Prof. L,. O. Foose, Rev. D. M. Gilbert, Jno. W. Hay, M. D., C. H. Hollinger, John Hoffer, Jr., M. W. Jacobs, Esq., Croll Keller, Dr. Geo. B. Kunkel, Rev. Marion J. Kline, Dr. J. B. Mc- Alister, Capt. F. M. Ott, Dr. C. A. Rahter, Rev. M. H. Stine, Dr. H. B. Walter, E. H. Wert, Esq., H. M. Witman, all of Har-risburg, and Rev. J. Edw. Byers, Penbrook. ^ THE VEIL OE SEPARATION. " Ah sir, there are times in the history of men and nations when they stand so near the veil that separates mortals from im-mortals, time from eternity, and men from their God, that they can almost hear the breathings and feel the pulsations of the heart of the Infinite. Through such a time has this Nation gone, and when two hundred and fifty thousand brave spirits passed from the field of honor through that thin veil to the presence of God, and when at last its parting folds admitted the martyred President to the dead heroes of the Republic, the Nation stood so near the veil that the whispers of God were heard by the children of men." —JAMBS A. GARFIBW. THE GETTYSBURG MERCURY. 21 E THE DEAD ON EXPANSION. XPANSION is in future the policy of our country, and only cowards fear and oppose it."—Buchanan. " It is of very dangerous tendency and doubtful con-sequences to enlarge the boundaries of this country. There must be some limit to the extent of our territory, if we would make our institutions permanent. I have always wished that the country should exhibit to the nations of the earth this example of a great, rich, powerful republic which is not possessed of the spirit of aggrandizement. It is an example, I think, due from us to the world in favor of the character of republican government." —Webster. " We are not seeking annexation of territory, certainly we do not desire it unless it should come by the volition of a people who might ask the priceless boon of a place under the flag of the Union. I feel sure that for a long time to come the people of the United States will be wisely content with our present area, and not launch upon any scheme of annexation."—Blaine. The editor of the School Gazette, after quoting the above, ex-plains that the utterances of Buchanan and Webster were made when the South sought to increase the territory of the Union, and that Blaine's statement is only ten years old. Her Dewey lips Hobsoned his, while like a Shaft'er glance, Schley-ly thrown with a Sampson's strength, pierced through his heart, Weyl'er true love was Miles away, suffering Cervera heart-pangs than this false woman could believe. "O'tis beyond me," said he," why I should Merritt this ?'.'—From the Lesbion Herald. " When you see a stately temple, Fair and beautiful and bright, With its lofty towers and turrets Glistening- in the sun's clear light, Think how soon the noble structure Would to shapeless ruin fall, Were it not for sure foundations Firmly laid beneath it all." —DR. C. H. PAYNB. II 22 THE GETTYSBURG MERCURY. THE OLD CHIEF AND THE BLACKSMITH. THE final day had come and the east was already bright with day. In golden splendor the pure sun mounted the hori-zon of a calm, cloudless sky. Its yellow rays lit up the green patches of corn and pasture in the most delicate colors and tiuted the distant mountains, stretched in majestic line far into the north, in soft purple. All was calm and peaceful. Silence seemed to rule the universe, as if it had hushed it for a great oc-casion. What an occasion it was ! Among those mountains the poor Indian was busy long before sunrise preparing with sorrow-ful mood a journey of the deepest woe and gloom. Yes, this was the day. The red man must change his home. Those hills so rich in fruit and grain were not his. The barren mountains had no place for him. He lived on the white man's ground. He hunted the white man's game. One last, lingering look on a happy home, the abode of his ancestors, his rightful inheritance, where once he enjoyed his wild day unmolested and drove his game over unclaimed land. He must go and the white man gives no farewell, no sign of sorrow, no clasp of the hand, save one, a hard laborer, an honest blacksmith. The early morning found his roughly-made work-shop at the foot of the mountains in full operation. Now the noisy anvil broke the deep silence and now the groaning bellows breathed loud and heavily, sending the black smoke far into the clear sky. Within and without in scattered heaps lay almost everything that a smith could make use of, and much more that he couldn't use at all. The workman stood by the side of the forge, his one hand bounding up and down with the handle of the bellows, the other poking at intervals the roaring flame with an iron rod. He was a large, broad-shouldered man, with slightly bended back, a re-sult of his much stooping. A thick gray beard swept his broad breast, which was partly exposed by an open shirt. His face was large and stout, of hard masculine expression, full of force and intelligence. A well proportioned head, broad, high forehead and prominent chin, showed a man of no low, trivial thought, but one of judgment and decision ; a man, who, if he would have a chance to develope his powers, might have been a genius, but by force of circumstances remained uneducated, possessing, however, THE GETTYSBURG MERCURY. 23 a great amount of good common sense, which he made use of when the occasion demanded it. As he stood by his work his brow was tightly contracted and his eyes firmly fixed on the flame. He was thinking. What were his thoughts ? Let us believe that he was thinking of the Indian. He ofteu thought of him. He pitied him. He believed that the Indian deserved a home and that he could love a home with as much tenderness and fidelity as any one else ; that he had feelings and that he had a soul as immortal as his own. Such were the thoughts of this poor workman as he stood in his shop on the last day for the Indian in his Eastern home. Suddenly a man appeared before the door. The smith, somewhat taken by surprise in the midst of his thought, quickly turned and beheld before him a neighbor; a farmer who was generally known in the community as being of a sour, selfish disposition ; a man with whom the smith could never become wholly reconciled. He was one of those many persons whose only care and thought is to en-large his borders, heap up his wealth, drive his wife and children at the first peep of day from their warm beds into the fields, and at evening reckon a profit of five cents a good day's work. He had no thought for the Indian. He hated him and could scarcely wait until he would leave the country forever. The reason for this was a selfish one. He found out that the Indians had dis-covered a silver mine iu the mountains and were working it with immense success. "They couldn't take this along," he argued, ' 'so the first man to find it would be its owner.'' He knew that the blacksmith was in close friendship with the redskins, and more than likely would know more about its locality and value than any other person in the neighborhood. He therefore came at an early hour to the shop. The smith began the conversation. " Good morning, Henry. A beautiful day?" "Splendid," replied the farmer. "They can't complain of bad weather.'' " No, they can't," answered the smith, " and I don't believe the weather bothers them much. They have other things to com-plain about; a lost home, for instance." "And lost produce and grain," quickly returned Henry. " I'll warrant they will have to raise their own now." " Henry," answered the smith with earnest expression, look-ing his visitor fair in the face, " I don't believe they ever stole a 24 THE GETTYSBURG MERCURY. cent's worth from you. You have not treated the Indian right and he knows it, and before he would steal your crops in revenge behind your back, he would meet you face to face like a man." " Well, what I see with my own eyes I guess I can believe," replied the farmer in great haste. " But whether they stole it or not, how about the mine? They can't take it along." " No, they surely can't," said the smith, sorrowfully, " but I would to God they could. Some of our greedy neighbors, ex-cuse the word, Henry, you know it's the truth, some of our greedy neighbors can hardly wait until the Indian leaves to lay hold on that mine, the only means the poor creatures have of making a livelihood. They are friendless, homeless, without pity or sympathy, and worse than all, an unknown west before them. It's shameful. But, Henry, one thing I wish with all my heart, and that is that these mountains might bury the treasure deep in their bosoms before the merciless white man pollutes it with his unworthy hand." "Come, come, come," began the other. "You're on your old subject again. That isn't the point. Some one will get it and so why not try for a share ?" No sooner had the last word slipped from the lips of the farmer than both were startled by the clatter of hoofs over the little road-bridge by the side of the shop. Henry walked briskly to the door, saw the Indian, immediately returned, somewhat paler, however, and whispered to the smith, " It's the chief." The Indian entered, dressed in all the gaudy decorations of his rank. His black silk hair fell gracefully about his muscular shoulders. His face was broad and brown, painted in circular stripes of various colors. A pair of black eyes, tightly pinched, glanced sharply over his high, prominent cheek-bones. Although old, as the wrinkles in his forehead would indicate, he seemed as agile and quick of motion as a young warrior on his first hunt. Bending himself slightly forward he made a becoming salute with his right arm, and, with eyes tenderly fixed on the old smith, ad-dressed him. '' What I have to say will not be long. You know all. The red man must leave his native hills for the barren west. The day has come when he must bid adieu to his mountain home. He comes to give good-bye to a friend. The Indian leaves many enemies, but he comes to give the blacksmith a kind farewell. He envies not his little home, his small fields, his blacksmith THE GETTYSBURG MERCURY. 25 shop. May he live in peace. May prosperity gladden his ad-vancing years. Ah, no more shall he bend his back beneath the horse. No more shall he swing the sledge. The red man's friend shall be rich in fields, proud in wealth, honored among men. The treasures of mines shall make happy his children's homes. His grand-children shall live well, they shall be truly fortunate. The Indian's silver shall be theirs and it shall prosper in their hands." " Come," continued the chief, drawing a silken scarf from his waist, " come, friend, let me bind your eyes and I will lead you to a treasure such as man never beheld before. Come, it is yours." The old smith was astonished at the chief's offer. He stood mute and silent. Recovering himself he approached nearer to the Indian and with broken speech humbly addressed him. "I thank you heartily, chief, for your ofier, but I cannot accept it. I live happy. I work hard all day long and am satis-fied with my little home and family. What do I want with all that wealth ? Why do I deserve it ? I could not rest night or day by living off of the Indian's silver. No, chief, I refuse it. I thank you for the offer, but give or sell the mine to one who could work it with untroubled conscience." The chief was greatly troubled by the smith's refusal and was on the point of pressing his offer further, when Henry broke in, his face beaming from ear to ear as though he was sure it was his already. " I'll let you bind my eyes, venerable chief. I'll take it." The Indian, with angry countenance, drew back in amaze-ment and with scorn answered him. "Youtakeit! Ah, no, no, no, white man ! Rather let it rot with the ages than have it en-rich the hand of an enemy." Approaching the smith again he kindly entreated him to accept. "It's yours, take it. Come, let me Show you your wealth ?" " No, I can't accept it," inter-rupted the smith humbly. " It would bring worriment upon my gray hairs and strife among my children. No, I can't manage so large a treasure." The chief, now aware that it would be useless to urge him further, quickly stepped forward and said : " Then, if you will not take my silver, take my hand. The mine will remain where it is. Man cannot find it. It is the Indian's treasure and ever shall be." Then bowing low before the old man he withdrew to his horse, mounted and departed for the mountains. The farmer, j| 26 THE GETTYSBURG MERCURY. not feeling very well, quietly walked to the door and was gone without a word. It was some time before the blacksmith returned to his work and resumed his place at the forge. He thought the matter over and over and finally concluded that he had done the right thing. He worked hard that whole day till evening, when he locked the shop, walked silently home and told his wife and children the whole story. They all in the old quaint way agreed that father had done the best and so went to bed and slept. The next morning the smith arose bright and early, as usual, greatly refreshed from the anxiety of the previous day. After breakfast he started for his shop, which was not far distant, thinking not so much of the fortune which he had refused as Of the wandering Indians, who must have been by that time far on their journey. Arriving at the shop he unlocked the shabby door, entered it and taking a small iron shovel from the wall stepped to the forge and began to clear away the ashes to start a fire. After thrusting his shovel several times into the heap, he became greatly astonished at the smallness of the hole. It seemed to have grown much smaller during the night. Bending over the forge he began to scrape away the ashes with his rough hand. To his surprise he found that at the bottom of the open-ing stood a bright, round kettle filled with silver blocks about an inch square. With trembling hands he lifted the treasure from its hiding place and stood it on the anvil, noticing at the same time a small piece of paper sticking out over the rim of the vessel. Drawing this gently from the blocks he unfolded it and saw drawn in rough outline the figure of an Indian, under which was written the words, " To the Indian's friend." —W. H. H., '01. " "When you see a mig-hty forest, With its tall and stately trees, Lifting' up their giant branches; Wrestling with the wintry breeze; Do not fail to learn the lesson Which the moaning winds resound, Every oak was once an acorn, All unnoticed on the ground." —DR. C. H. PAYNE. THE GETTYSBURG MERCURY. 27 WHY WE BROKE CAMP. TEIYL you a story? Well, if you have patience enough I'll tell you of an experience I had last summer vacation, while on a camping trip. You see, every summer vacation when I come home I spring it on the " old gent," that, after having worked so hard for nine months, my poor brain needs rest. Well, he takes it all in, and gives me a vacation of several weeks. Then the old gang gets together, and we go on a few weeks' loaf. Fun ? Well, I should say so. I^ast Summer, following our usual custom, we visited "Straw-berry Island," a beautiful little Island in the middle of the broad Susquehanna. Here there is but one small village of a few hun-dred population. The rest of the square mile of the island is heavily wooded, and affords an excellent place for campers. Usually there are anywhere from three to six parties camping on the island. But at the time we were there none of the others had yet arrived. Soon we were settled down, and were enjoying ourselves very much in hunting and fishing. One evening after we had been there about a week, I went to the village for our mail. When I got back, and distributed the letters to their respective owners, I took my own letters and drew apart a little to read them. The first one I opened was from my father. (You know my father is postmaster in the town in which I live, and, as it is a pretty large town, usually has large quantities of stamps, besides a good deal of money, on hand.) Well, to continue where I left off, the first letter was from my father, and the very first line conveyed to me the startling news that the post-office had been robbed the previous week of a considerable sum of money and about $400 worth of stamps. There was no clue to the robbers, and at present the officers were at a stand-still in their investigations. It is needless to tell you that I was surprised at the news. My first thought was to leave for home next day, but further in the letter father said I needn't let this spoil my fun, and that I should stay as long as I wished. So I decided to stay. The next afternoon I was appointed to run over the island in search of some stray chickens for our evening meal. I started about four o'clock, and leisurely made my way across the island. About a quarter-mile beyond the village I came upon a thick 28 THE GETTYSBURG MERCURY. clump of trees and undergrowth, situated about three hundred yards from a farmhouse. Thinking this would be a good place for the chickens, I cautiously made my way into the thickest part of the copse. Suddenly I was startled by hearing a gruff voice directly in front of me. I stopped at once, and soon heard another voice, raised in an altercation with the first speaker. He was cursing him roundly for a cheat and a rascal, saying that after having done the dirty work (I couldn't quite catch what), he wasn't going to take a cent less than half of the haul. I be-came interested in what was going on, and crept closer to the speakers, and saw two as villainous and rough looking toughs as ever I beheld. Between them they had a large bag of money, and beside the larger of them lay a peculiar oblong tin box, which somehow or other seemed very familiar to me. All at once it struck me that that was the stamp box which I had seen so often in my father's safe at home. Then it flashed upon me that these were the robbers who had so neatly eluded the officers of the law. My first impulse was to get back to camp at once, tell the other fellows about the robbery and my discovery, and then come and capture these fellows. But, on second thought, I saw it would be wiser to watch them, and find out where they took the booty. Soon the rascals came to an agreement, and decided that they would hide the " swag " until a convenient time should offer for them to dispose of it. They then picked up the bag and stamp box and made their way toward the other side of the island. It was now nearly dark, and I thought I could safely follow them. So I waited till they had gone, and then cautiously picked my way after them. After a half-hour's walk they came to a small tent pitched in a wooded hollow near the shore. They entered here, and I crept up close to catch every word concerning the disposal of the money and stamps. After a good deal of discussion they decided to bury it in the ground under the tent, and in order to do this I knew they would have to move the tent; so I quietly slipped away and hurried off as quickly as possible to our camp, and told the boys about the whole matter. They were eager to go at once, and even more so when I told them that the postoffice authorities had offered a re-ward of $500 for the capture of the robbers. Now, this meant $100 apiece for us, and we could do a good many things on $100. So we decided to go that very night. THE GETTYSBURG MERCURY. 29 We had with us several revolvers and hunting-guns. Each fellow armed himself with one of these, and was soon ready to set out. We started about eleven o'clock, and reached the village a half-hour later. Here I stepped into a store, telephoned to the police at home that I had caught the thieves, and then proceeded. About twelve o'clock we were nearly at the robbers' camp, and I told my chums to take it easy so that we might take the men by surprise. Every fellow cocked his revolver and made ready for business. We crept silently up to the tent, and, peering in, saw two dark forms lying within, sound asleep. Then we entered, and order-ing two of the boys to cover each man, I proceeded to awake the larger and tougher of them. I succeeded pretty quickly, and soon had him securely bound, and then proceeded to do the same for his partner. We found all the booty buried in the earth under the tent, and then loosening our prisoners' legs, ordered them to march on ahead. We soon reached our camp, and binding the men again so that they could not get away, we took turns at guarding them during the night. We held them till the next evening, when my father came with two officers. We all set out for home, and soon had the satisfaction of seeing the malefactors in prison. In due time we received the reward. I saved mine, and father added a substan-tial sum to it. That's the reason I am flush this term. Come up town and have some oysters on me, the whole gang. — " APFI,EBEB." '■ Oh, wad some power the g-iftie gie us To see oursels as ithers see us ! It wad frae monil a blunder free us And foolish notion, What airs in dress and g'ait wad lea' us And e'en devotion." -BURNS. i\ 30 THE GETTYSBURG MERCURY. AT THE BREAKFAST TABLE. GRACE had been said. The preacher of the village, whose gray hairs had never been endangered by conjugal wrath, in short, who was a bachelor, had performed that solemn office, as was his wont, at the Lyn boarding-house. Around the table sat six. The preacher, by right of his sober mien and broadcloth, of course, occupied the first place of honor, that is, he sat at the end of the table next the door leading into the pantry, from which issued the appetizing sound of the sizzling, sputtering and splashing of the cooking, or the rattle and clatter of pots and pans, and occasionally, to vary the program, the bang of falling dishes invariably followed by a lecture on culinary economy and general management by the matron of the establish-ment, who at divers times and in divers manners, delivered these emphatic and lengthy dissertations to the cook, a buxom, grin-ning lass of perhaps sixteen summers, who bore several red marks on her face, testifying to the violence of gesture with which the lecturer was accustomed to drive home her rather striking argu-ments. Next to the preacher sat Mr. Eyn, who boasted the empty title of " Eord of the House "—a little, pinched, henpecked piece of crusty mortality, who spoke with a very emphatic "I intend" or " I will," but, as I observed, only when his wife was in the pan-try and the door closed. In her presence, or within range of her eye through the open pantry door, he seemed to sink about six inches in stature, and peep slyly out of the corners of his e3'es, like a cat expecting a sudden and unannounced visitation of boot-jacks and stove-pokers. Beside the hard-fated Mr. Lyn was situated, geographically speaking, a volcano of sentimental effusion, or, perhaps better, sat the village poet. He looked like a poet, at least to a stranger, having all the visible qualifications—long hair, a sentimental air, a canary-like whimper that sometimes sounded like the sigh of a zephyr, and a box of dyspepsia tablets sticking out of his vest pocket, which would most strongly confirm the theory suggested by the unbarbered hair. At the end of the table, opposite the snowy-templed " shep-herd in Israel," sat the school-mistress, another very important functionary in the village, enthroned in dignity and starch. She THE GETTYSBURG MERCURY. 31 always dressed in a rusty shade of brown satin, evidently to match her complexion, and had it so thoroughly starched that she could sit down only in one way, there being only one hinge in the dress. She was always " precise" and plain, never bedecked herself with flowers, perhaps because she couldn't starch them. Slight in figure, in her rusty armor she looked not altogether unlike a mud-wasp— a dignified mud-wasp. Her features denoted character, but as Pat said, who sat around the corner from her, they looked a little smoke-dried. Pat was a red-nosed Irishman, with a broad, open, jolly Irish face, always lit up with an expression of bantering humor, and partly covered with a thin, scattered crop of stubble. He was the man of all work about the establishment, and bossed about by the lady of the house, curtly snapped at by the next highest power, Mr. Lyn, divinely stared at by the volcano, furiously glared at by the mud-wasp, and reproached every now and then by the preacher for profanity, he bad a very wretched time of it, and often gave that as a reason for the redness of his nose. "Be-jabbers," he would say, " Oi must droon moi troubles;" but how he drowned his troubles by reddening his nose I never could imagine. Grace had been said, as I stated before, and Jane began to serve roast chicken, starting with the preacher. " Thank you, my girl," said his reverence in his blandest tone as she turned from him to the poet, who took a wing with a smile—a very poetic smile—and, holding it up on a fork that all could see it, in his softest canary notes began : " Oh for the wings of an angel, To fly to that heavenly shore, I would leave this land of sorrow, There in joy to dwell evermore." " Oh, how delectable !" exclaimed the ecstatic teacher. "What spontaneity and brilliancy of genius ! Surely, Mr. Bilious, you have been endowed with those peculiar qualities of intellect which combine with a deep and susceptible emotional nature to consti-tute those favored and favorite mortals, whose function in life and society is to add to the general happiness of humanity ; one of those who drink of Olympian fountains and feast on the ambrosial —the ambrosial—feast on the ambrosial—in short, Mr. Bilious, you are a poet." She always rattled out her comments in a man- 32 THE GETTYSBURG MERCURY. \ ner something like a hysterical alarm-clock, and stopped for the same reason, too—because she was run down. The flattered rhymer, in his confusion and gratitude, blushed a sort of 3^ellow green, and fumbled about in his inspired cranium for a suitable answer, when Pat relieved him. " Ay, Midam, a pooet's boorn a pooet; ye can't make 'im." Though "Madam" rarely condescended to notice any of Pat's remarks, she replied: "Mr. O'Brien, I fully appreciate the force and significance of that sententious and universal truth to which you have just given utterance. I find it true, in my ramblings through the variegated fields of imaginative literature, that a skill-ful master of the poetic art must—must possess certain natural endowments of mind and feeling. He may avail himselfof the most efficient intellectual discipline in the most advanced institutions of learning, established in either hemisphere, the Eastern or the Western, fortne impartation of knowledge and mental develop-ment, and yet, sir, may never gain admission into the temple of the Muses." " Yis, a pooit's loike an iditor. Ye moight fade a goat tin years on newspaipers, but shtill ye couldn't make an iditor av 'im." Very much to Pat's annoyance—for he felt unusually honored in being patronized by such an able representative of scholarship and high English—the poet, who felt that they were both allud-ing to him, chimed in : " If Nature on you doth bestow it, To reveal her charms, to be a poet, In school or out you're bound to show it, And all the world will some time know it." "Och, bedad," supplemented Pat, with a dubious smile of malicious humor, intending to punish Mr. Bilious for this obtru-sive sally, "Ye remoindmeso much of Samson in the Scriptures." The poet shook out his tresses of black, hanging in Miltonic waves over his shoulder, proud to have them compared to Sam-son's immortal looks of strength, but Pat. continued : " Ye both use th' same wippin, only ye make pooetry with it and he slew the inimies of Israel." Of course, we laughed; the preacher till he was as red as Pat's nose, I till my sides ached, and even the school-mistress smiled as loud as the constitutional gravity of her deportment would permit, the poet, all the while, turning alter- THE GETTYSBURG MERCURY. 33 nately red, white and blue, and looking as though he had swal-lowed a smoothing-iron. Mr. Lyn alone did not smile—the pan-try door was open. The cook was seized with a fit of tittering that went nigh end-ing with her dropping the coffeepot, with which she had now reached the school-mistress, filling the cups as she went round the table. " O Miss Jane, do exercise more vigilant care lest you occa-sion some disastrous calamity. Just cogitate how seriously I might have been scalded by that liquid, in that state of violent ebullition, as you undoubtedly apprehend. Such inexcusable carelessness cannot, must not be tolerated, young lady." Jane, somewhat abashed, colored and would have attempted an apology, but the preacher, ever ready to rescue one in embar-rassment, interposed : " Nothing hurt, Jane; accidents will hap-pen everybody. I don't wish them to you," he added, with an air of cheerful gallantry, " but I like to see you blush up ; your cheeks look like peaches." " Yis, yer Riverence," added Pat, "and Oi am so fand of paiches," looking at the preacher and then at the cook. The teacher had, by far, too positive notions of propriety not to rebuke the facetious Patrick. " Undoubtedly, Mr. O'Brien, you have not had the advantages which the cultured usually de-nominate the ' privileges of high society,' those elements of good-breeding enjoyed in homes of education and refinement, or un-doubtedly you would not be guilty of the audacity, so boldly and improperly to allude to the female employee of the establishment in which you occupy the humble position of a menial. Mr. O'Brien, I certainly am surprised." Pat looked at me and winked, evidently not much discon-certed by the bombardment. •'You exhibit," she continued, angry because Pat did not wilt, " directly under and within the range of my ocular vision, such indecency towards me, one so manifestly your superior"— another wink. "Well, did I ever!" she ejaculated, closing her mouth with a snap like a pocketbook, looking daggers all the while at the unabashed Mr. O'Brien. "Did ye iver," rejoined the impregnable Patrick. "It's moire than Oi can till ye what ye iver did; yer auld enough to 34 THE GETTYSBURG MERCURY. have done imiything, judgin', as the poet says, 'by the silver min-gled mang th' gauld.' " '' Sir,'' sharply retorted the now thoroughly enraged pre-ceptress, "I do not propose—" " Nay, Midim," interrupted Pat., " Oi didn't ask ye to pro-pose, and there's no danger of innybody havin' ye innyhow, un-less p'rhaps yed propose in the dairk av th' moon." During this passage between the scholarly tongue of the out-raged pedagogue and the native wit of the mischievous Irishman none of us dared to laugh out, though we suffered severely with suppressed mirth, which, in my case, played a little game of earth-quake in my abdominal regions, made me drink two glasses of water in quick succession and spill half a cup of coffee over the table. Determined to beat a retreat with at least the honors of war, she turned from the Irishman, as if perfectly disgusted with his conduct, and addressed Jane, who was about to give her a^second cup of coffee. " No, thank you. If I should indulge in the sec-ond cup of this beverage, although I consider it exquisitely pal-atable and invigorating, when administered, or rather taken, in moderate quantities, my digestive organ would be greatly exag-gerated— I mean aggravated, and probably develop in the course of time sub-acute gastritis or some other modification of irritant poisoning. Indeed, I have entertained the greatest apprehension of"—just then the door bell rang, and I was called out. —A. N. ONYMOUS. PATRONIZE OUR ADVERTISERS. C. H. SOLT MERCHANT TAILOR Masonic Bldg., GETTYSBURG Our collection of Woolens for the coming Fall and Winter season cannot be surpassed for variety, attractive designs and general completeness. The latest styles of fashionable novelties in the most approved shades. Staples of exceptional merit, value and wearing durability. Also altering, repairing, dyeing and scouring at moderate prices. .FOR UP-TO-DATE. Clothing, Hats, Shoes, And Men's Furnishing' Goods, go to. I. HALLEM'S MAMMOTH CLOTHING HOUSE, Chambersburg St., GETTYSBURG, PA. ESTABLISHED 1867 BY ALLEN WALTON. ALLEN K. WALTON, President and Treasurer. ROBT. J. WALTON, Superintendent. flammelstomn Broom Stone Gompany Quarrymen and Manufacturers of Building Stone, Sawed Flagging and Tile Waltonville, Dauphin Co., Pa. Contractors for all kinds of Cut Stone Work. Parties visiting the Quarries will leave cars at Brownstone Station on the P Telegraph and Express Address. BROWNSTONE, PA. : R. R. R. PATRONIZE OUR ADVERTISERS. The Century ^^.0 Double-Feed Fountain Pen. ^^Poiated- GEO. EVELER, Agent for Gettysburg College PRICE LIST. .$2 SO . 2 50 No. 3. Chased 3 00 Hexag-on, Black or Mottled No. 3. Gold Mounted 4 00 Pearl Holder, Gold Mounted . 2 50 . S 00 THE CENTURY PEN CO. Askyour Stationer or our Agent to shozv them toyou WHITEWATER, WIS A good local agent-wanted in every school. ^mmwmmrmwmmwmwmwm^ Printing and Binding "We Print This Book THE MT. HOLLY STATIONERY AND PRINTING CO. does all classes of Printing' and Binding, and can furnish you any Book, Bill Head, Letter Head, Envelope, Card, Blank, or anything pertain-ing- to their business in just as good style and at less cost than you can obtain same elsewhere. They are located among the mountains but their work is metropolitan. You can be convinced of this if you give them the opportunity. Mt. Holly Stationery and Printing Co. K SPRINGS, PA. VL H. S. BENNER, .DEALER IN. Groceries, Notions, Queensware, Glassware, Etc., Tobacco and Cigars. Yl CHAMBERSBURG ST. WE RECOMMEND THESE BUSINESS MEN. Pitzer House, (Temperance) JNO. E. PITZER, Prop. Rates $1.00 to $1.25 per day. Battlefield a specialty. Dinner and ride to all points of interest,including the th ree days" fiffht, $1.25. No. 127 Main Street. MUMPER & BENDER Furniture Cabinet Making, Picture Frames Beds, Springs, Mattresses, Etc. Baltimore St., GETTYSBURG, PA. You will find a full line of Pure Drugs and Fine Sta- People's Drug Store Prescriptions a Specialty. .GO TO. fjotel (Gettysburg Barber Sfyop. Centre Square. B. M. SEFTON J. A. TAWNEY o. Is ready to furnish Clubs and Bread, Rolls, Etc. At short notice and reasonable rates. Washington & Midde Sts., Gettysburg. XWTT. TrJ. //dfe//>/l/d. C/)/Cd50. Sd/iftvnasco. London. PdnsJerf//?. Co/03ne. CALL ON F. Mark Bream, The Carlisle Street Grocer Who always has on hand a full line of Fine Groceries. .Photographer. No. 3 Main St., GETTYSBURG, PENNA. Our new effects in Portraiture are equal to photos made anywhere, and at any price PATRONIZE OUR ADVERTISERS. ^entpol Jfotel, ELIAS FISSEL, Prop. (Formerly of Globe Hotel) Baltimore Street, Gettysburg, Pa. Two doors from Court House. MODERN IMPROVEMENTS. Steam Heat, Electric Light and Call Bells all through the House. Closets and Bath Rooms on Every Floor. Sefton & Flem-ming's Livery is connected with this Hotel. Good Teams and Competent Guides for the Battlefield. Charges Moderate, Satisfaction Guaranteed. Rales $1.50 Per Day. R. A. WONDERS, Corner Cigar Parlors. A full line of Cigars, Tobacco, Pipes, Etc. Scott's Corner, Opp. Eagle Hotel. GETTYSBURG, PA. L Try My Choice Line of .' £ High-Grade Chocolates 3 L, at 40c per lb. Always fresh at ,\ C CHAS. H. McCLEARY "j C Carlisle St., Opposite W. M. R. R. ^ Also Foreign and Domestic Fruits '(' Always on Hand. JOHN M. MINNIQH, Confectionery, lee, -andIee Creams. Oysters Stewed and Fried. No. 17 BALTIMORE ST. BARBER SHOP®® CHARLES C. SEFTON, Proprietor. .Baltimore Street. The place for Students to go. Only First-class Tonsorial Work. LIVERY ATTACHED. ESTABLISHED 1876 PENROSE MYERS, Watchmaker and Jeweler Gettysburg Souvenir Spoons, Col-lege Souvenir Spoons. NO. 10 BALTIMOE ST., GETTYSBURG, PENNA. HARRY B.AR010R, Chambersburg: Street, Gettysburg:, Pa. Electrical .and Bicycle Supplies Repair Work of Every Description.

JUIiV, 1894. PUBLISHED BY THE STUDENTS OF PENNSYLVANIA (GETTYSBURG) COEEEGE. "STAH ANH SKHTINKI." Office, Gottynl)urj.-, Pa. ADVERTISEMENTS. Fraternity Jewelry ICHQICLFAMILYGROCERIES J J | Sugars, Coffes, Teas, Dried Fruit, Syrups, OF EVERY DESCRIPTION. X X -•* -K- *s- A FEW SUGGESTIONS: fBADGES, o i | SCARF PINS. HlfiY^ SLEEVE BUTTONS, a a/ I LAPEL BUTTONS. l_RINGS. fCHARMS, | FOB CHAINS, i COURT PLASTER CASES MOUSTACHE COMBS ^LOCKETS. fSOUVENIR SPOONS, I " MATCH BOXES. STAMP BOXES, SCENT BOXES, BOOK MARKS. I " GARTERS. Factory 611 & 6I3 S. ;'—3) Simons Bra. &. Co, Street / Salesrooms, 616 & 618 Chestnut St , Phila. I9 Maiden Lane, New York. 96 State St., Chicago. -r"\ §>~a No. 3 MAIN STREET, GETTYSBURG, PA. Out new Enameled Aristo Pot traits are equal to Photos made anywhere, and at any price. Dried'Fruit, Flour, Butter, Eggs, Potatoes, Apples; all of the best quality. Persons in need of anything in the above line, can be accommodated at my store at the very lowest cash price. Give me a call and be convinced of the fact. D/\VlD TROXEL, York St., Gettysburg. SPECIAL TO STUDEBTS, Hfifig vbml®rm®. Merokaaat Tailor, (Below Eagle Hctel) GETTYSBURG. pA (Rear of Washington House, Opposite W. M. TUB BATTLEFIELD' (Publishers, (Booksellers and -^A SPEGIALTY,*- Stahoners, — - 335 MARKET ST., HARRISBURG,PA. I DAVID McCLEARY. Prop. ADVERTISEMENTS. Colombia' f the World, graceful, light, and strong, this product of the oldest bicycle establishment in America still retains its place at the head. Always ■well up to the times or a little in advance, its well-deserved and ever increasing popularity is a source of , pride and gratification to its makers. To ride a bicycle and not to ride a Columbia is to fall short cf the fullest enjoyment of a noble sport. A beautiful illustrated catalogue free at any Columbia agency, or mailed for two two-cent stamps. 4 BALTIMORE ro STREET. Samuel Faber, Fine Cigars and Smokers' A rticles, CHAMBERSBTJRG ST., GETTYSBURG. L M. BUEHLER, SUCCESSOR TO A. D BUEHLER & CO., Headquarters for STATIONERT AND BLANK BOOKS, THE CHARLES H. ELLIOTT CO., 910, 912 Filbert St., 108 South 13th St J1 Commencement, Visiting Cards, Class Day, Address Dies, Society and Monogram, Wedding Invitations, Coats of Anns, College Catalogues, Class Awards, Diplomas, Exterior and Interior Views, and Groups in half-tone, wood, Photo Type or Steel. aptstoutn JH& *mt *W *NT jiW N. W. Corner Public Square, m -autubg iM HAGERSTOWN, Maryland. LOWEST CASH PRICES. WE will endeavor to give satisfaction In the future as we have done In the past. Special rates to students. Give us a trial. J. E. SCHINDEL, Proprietor. W. G. Brnbakor, College Agent. Ssars. HOLLY Stationery!Priatintt MANUFACTURERS AND DEALERS IK SCHOOL SUPPLIES A SPECIALTY-The Company has excellent facilities for issuing Periodicals, Catalogues, Invitations, Announcements, Letter Heads, Thesis and Examination Tapir and all College work. Old Books and Magazines re-bound. A full line of School Sup-plies kept in stock. Agents wanted. All work guaranteed. ADVERTISEMENTS. iutltewilk jfrtmimw. •*? Here are some patrons of the school: Rev. Dr. Valentine, Rev. Dr. McKnight, Rev. Dr. Scholl, Rev. Dr. I^illy, Rev. Dr. Henninghansen, Rev. Dr. Holloway, Rev. Dr. Bntler, Rev. Dr. Earnest, Rev. Dr. Repass, Rev. Dr. Peschan, Rev. Dr. Seip, Rev. Spieker, Rev. Dr. Enders, Rev. Dr. L. G. Miller, Rev. Dr. Bernheim, Rev. Dr. Fox, Rev. Dr. Sadtler, Rev. Dr. Morris. Send for Catalogue. AscMrress,, ffiew. 5, ^~ BOOTS« SHOES. G55=Satisfaction Guaranteed.i^) No. 6 S. Baltimore Street, GETTYSBURG. PA. ADVERTISEMENTS. 0:'EC BW Iiuporters and Jobbers of «1DRUGS,I» Nos. 16 and 18 W. German Street, BALTIMORE, Offer to the trade their large and well-selected stock of Make a specialty to have on hand everything required by Pharmacists. A complete stock can at any time be selected or wants supplied. ALONZO L, THOMSEN,^ EAOE, WINDEK, SHAItP AND LEADENHALL STS., P. O. Box 557, Baltimore, Md. I beg to call to the attention of the Trade that I have re-cently added to my Plant a complete set of Drug Milling Ma-chinery of the most Improved pattern. GEORGE SMGLES, Successor to J. W. Eicholtz & Co., DEALER IN No. 127 Chambersburg St., GETTYSBURG, PA. JOHN E. PITZER, MEMBER POST 9, G. A. R. [C^SHI9, —DEALER IN— Hats, Shirts, Shoes, Ties, Umbrellas, Gloves, Satchels, Hose, (pocket ^ooks, Trunks, Telescopes, Rubbers, Etc., Etc. AMOS ECKERT. W HOTEL, Gettysfofcifa, Pa. J0HI2 E, HIMHE2, PRorft THIS Hotel is situated on Main street, one square from I', and II. and W. M. R. K. Depots and within one-half minute's walk of the Diamond. Every room is heated, and lighted by electricity. Parlors on first and second floors. Bath and Toilet rooms on second floor, gratis to guests. Hates $1 50 to $2.50 per day. Booms without Hoard 50 cents and upward according to location. Excellent accommo-dations for 250 people. Electric cars stop at the door eveiy half hour. Livery Connected, with first-class Teams, and Battle-field Guides at Low Rates. Dinner with Drive over the — attle-field $1.: 5. Commencement Number. The College Mefcufy. VOL. II. GETTYSBURG, PA., JULY, 1894. No. 5. THE COLLEGE MEftCUfiY, Published each month during the college year by the Students of Pennsylvania (Gettysburg) College. STAFF. Editor : WALDO D. MAYNARD, '95. Associate Editors : SYLVESTER C. BERGER. '95. WILLIAM A. KUMP. '95. J. EDWARD BYERS, '95. GRAYSON Z. STUP, '96 WILMER A. HARTMAN/95. HORACE M. WITMAN.'gs. ROSCOE C. WRIGHT, '95 Alumni Association Editor: REV. n. FRANK GARLAND, A. M , Baltimore, Md. Business Manager: MORITZ G. L. RIETZ, '95. Assistant Business Manager: HENRY E. CLARE, '95. m*.,,™, fOne volume (ten months). . . . $l.ro IEKMS-\Slngle copies : . . . .15 Payable in advance. All Students are requested to hand us matter for publication. The Alumni and ex-members of the College will favor us by sending information concerning their whereabouts or any items they may think would be interesting for publication. All subscriptions and business matters should be addressed to the business manager. Matter intended for publication should be addressed to the Editor Address, THE COLLEGE MERCUKY, Gettysburg, Pa. CONTENTS. ABSTRACT OF BACCALAUREATE SERMON, - - - - 85 ABSTRACT OF Y. M. C. A. ADDRESS, 87 CLASS DAY PROGRAMME, - - - - - - - - 89 CLASS PROPHECY, 89 SCIENTIFIC Srmrr, - - - - 92 IN THE CONFLICT, - - 94 IVY POEM, 9s LOCAL GOVERNMENT, - -96 JUNIOR ORATORICAL CONTEST. - 98 OUR MENTAL LIVES, - - - - 9S ROLL OF HONOR, 100 COLLEGE COMMENCEMENT PROGRAMME, - - - - 100 CANDIDATES FOR DEGREES, --- 100 COMMENCEMENT NOTES AND COLLEGE LOCALS, - - - 101 ALUMNI, 103 TENNIS, 104 SEMINARY NOTES, - - - 105 ABSTRACT OE PEES. MoKNIGHT'S BACCALAUREATE SERMON, Matt., 17:14 : "Then answered Peter, and said unto Jesus, Lord, it is good for us to be here: if thou wilt, let us make here three tabernacles; one for thee, and one for Moses, and one for Ellas." Peter was one of the three disciples who were permitted to be with Christ on the Mount of his transfiguration. The glories of that scene which was like a sublime coronation hour dazzled and entranced him. He was awe-struck—dazed by the strange magnifi-cence. It was to him a moment of supreme privilege, and the very place where he en-joyed it was converted into sacred ground. IvOngiug to remain and to continue the vision, and experience he uttered the request: "Mas-ter, let us build and stay here, let us make a resting-place of this mount of vision, and not go down again to the valleys of common ex-perience where toil and tears and weariness and suffering await both thee and us.'' It was a natural request which he had thus expressed, but, for his own good and that of the great and needy world to serve and help which he was being prepared by that very vis-ion, it conld not be granted. Instead, Jesus led him and his fellow-disciples down the slopes of the mountain at whose base a stricken boy and his heart-broken parent awaited them, and where a miracle of mercy and deliverance was to be wrought. By his act, therefore, He taught Peter and teaches us that, while privi-lege is good, duty is better; that the valleys of waiting and watching, of toil and sacrifice are to be preferred to the summits of ease and re-ceptivity and enjoyment; that privilege, the highest and most transporting, serves its true purpose only when it acts and re-acts upon daily duty and ordinary life, transfiguring all that we are and do. No doubt, my young friends, you are able 86 THE COLLEGE MERCURY. to sympathize with Peter this morning, and are ready to breathe his prayer: "Let us j stay.'' You have been on a mount of special i privilege, enjoying what is permitted to but few. The years of liberalizing study you have spent here have afforded you opportunities of growth and enrichment beyond the possibility of exact calculation. And now that they have ended, and you are to go out from us and be, in the old sense, of us no more, there must be ' a quickening of 3'our appreciation of what you have enjoyed. As others crowd you out of the places you have held, and forward to the scenes of stern and responsible action, you may feel like drawing back and pleading: "Let us stay." But believe me when, speak-ing to you in the name of those who have been . your instructors and friends, I say to you, in these parting words, it is better for you to go. God himself commands you away to duty, and ' in the service to which he appoints you. Your { gains will be greater and richer than they can be on any heights of mere receptivity and ease. Remember the words of the Lord Jesus, how he said: "It is more blessed to give than to receive." This truth so hard to ap-prehend and appreciate in advance, we wish to emphasize and illustrate for your encourage-ment and guidance as you now face outward towards your respective spheres of experience and activity. The superiority of service over privilege or of productive energy over mere receptivity was then shown in the discussion of the following points : i. In its relation to the right and full development of God-given powers, and fa-cilities. 2. In its relation to character. 3. As the condition of all true greatness. 4. As the source of true blessedness. After discuss-ing these points, the Doctor addressed the class as follows: "My young friends of the class of '94: We have sought thus, in a practical way, to impress you with the dignity and im-portance of earnest and unselfish work. It is more needful than any circumstances or special privileges for the best and fullest development of your powers and faculties. It bears a vital relation to your character, calling.for the^exer-cise of those gifts and graces which are es-sential to a worthy manhood and womanhood. It must form the basis of all true greatness you can ever achieve, and condition the enthrone-ment you would gain in the esteem and confi-dence and love of your fellow men. It is the real source of the blessedness which sweetens life and gives foretastes of "the joy that is un-speakable and full of glory." We have sought to impress you with the truth that in entering on an earthly, you are in reality entering on an eternal career, and to set before you aims which belong equally to the life that now is and to that which is to come. Let not the gains or pleasures of time obscure and hide your better portion. Let not the engagements of earth so absorb your attention that you shall forget the claims of heaven, or your cares so overshadow you that the light of a better world cannot reach you. Let yours be the holy am-bition which filled the heart of David and con-trolled his aims and actions—"to serve your generation according to the will of God." Let the thought, not of ease or pleasure, or posi-tion, or gain, but of usefulness determine your occupation or profession in life, and control you in it. Not what you do, but the spirit in which you do it shall fix the actual and abid-ing results of your living and working. This spirit—the spirit of all right action—has been forcefully indicated in the device and motto on the seal of a well-known Missionary So-ciety. The device is an ox standing between a plough and an altar, and the motto is: "Ready for either." Readiness for service or sacrifice, or for both! What noble spirit can control a human life, or give impulse to human activity! God himself has approved this ideal, and marshalled all the forces and agencies of the universe to it. It makes the music of the spheres, and gives harmony and majesty to the ceaseless song before His throne. Serve or suffer in the spirit of that holy enthusiasm which made Christ's mission to Him "more than his meat and his drink," and, whatever may be your allotted sphere, humble or high, THE COLLEGE MERCURY. 87 it will be found at last that you have neither lived nor labored in vain. Your glory and joy will be, not that you have possessed talents and had high and peculiar privileges, but that you have used them aright. Let this spirit of service be carried into the commonest of duties and minutest details of the spheres you ma)- fill, for, if you reach for the stars, and forget the flowers that bloom at your feet, you will miss much, perhaps all. He, who waits for great occasions tq display his talents and prove his serviceableness, neg-lects the real conditions of success, and his plans are likely to come to naught. Little tilings, common duties, ordinary occasions con-stitute the larger portion of every life, and he who despises these, misses the choicest oppor-tunities for filling his mission and serving the world. The world's greatest servants and most honored chieftains have been wiser and nobler. In business, in literature, in art or in war, they have been distinguished for their conscientious attention to details. Carry a similar spirit of fidelity into all that you do. Serve in everything, if you would reach the only distinction that men will lastingly recog-nize and God eternally approve. "He that is faithful in that which is least, is faithful also in much, and he that is unjust in the least is un-just also in much." Fidelity to all your tal-ents and opportunities, whether they be few or many, great or small, only can and surely will gain for you the plaudits of the skies—the ulti-mate welcome: "Well done, good and faith-ful servant, enter into the joy of thy Lord Thou has been faithful over a few things. I will make thee, ruler over many." ABSTRACT OF Y. M. C, A. ADDRESS BY REV. FISCHER, OK EASTON. I .Tollll -2 : l(i Solomon says "the glory of young men is their strength" and we are born with an in-stinctive admiration for ph\'sical power. It was the primary glory of the race. The first picture the live boy hangs upon the walls of his room are not those of apostles and martyrs but of athletes and heroes, so in the world's pic-ture gallery, we find Hercules, Theseus, Sam-son and David. Although the days of giants and Olympian games are past, time will never destroy man's admiration for strong muscle and mighty sinews. The popular idol to-day is the pitcher of the champion nine, the rusher of the winning foot ball team, the bowler of the eleven that holds the cup, or the stroke oar of the successful crew. But Christianity has lifted and proposes still more to lift these things to a higher plane. She recognizes that physical culture is conducive to mental health. Hence she has equipped her gymnasium with every apparatus to accomplish this purpose as a means to an end. She desires to subordinate the material to the mental. Brain not brawn tells in this age. The prize-fighter is an out-law and plies his business in barns and unfre-quented places. "There is nothing great in the world but man. There is nothing great in man but mind." Three elements are in the strength referred to in this message: 1. That zvhich character-izes the period of life here addressed '' Young men," those who occupy the golden mean be-tween childlike weakness and the period of wakening manhood. "Fathets": There is a strength peculiar to young men to which is at-tached a corresponding responsibility. This is the period of life never affected by drought. The channels of vigor run bank-full with the greatest force of life. The growth of a year is soon accomplished. Little growth is made in the branch after the spring days are gone. But this stream must be regulated or it will ruin. Man is God's workmanship, hence his life dare not tear its own channels or spread in miasmatic waste over this period of his being, but flow in channels of divine ordering. This is the strong period of life because it has not yet felt the chill of disappointment. They have not yet been the victims of betrayed con-fidence. The child-like spirit of trust marks every approach. Their future has no failures in it. When Napoleon asked for 100 young men out of a regiment who were ready to die, THE COLLEGE MERCURY. all stepped forth. They never doubted their ability to take the battery or their readiness to die. This spirit is not to be despised, for con-fidence is the very essence of achievement. 2- Second element of strength is Education. The Greeks soon discovered that physical de-velopment was not the true line for a man to follow. In this the brute was his superior. Soon the glory of the athlete was conferred on the poet and philosopher and the school was sought as eagerly as the arena. The college is more than a ' 'crew," a ' 'nine'' or a "foot-ball team." Mind rules the world and education is the great social equalizer. As you cultivate your minds you add to your strength and give breadth to your sphere of usefulness. 3. Tim de lement is strength of soul. '' Finally my brethren be strong in the Lord and in the power of his might." This lifts man above self and unites him to an unfailing source of power. Religion gives sight, direction, trend to what you have by natural endowment. Seneca says: "No mind is good without God." The world recognizes the superiority of this. To keep your body under places you in the final and real conquest way above the athlete and the mental genius. "Ye have overcome" does not mean that you can neglect watchfulness and lay aside your armor as if all life's work were done. No! But as the acorn contains the oak, so your faith has in it all its fruit, "For this is the victory that overcometh even your faith." That faith made Luther a conqueror. All the liberties of our day, civil and religious, were wrapped up in germ in the faith of that one man. Without this new life in Christ you will only be a sort of refined, highly developed animal. The' electric car will not budge an inch unless connected with the power-house. Man is a creature of two worlds. Your spirit can never grow by sticking its roots in the soil that nourishes your flesh. Without a sun this world would be an iceberg revolving in space. Your spirit must be warmed by the Son of Righteousness. A living, growing faith is neces-sary, for life without faith is an earth without a sky. Your institution has not neglected this part of your training. Education and Chris-tianity are sisters. It is more important for the student to practice virtue than to decline virtuse; to form his character along the lines of righteousness than to demonstrate all the prop-ositions of plane geometry. What now is the duty that arises from this trinity of endowments f Blessed with trained bodies and minds and added grace, what will you do with them? "Stand fast in the faith." "Quit you like men." "Hold fast what thou hast, lest any man take thy crown." You must call up all the power you can command in order to hold the advanced posi-tion which by nature and grace you occupy. You dare not waste an ounce of your strength. Only the fittest survive. You must have the whole armor or you will go clown. Do not tamper with evil because you want to know something about it. "Only once" has ruined many a soul. Let God direct your steps into the right track and keep them there. Keep yourselves pure. You may repeitt, but a whole garment is better than a patched one. "The greatest spiritual strength is born out of that moral strength which has never been broken by vice." Ireland's great leader, Par-nell, from lack ot moral strength, was ruined in the very hour of victory. Meeting his De-lilah he was shorn of his locks, and his strength departed from him. Great self-denial is required. To be any-thing you must deny some part of yourself. To be a ttiie man you have only to deny that part of yourself which is unworthy of you. You must live for others. This is best done by a consistent life. We need not less preach-ing but more practice. The professor makes the college more than does the curriculum or the library. The teacher is often of more value than his teaching; no name is more fra-grant in the long list of teachers of this cen-tury than Arnold of Rugby. His tenderness of conscience, his sympathy with the heart of youth, his self-forgetfulness, his hatred of the mean, his love for youth and God made him the great teacher of- our time. Not Hopkins THE COLLEGE MERCURY. 89 I the teacher or philosopher, but Hopkins the man formed the character of the graduates at Williainstown. Nor can we refrain from re-ferring, in part, to a late vice-Pres. and Pro-fessor in our own Alma Mater; whose sweet, courteous Christian life did more to mould character, and kindle aspiration for a nobler and truer manhood than all the sines and tan-gents of his department could do to strengthen the mind. And "being dead he yet speak-eth." Such is the power of a true life every-where. Do not lament that the professions are over-crowded. The world is not'overcrowded with such men. There is room in the business world for men who despise a false balance and love a "just weight." There is room in the political world, swarming with a hungry crowd, for young men whose back bones will not bend though a whole party try to do it; whose knees will not bow to the "boss's" will, though ejectment from office and political ob-scurity be threatened. There is room for more than "four hundred" in society, where the Christian Sabbath is degraded into that of the continent, and where men through intem-perance are dammed body and soul by "dtce process of law.'' There is not only room but need for you in the sphere of the pulpit where a rationalizing tendency is seeking to rob relig-ion of its faith, into which secularism with its blighting influence is slowly creeping, and which is being changed into the platform, the sermon into the lecture and the preacher into the lecturer. We need ' 'not echoes but voices.'' This is God's message to you. Will you heed it and find your true strength in Him or waste even the strength you have ? Your suc-cess, position and usefulness depend upon the characters you are forming now. Be true men. Do not disappoint the God who made you and the Redeemer who bled to save you. Live for God and humanity. Such a life will be beset by dangers, but also arched with flowers and palms of victory. By living it boldly and in faith many a sweet blossom and green palm will be shaken down to gladden you by the way, and the joy and safety of your strength will be to you a taste of that great reward that awaits the victor when the final goal of this earthly life is reached. _ ♦ ♦ ♦ CLASS-DAY PROG-RAMME. TUESDAY EVENING, JUNTE 19. 1804. 0 P. M. Maser of Ceremonies. - - W. O. NICIILAS. IVY EXERCISES. Iny Poem, Ivy Oration, Miss HAKTMAN. R. W. MOTTERN. CLASS EXERCISES. Class Boll, - - - - C. F. KLOSS. Class Hi.stoty, - JOHN HOFFKR, JR. Class Poem, - Presentation Oration, Pifiphecy, Miss HIMES. F. BARNDT. J. S. ENGLISH. CLASS SONG. CLASS PROPHECY. To write a prophecy a man ought to be a prophet. To be a successful prophet he should be inspired; but we lay claim to inspiration neither infernal nor divine, and we are just going to run off your futures in grind organ style. Now, we might begiu this prophecy by making some allusions to the old Greek and Roman Gods, but this thing of referring to the mythological dieties has become so old and chestnutty, so antiquated and mossbacky, so kindergarden like and so universally prev-alent among the would-be crack orators of to-day that we raise our hands in holy horror and say, begone, vile thought begone! You know I might say that I laid my Adonis like carcass down on the banks of a beautiful sylvan stream and as the crystal waters danced musically over the beautiful pebbles Minerva scratched my scalp with the point of her helmet and lo and behold prophecy seethed from between my teeth in a perfect stream. But we are not going to indulge in any such nonsense. To some extent we are going to draw upon our imagination, and if we don't predict future greatness from present indica- ^^^^^^■^^^^^^^■■■H ^^^^■■■■^■l^H^^^^H^H ■■UHB^^B 9o THE COLLEGE MERCURY. tions yon can draw all the hair from our heads with a pair of tweezers and make switches for your wives. (Bush please take notice.) Now there are the ladies. What future too grand or brilliant can be predicted for those who have extended such a beneficial influence upon the masculine element of " '94?" Even now Miss Hartman is looking wistfully toward the Seminary, and in the near future, present indications will be realized. The marriage bells will proclaim the bliss of two more mor-tals, and after that will follow a life of great usefulness in teaching poor fallen humanity what is best for their own eternal interests. Miss Himes will be the possessor of a beautiful home in sunny Florida and will set the world on fire with the products of her literary genius, and Julius won't be in it at all. In the near future Allison will no longer kick the stones from off the country roads in Adams county with his copper-toed boots. He will become the 20th century Ward McAllis-ter, of New York City. He will be distin-guished far and wide for his social ability and will be nightly sought after during the but-terfly season to lead the Germans. The future Oscar Wildes will be laid under the willow trees mud-pies at Call Piatt. The reformer will then begin to admire himself in his usual style, and say: '' What a dandy good looking fellow I am! Don't I have a dandy personal appear-ance?" The native Chief observing this will say: "Him makey heap ob good soup." Put him in de kettle, and lo and behold the calcium light of Bastian's intelligence will be extermi-nated forever. Bloomhardt will write a book entitled ' 'The World and Freddy Bloomhardt.'' It will con-tain three chapters of a thousand words each. Chap. I. Why Bloomhardt was born and why the world was made for him. Chap. II. Why all creatures should bow the knee to Bloom-hardt. Chap. III. What's the matter with Fred Bloomhardt becoming the ruler of the Universe. The work he will affectionately dedicate to himself, the only man fit to live. He will finally metamorphose into a bird of Paradise, and will be placed on public exhibi-tion at the Phila. Zoo. Bush will become a Professor in the Chicago University, and will make his fortune by writing a text book on International Law. He will squander this same fortune in seeking a divorce in the Chicago courts, and will finally settle down to collecting rags and when this Adams county farmer with his i bones in the streets of Gettysburg. silken mustache shall spring into prominence. Now there is that man Barndt. Ah, ye iron Fates and Chinese Gods, please deliver us! Once crazy, always crazy. He will study medicine but will be expelled from the pro-fession because of his attempt to saw the toes off the feet of a club-footed man. He will then join a wild-west show in the capacity of a clown, and when the circus monkeys die he will take their places and ride the ponies. Here is a sample of his circus jokes. A trained dog will come in the ring with a piece of stove wood on its back and Sumneytown will say: "You would better take that off." He will die in the Montgomery county insane asylum. Bastian will go to Africa as a missionary and immediately on landing, the natives will throw Duttera will become business manager of the St. Louis Fake Opera Company. In at-tempting to introduce his company to a Phila. audience he will make so many breaks that the gallery gods will shoot a volley of anti-quated eggs at him, and he will retire in dis-gust to a Home of the Friendless for the rest of his natural life. Fickinger and Fair will enter the ring as champion prize fighters and hair pullers. Jimmy Gladhill will sprout a great pair of wings and will be so anxious to get to the Golden City, that he won't take time to die, but will fly there. Hoffer will be employed by all the leading colleges and universities of both this and the old world, to teach the young students how to recite. The first lesson will consist of a drill, THE COLLEGE MERCURY. 9i in teaching the young student how to sprawl his hands all over the face of the young man directly in front of him, when he is called upon to tell what he knows. Lesson No. 2 will be to teach the student to say everything the Prof, says, in a regular parrot style, and then when he does make an attempt to say something of his own accord, to so jumble his words together, that no earthly man can un-derstand what he says. Ibach will study for the ministry, but will give that up, and make his fortune pla3'ing a hand organ. Kemp will spend his whole life-time in writ-ing a book, entitled "A Proof that the Human Species is capable of Hibernating." The facts will be deduced from his own experiences while a college student. Kloss will be the fond possessor of a sheep ranch in New Mexico, and will make $20,000 the first year. He will never have enough music in him to be able to call the sheep, so he will get an old Mexican Shepherd to sing in his graphophone, and after that you will be able to see ' 'Shorty'' strolling over the pasture with his talking machine on his back. Kohler will go West as a Home Missionary, but he will fall away from the straight and narrow path;will take to stealing Indian ponies "and will finally be hung as a horse thief. Count Lantz will become a noted lecturer on Geology. He will pick up wrinkled potatoes and use them as good examples of sea urchins. However his crack lecture will be on the Archegosaurus. The following is an extract: "Gentlemen this is a wonderful thing. Some say it is a magnificent tree, 50 feet high, in the branches of which the Bald Eagles build their nests. Others say it is a big animal with a heteorical tail with a curve on the end, and that it had big feet; which is proved by the foot-piints which it has left in the sands of time. It has its habitat in a con-duit and feeds on that custard material known as ice cream. Lutz will study for the ministsy under the direction of your worthy President, and will some day become an awful factor for good in the world. Miller will work 011 a farm for 50 cents a day, and it will keep him scratching to get that. . Mottern, the fiend of originality, will in-vent a perpetual motion machine, and in mak-ing experiments with it will be carried to the moon. There he will be encased in a great thickness of ice, and in the 30th century will be dug out and exhibited as a crank. The day after his departure from earth the Presi-dent will issue a proclamation, stating that a day of rejoicing will be observed on account of the nation's deliverance. "I don't think this here man," Billy Nick-las will make much of a lawyer, but Dr. Martin has promised to will him the German Chair when he dies, and Billy will make a howling success as a teacher of Dutch. Big Nick will make a reputation as an orni-thologist, and his hobbies will be the dear lit-tle wren and the cute little sparrow. Although Stahl is old and gray there is still time for him to become a Mormon preacher. The subject of his discourses will be the Ark. 1 'And the sides thereof were tight as unto a dish, and the top thereof was tight as unto a dise, and the ends thereof were peaked." Dearly beloved Julius, the idol of his class-mates and the pet of the College at large, will metamorphose into a foxy detective and champion leg-puller of the world. He will be-come the satellite of dark schemes, and will breathe his last in Sing Sing. Sorrick will publish a book entitled "The Bitter Experiences of a Man pursuing a college course and at the same time burdened down with household cares.'' Clyde Bill Stover will become a Chauncey Depew, after dinner speaker and a golden ton-gued orator. Further he will become a female heart-breaker and woman fascinator and will finally turn his brain in trying to make an im-provement on Edison's graphophone. Dave Van Camp will become a foreign traveller; but the curse of his cast iron walk Q2 THE COLLEGE MERCURY. will finally be the death of him. While walk-ing through the streets of St. Petersburg he will be mistaken for the Czar of Russia and will be blown to atoms by a dynamite bomb. And now our melancholy task is ended. May the fates be with you—you monsters of "94" and may the divinities smooth the rough road of your future experiences. SCIENTIFIC SPIRIT. When we speak of the sciences we generally mean the natural sciences such as geology, chemistry, natural history, and the like; but when we speak of a scientific spirit we mean more. The idea it awakens is a comprehen-sive one. It includes the idea of method and purpose and is the animating spirit not only of the natural sciences but also of philosophy, history, the languages, and indeed of all the prominent branches of learning of to-day. In all of them we find the student observing, com-paring, classifying. The spirit of this age is truly scientific. The so-called rivalry existing between the classics and the sciences is not a justifiable rivalry. It is only the result of bigotry and short-sightedness and we are glad to see that it is gradually disappearing. Both are neces-sary but it was through the proper study of the natural sciences that we have been led to apply practical methods and practical purposes to all branches of learning. The scientific leaven has permeated and modified our entire system of education. That it should have done so is but natural on account of the sub-ject matter with which science deals. "And God saw all that He had made, and behold it was very good." This is what science offers to man for contemplation, and is it not infi-nitely better than what man can offer? By studying the imperfect works of man we may be led into error, but the close observation and proper interpretation of nature, God's work, cannot help but lead us to the truth. The methods and purposes of science are such as will naturally lead us to good methods in all our work and inspire us with the true spirit of progress. Science takes us directly to nature where we find progress stamped on every side. The purpose of science is ever the same. The watch-word is truth, truth, truth. This may be seen in the character and meth-ods of the men who pursue scientific investiga-tion. They are beyond a doubt among the most honest and truthful of men. One of our leading educated men said a few years ago that he never heard of but two cases where a scientific man willingly said in scientific re-search what he knew to be untrue; and this was in regard to the classification of two shells. Can this be said of other professions? The scientific man is required to put aside all pre-conceived notion and theories and prepare his mind for the reception of the truth. He has no more victory to gain; for so long as victory and not truth is the primary object the contest is sure to be bitter and unjust. In his experi-ments he works carefully, he observes closely, he interprets according to the best light and knowledge that he has and announces the re-sult to the world whether it agrees with a the-ory that he may have advanced or not. If the facts do not sustain his theory he rejects it and turns to what the facts seem to justify. Thus he approaches nearer and nearer to the truth. This may be seen in the long series of experi: ments made to establish or overthrow the the-ory of spontaneous generation. And in giving the arguments in favor of a theory the scien-tist also gives its objections, and indeed some of the strongest objections came from the very men themselves who advanced the theory. And again, the methods of science are such as lead most surely and directly to the object sought; to express the unknown in terms of the known; to lead to a truth not before realized. "Science above all things demands personal concentration. Its home is the study of the mathematician, the quiet laboratory of the ex-perimenter, and the cabinet of the meditative observer of nature." Science realizes the truth that to accept a fact on mere authority means intellectual death. Man has been THE COLLEGE MERCURY. 93 termed, "Das rastlose ursachenthier," the rest- \ less cause-seeking animal. The intuition of causality is in man and will assert itself. Rec-ognizing this fact, science is ever striving to bring to man's notice secondary causes which, when viewed aright, point us on and on to a great First Cause which true science not only requires but demands. Scientists have also had to learn many things by experience, and one of these is not to form a conclusion until the facts justify it. They have made many errors in this way and have been taught that there are times when the judgment must be held in suspense, the data upon which the decision should be based may be just what is wanting. The high aim of scientific work, its practical methods, and the high order of subject matter with which science deals have furnished a suit-able basis for the growth and development of scientific spirit. It began to manifest itself very early but its progress for a long time was slow. It was thought to lead to error and for this reason stifled and suppressed from the be-ginning. Probably the greatest and most act-ive agent in suppressing scientific research was the church. The conclusions reached by science seemed to contradict the teachings of the Bible. The theory of the antipodes was not found in the Bible. Evolution contra-dicted the doctrine that the world was created in six days, Joshua commanded the sun to stand still. The ideas of scientists with respect to these were looked upon by the church as false. But it may be said of them in the words of Gamaliel: "If they be of God, ye cannot overthrow them; if they be of man, they will come to naught.'' The victory thus far seems to have been on the side of science. The re-sult of this attempt to suppress the searching after truth has been just the opposite from what was expected. Instead of restraining it by the rigid envelope thrown about it they in reality gave it explosive force, and when it did burst forth it was with a power that was con- ! vincing. And to-day we find these very theo- \ ries advocated by many Christian teachers, j Indeed they are no longer looked upon as the-ories but as facts. It is also often urged that scientific research leads to atheism. While it is a fact that many of our leading scientists were not professed Christians, yet is science entirely to blame for this ? May not much of the blame lie with the church rather than with science ? The church was at variance with what science knew to be true. Her conduct toward these was such as would drive them to renounce the church and make them hate religion. Bruno, for believing in the doctrine of Ca-pernicus, was burned at the stake. Galileo, thirty-three years later, to save himself from the same fate, was obliged to abjure, on bended knees and with his hands upon the Holy Gos-pels, the heliocentric doctrine which he knew to be true. No wonder that these men were led to hate the church and through the errors of the church to spurn Christianity. It put science and religion at war with each other. But to-day we are glad to see that this difference is gradually disappearing and the church is willing to accept many of the teach-ings of science as in harmony with the Bible. And in turn we find that many of our leading scientists are now professed Christians. Kep-ler gave voice to the true scientific spirit when he said: "Oh, God, I think thy thoughts after Thee!" Science is ever striving to know God's thoughts as expressed in nature. Although the growth of scientific spirit was slow until quite recently, yet its practical ben-efits have been many. It has been applied to the study of history. By its methods we are enabled, as it were, to get back of the histor-ian. We wish to learn his character and his methods of working; we wish to know whether he used the best material at his command, whether he suppressed any of the facts or took them out of their connection, thus giving them a wrong interpretation. We wish to know whether he had some political purpose in view or not; whether he told the whole truth as he saw it for the truth's own sake. It has also been of advantage to history indirectly through 94 THE COLLEGE MERCURY. the comparative study of language. By its methods we have been able to bridge over chasms between nations, thus establishing the nation's origin which would otherwise have been imposssible. It has also been of value to the church. A proper application of scientific methods tends to eliminate many of the errors which man has read into the Bible. Sin has dulled man's per-ception and a struggle is necessary for him to regain his lost position. To accomplish this man's nature requires that science and religion •go hand in hand; that scientific methods be complemented and enlightened by Christian revelation. We can thus see scientific spirit playing an important part in every department of daily life. It is the motive power of the age. It brings about invention after invention. It enthuses the age with its true progressive spirit and urges us on and on to a higher state of civili-zation. E. M. STAHL. IN THE CONFLICT. Perfection is the aim of all true manhood; perfection is the moral, intellectual, and phys-ical qualities which we possess. We turn over history's pages, and we see tier upon tier of anxious faces in the arena with eager eye set upon the gladiator, physically perfect, as he strains every muscle to win the conflict. Year after year he has trained those brawny arms for the final encounter. At first it seemed that this would be a fitting representa-tion of the "Conflict of Life," into which the class of '94 is to enter. But second thought suggested (with no intention of making any plea for athletic sports,) that the modern ath-lete as he contends for glory and victory is more fitting because a more familiar represent-ative. 'Tis a perfect day in autumn on which the final contest upon the field of manly sport is to take place. Thousands of anxious faces are watching for the heroes of the hour. In that great throng are friends and relations of each participant, who have come to cheer their favorite on to victory. But they need not wait long, for here comes that well-trained band led by its alert Captain, who thinks thoughts worthy of a Napoleon or a Washing-ton, while planning for victory in the struggle. Can you faintly hear those words of exhor-tation from the lips of that captain, as his men are gathered about him, drinking in those final words intended for no other ears than theirs: "My men, we must win. Glory, honor, supremacy, lie in victory, while these will all be lost if we lose. I want every man to do his very best; remember what you are contending for, never give up until the last moment is gone, and if it brings defeat, I want to feel that every man has done his duty. This is all I can expect." I dare say those noble words of Nelson, "England ex-pects every man to do his duty," awakened no nobler sentiments, no truer courage. But the conflict begins, yet it is not one of brute force, for these are gentlemen who con-tend to-day for victory and for nothing else. The great masses of human strength heave to and fro. But see! At the moment when every man's best is needed, the one from whom much was expected, lags behind or makes a blunder, because he is not the true athlete, because he has shirked some duty or scorned some word of advice. The conflict intensifies, victory is seated on the banners of neither contestant as yet and the precious moments are flying. Ere long, the contest must be decided; if hopes are to be realized, now is the time. Summoning every particle of strength, and the whole power of will, they make one grand movement, one united effort and the victory is won. The hour has brought reward for toil. "This is the only part of an athlete's career of which the public knows anything, this brilliant climax of half a year's daily work and sacrifice." People know nothing of that self-denial, which has given up pleasures in-numerable, which has declined solicitations THE COLLEGE MERCURY. 95 to self-indulgence, which has given up things which made College life what it is. There is no more room for the indolent man in athletics than there is for the lazy bee in the hive. He is stung by the piercing words of ridicule until life is made a burden for him. But energy alone does not make the victors. Mental discipline is no less a factor to his suc-cess than physical power. Brawn and will, a cool, calm intellect, these are the requisites. Were I making a plea for athletics, I could point you to example after example, where the man who led his team to victory, also led his class; where the fingers which pitched the winning game, penned the grandest words which won the prize. Manly self-respect and refinement are im-portant requisites in an athlete's training. Evil habits and wrong ideas, which mar many a life, have been given up, because it was ab-solutely necessary. These having been given up, and the man having been made a man, cruel appetite and seemingly irresistible desire .lost their sway and he remains a man forever. Many harsh words of criticism have come to his ears from the lips of superiors, who have shown him his faults, and who have plainly told him just what was expected of him. But these only give a tenderer tone, a sweeter sound to the final words of exhortation and are forgotten in the moments of victory. If there is one thing which towers high above everything else, it is courage. The coward, no matter what other qualities he may possess, is not wanted. He is a hindrance. It takes a Heffiefinger to stand by a poor, for-lorn man, who is at the mercy of an angry lynching mob and defy them to carry out their awful purpose. It takes a Frederick Brokaw to plunge into the angry, roaring waters to save a servant girl and to give his own young, promising life in the attempt. These are some of the stages of the athlete's training. I trust that you have been able to see the analogy of our own lives, but a few words of application may make it plainer. Not unlike this training has been our own. For four years we have been in preparation for the conflict upon which we enter to-day. As the true athlete learns to receive the kindly criticism of his superiors, so we, too, have learned to be grateful to those who point out errors to us. Although it is not pleasant to stand up to be criticised, yet when we think of it, we really ought to congratulate our-selves, every time we learn of a new fault, not because we have such a fault, but because we have now discovered it. For the discovery of a fault is to anyone who is living worthily, an opportunity for fresh conquest, and for a new advance in the evolution of a noble character. In our preparation for Eife's Conflict, refine-ment in word and manner, has been an im-portant factor. "True nobleness is always gentle. Eove is the law of life, and whatever is unloving is a blemish." We may not be familiar with the rules of etiquette, may not be able to appear gracefully in a drawing room; and yet we may have a grace and gentleness of heart, which will give to our bearing and acts the truest refinement. Have you ever known a true athlete to be a coward? Has the true man ever shown cow-ardice ? No, it is he who can bear the scorns and sneers of those who oppose him in his de-fense of truth and right. Energy. especially has been a part of our training. Some men who never get on in life blame their failure on unfavorable circum-stances. They think if their conditions had only been different, they would have been suc-cessful. But the way to make the most of life is not to get easy conditions, it is to take the conditions we have and by energy, faithful-ness, indomitable courage, and unsparing, un-relaxing toil, to make our conditions and circumstances serve Us in doing the work of life well. The ambition to win the contest has been a powerful influence. Without enthusiastic am-bition, we are not worthy the lofty name of men. God did not make us to grovel like worms. He made us to rise to glory. The world has neither .use nor room for men who 96 THE COLLEGE MERCURY. are without energy and persistence. They can only be dropped out and left behind while the conflict rages. People do not dream them-selves into grand characters and lofty posi-tions. And there never was a time when it was grander to live than now, when true men have larger opportunities to do noble deeds and make a worthy record for themselves. The ambition of the athlete is to win. "The desire of every true-hearted and worthy young man is to reach that vision of beauty and nobleness which he himself earnestly desires to attain. It is radiant and spotless." Some one says "God never yet permitted us to frame a theory too beautiful for his power to make practicable.'' The conflict is not to be won in a day; a lifetime alone is sufficient. Yet the victory should be kept before the eye all the time, and the effort to obtain that victory should never faint nor lag for an instant. Through all experiences, through trial, temptation, discouragement, opposition, defeat and failure, the eye should rest unwaveringly upon the goal and the purpose to conquer should never be abandoned. "The thoughts of victory dawning on the soul Are glorious heaven gleams; And God's eternal Truth lies folded deep In all man's lofty dreams. F. H. BLOOMHARDT. IVY POEM. BY COKA B. HAKTMAN. oh, green twining Ivy, true emblem of friendship, That friendship which lives through all sorrow and care, That spurns the rude thrust ot the blast of misfortune And grows still more dear, be the sky dark or fair. Oh, bright glossy Ivy with silver-veined foliage, ' That ever is green and ne'er becomes sere, How like to fond memory thy very existence, Hemembrance of life and of things that were dear. Oh, small Ivy sprig, with thy dainty young tendrils That tell of the ties of devotion and love, We look on thy beauty and think of the future. We trust thee our sentiments nobly to prove. By the side of this hall, the Chapel Memorial, We plant thee with joy and an uprising prayer That dear mother Earth may love thee and cherish. And give thee the best of her motherly care. Grow onward and upward, dear plant, on thy mission, Cling close to the wall with a gentle embrace, Heed not the loud threat of the nearing dread tempest, Nor clouds darkly hiding the sun's smiling face. Enshroud this high wall with thy evergreen mantle, Adorn every part with thy tap'stry of life; Preserve from decay and shield it from ruin, Protect from the storm and from time's ruthless strife. Then, emblem of friendship, remembrance, devotion, Speak fervently, lovingly, words sweet to hear, Recall to the mem'riesof those who shall follow The class '94, the class of this year. Tell how all its members are faithful and earnest In the struggle of life as onward time runs, Tell how they are loyal to dear Alma Mater, Now devoted to her are her daughters and sons. LOCAL G-OVERNMENT. It is our favorite boast as American citizens that we are the freest people on the face of the globe. And such, indeed we are. This is the sentiment of the political philosopher, as well as the patriotic citizen, filled with a par-donable pride. Here liberty, in the truest sense of that much misused term, has found a secure abode. Our government was "conceived in lib-erty." This was the spirit that animated even our pilgrim forefathers who, to secure it, left home and country to brave the mighty deep. This was the spirit of the heroes of the revo-lution who poured out their life-blood upon the altar of their country. This was the spirit of the framers of our Constitution, which was established, as they said, "to secure the bless-ings of liberty to ourselves and our poster-ity." In the government of a people so jealous of their rights, so filled with the love of liberty and self-government, it is natural to expect that they would keep a large part of the power of government as near to themselves and as directly under their own immediate control as possible. So we find it in our coun-try to-day. A local government has been es-tablished in our midst, forming a most im-portant part of our governmental structure. It is not the purpose, at present, to point out the wisdom of this course on the part of our ancestors, to show how necessary this step was to the securing of real liberty, but rather to point out the importance of this branch of our government to the welfare of the citizen THE COLLEGE MERCURY. 97 to-day, and the necessity of a wise and eco-nomic administration of our local affairs. It is the function of local government, broadly speaking, to administer the laws. These the State government for the most part enacts while with the local government it re-mains to carry them out. In other words, the State Legislature enacts laws for the benefit of the people, the local authorities determine how much benefit they shall be to the people and how much such benefit shall cost the peo-ple. The local government thus has virtually under its own control, matters that are of vital concern to the welfare of the people, matters that are of practical importance to the every-day life of every citizen. Education, high-ways, the care of the poor and taxation to pay the expenses incurred are some of the matters in the hands of the local authorities. Educa-tion, for instance, is mostly in the hands of school boards, who erect and furnish school buildings, employ teachers and exercise a gen-eral supervision over the schools. The high-ways are in the hands of road supervisors whose duty it is to keep the roads in repair. The care of the poor is in the hands of poor directors whose duty it is to see that those un-fortunates among us, who are no longer able to care for themselves are comfortably fed and clothed. And so through a long list of officers and duties to describe, which would be ex-tremely tedious and at the same time unnec-essary for the present purpose. The impor-tance of the local government, as seen in these offices, is unquestionable. It is concerned with matters that are of immediate interest to every citizen, and it follows naturally, as be-ing of importance, that it should be adminis-tered well. It is important, in the first place, that it should be administered efficiently—that the ends for which these laws were designed should be accomplished. We see the impor-tance of this in the school management of the borough or township where the condition of our public schools depends largely upon the in-telligence of the school board. We see it too in the care of our public roads where, upon the intelligence of the supervisor—only too often a minus quantity—depends this most im-portant factor of civilization and progress. It is important, in the next place, that it should be administered economically; that the expense connected with such administration should be as little as possible. This consider-ation has been left for the last because it is the one that perhaps most needs emphasis at the present day. We hear, occasionally, of the im-portance of limiting our State and National expenditures "to the necessities of govern-ment, honestly and economically administered. And that is right. But if it is true of our State and National governments how much more is it true of our local government ? It is to the citizen, by all odds, the most expen-sive of all. To the National government we pay no money in direct taxes, and to the State government we pay comparatively little. It is to the local government that we pay the larger part. While economy in our State and Na-tional affairs, it is true, is highly desirable, in our local affairs it becomes essential to the welfare and progress of the citizen. Taxation, though necessary to the carrying on of all government, is none the less a burden, and if a heavy one, may seriously cripple the welfare of a community. Especially is this question of taxation of importance in boroughs and cities, where the burden of taxation often be-becomes almost unbearable and often proves a serious menace to business prosperity. There is economy in government as well as in the home, and it should be practiced as rigorously in the one place as in the other. Extrava-gance in government is robbery. If, by reck-less expenditures on the part of our local of-ficials, the citizen is compelled to pay taxes for which he receives no benefit, he is no less being robbed than if he is met upon the highway and made to give up his money un-der the threat of death as the alternative. Ex-travagance in government is a baneful evil that should be removed as speedily as possible wherever found. As a means of checking reckless expendi- BSBKBHT 98 THE COLLEGE MERCURY. tures on the part of our local officials the local office-holders should be made to feel that he is directly responsible to the citizen for every dollar that he expends. The spirit of those local papers which are disposed to acquaint the citizen with the manner in which our local affairs are being carried on is highly com-mendable. The citizen has a right to know what his money goes for and at the same time the honest, conscientious official will not fear publicity. Above all, that our local affairs may be ad-ministered well, we must place good men in charge. To this end let us use our best ef-forts. Let us not stay at home on election day under the mistaken impression that our local affairs are of little importance. But let us go to the polls and vote. Political apathy has no right among a self-governing people. Let us throw aside party prejudices. "Principles, not men," may be a good motto for a Na-tional election but it certainly is not for a local one. Let us vote for the best man regardless of party differences. Let the men who have charge of our local affairs be the most honest, the most intelligent, the most energetic that the commvmity can offord. H. A. ALLISON. * ♦ ♦ JUNIOR ORATORICAL CONTEST. WEDNESDAY, JUNE 20TH, 18 ♦Progress and Triumph of Democracy, tThe Courage of Conviction, - *Our Present Peril, - - - - tThe True Shekinah, - ♦Ships that Go Down in the Night, - ffrue Greatness of Man, - *Our Mental Lives, - tSeeking the Goal, - J. E. BYERS. W. A. HARTMAN. M. G. L. RIETZ. H. E. CLARE. • W. A. KUMP. W. D. MAYNARD. - H. M. WlTMAN. A. R. LONGANECKER. •Phruiiiikoxmiiill. tl'llUumatlitoan. OUR MENTAL LIVES. "In the world there is nothing great but man; In man there is nothing great but mind." This is an aphorism of Sir William Hamilton. What sublime truth! But we may go yet further and say that man is the world. All forms of matter and of life were created for him, to serve his ends. The world is his, he rules it—he is the world. Again, we may as-sert that the mind, or more strongly, the soul is the man. By natural conclusion, therefore, the mind, the soul is the world. And truly, indeed, is the soul man's real world. We are to treat of this world, more particu-larly of the mind. What a symbol of power in very grandeur! Crowning endowment of man, God's noblest work! The image of the Divine mind, its faculties and powers approach those of the Creator. Designed to comprehend and interpret His thoughts and His laws as written on the tablets of nature and in man himself, it thinks over again these thoughts of the great uncreated Thinker. Vast and ex-haustive sciences and philosophies has this thinking mind established, wherein are re-corded its analyses and explanations of the laws of nature, of man and of God. Un-checked by the narrow confines of the world, the bounds of space, or the limits of time, it may wander at pleasure amid empires and wonderlands of its own creation, and even pierce the woeful borders of Hell or enter the blissful gates of Heaven as did the inspired soul of Milton. Reason, Understanding, all the capacities for thought and for knowledge! What pro-found powers are these ! Dominating influ-ences of the world! Imagination, Memory! What wonderful and delightful kingdoms! Girt in such robes of majesty, with a dignity both grand and sublime, adorned with almost angelic graces, the lofty soul of man, acknowl-edging its Lord and Maker and gaining its mighty power from that divine source, by its soul-quickening, soul-inspiring personality, has conquered the world and reigns supreme in its vast realms. What wonder that Plato called the faculties gods and that France was led to worship Reason! In the infinite wisdom of God, and in the divine harmony of the creation, all minds were not endowed alike, but each with its peculiar talents and capacities. Again, Mr. Emerson says: "It seems as if the Deity dressed each THE COLLEGE MERCURY. 99 soul which He sends into nature in certain vir-tues and powers not communicable to other men, and, sending it to perform one more turn through the circle of beings, wrote, 'Not trans-ferrable' and 'Good for this trip only' on these garments of the soul." Each soul, in its sov-ereign freedom and in the exercise of its di-vinely appointed prerogatives, may use and develop its talents for its own betterment and the good of mankind, or it may consign them to decay and death, abandoning itself to sen-sual pleasures, the glamours and enchant-ments of the world. Man's talents are the gifts of God, the signature of Divinity written on his soul. To despise them is to despise God Himself. What cowards, what robbers we are! What very pigmy souls in compari-son to the grandeurs possible to us? What soul has ever attained to its highest possibility? Yea, how many attain to even a middle de-gree ? What a world of wasted power! No less a mind than that of Mr. Emerson thus observes: "There is an American dis-ease, a paralysis of the active faculties, which falls on young men of this country, as soon as they have finished their college education, which strips them of all manly aims and be-reaves them of animal spirits; so that the no-blest youths are in a few years converted into pale Caryatides to uphold the temple of con-vention. Is there not room, then, for a most serious consideration of our subject? Mental j paralysis, mental lethargy, mental loafing are diseases which have blighted and ruined the powers of many thousands of minds. From non-use, disuse, as well as abuse of the facul-ties of the mind, men become intellectual sui-cides and the evil is a most prevalent one. De-based and degraded, the soul is dragged from its throne, the sceptre, which is conscience, is broken, and the crown, which is reason, is thrown away. We make our lives the fulfillment or the failure of a grand purpose. According to his individual concept of this purpose so will each man fashion his life. Some merely live, es-teeming only health and bodily sustenance; others esteem wealth; others worldly power; others social distinction; and of a great major-ity pleasure is the highest aim. With such use the higher faculties of the mind must be-come dwarfed and well-nigh lost. How many mere sentient beings there are in the world, who go by the name of men, but who know not the higher intellections of the soul ? Says Bovee : '' Mind unemployed is mind unenjoyed." And Spenser : "It is the mind that makes good or ill That maketh wretch or happy, rich or poor." Our lives, then, are truly our thoughts. If we have beautiful and happy thoughts, our ' lives are beautiful and happy. If the resources of our souls are marked with richness or pov-erty, our lives are virtually rich or poor. It is in the quality of our pleasures not in the amount that the soul is truly and lastingly happy. Oh, the dignity and joy of the true life of the soul! Happy indeed was Sir Wm. Byrd, who could muse thus : "My mind to me a kingdom Is; Such perfect joy therein I And, As far exceeds all earthly bliss, That God and nature hath assigned." "Every mind,", says Channing, "was made for growth, for knowledge, and its nature is sinned against when it is doomed to ignorance. We owe it to ourselves, our fellowmen and our God to cultivate and develop our indi-vidual powers. The responsibility is tremen-dous, and, in contemplating it, even souls that are most brave in the heat of life's battle grow coward. Were it possible to resign this life for that better, even without having accom-plished anything in the world, how many of us would have the courage to stand forth and say : I will live out and accomplish the pur-pose for which I was created ? What miserable courage we have-! It is said of Michael Angelo, that, when he had finished his statue of Moses, and the figure stood there in its perfect form and beautiful S3'mmetry, seeming to beam forth a living soul, yet lifeless, in his desperation he struck it on the knee with his hammer, saying in the intense feeling of his soul : "I can do every-thing for you but give you life." And we IOO THE COLLEGE MERCURY. can well understand his despair. Oh, man that hast life, that art "so noble in reason, so infinite in faculty, in form and moving so ex-press and admirable, in action so like an angel, in apprehension so like to God, the beauty of the world, and the paragon of animals," shalt thou not be more than statue, not more than caryatide ! If there is no other reason why we should develop our individual powers of mind, then for a defense: If we would escape a life of comparative blankness and loneliness, of con-tinued dissatisfaction and endless despair, we would lay up in our own souls stores of knowl-edge and truth, that we might ever find in their rich resources an abundance of wealth and precious stones of inestimable worth, of ever newer and more delightful form, and in our own noble and beautiful thoughts most pleasant and congenial companionship. Let each fact which we attain be, as Mr. Emerson calls it, "a fulcrum of the spirit," and let the will in its purity be the lever by which to raise the spirit higher. Let each expansion of the soul be as an invitation from heaven to explore loftier regions of thought. Finally, we are each of us writing a book of our lives, which shall be opened on that Great Day in the presence of the angel hosts and the multitudes of earthly souls ranged before the Judgment Bar of God. In it shall be found a strict record of the soul as to every thought and every deed. Shall its pages be filled with beautiful and refined thoughts that shall shine forth in characters of living light ? Shall the pages be written in dull monotony ? or shall they be blank ? We are each day numbering them. H. M. WITMAN. BOLL OF HONOR. FIRST GRADE. MARGARET R. HIMES, DAVID W. VAN CAMP, - HERBERT A. ALLISON, JULIUS F. SEEBACH, FRED H. BLOOMHARDT, - SECOND GRADE. FRANK E. FICKINGER, PAUL W. KOLLER, Gettysburg. Plainfield. Gettysburg. Waynesboro. Altoona. New Bloomfield. Hanover. GR^FF PRIZE, For best Essay on Tennyson's '-Princess." CORA E. HARTMAN, - - - - Mummasburg. HASSLER GOLD MEDAL-Junior Latin Prize. NATHANIEL C. BARBEHENN, - - Gettysburg. WITH HONORABLE MENTION OF WALDO D. MAYNARD, - - - Schoharie, N. Y. M. G. L. RIETZ, - Amsterdam, N. Y. HERBERT F. RICHARDS, - - - Zanesville, O. BAUM SOPHOMORE MATHEMATICAL PRIZE. LUTHER P. EISENHART, - - - York. DAVID E. RICE, - - - - Chambersburg. WITH HONORABLE MENTION OF EDNA M. LOOMIS, . - Troy. MUHLENBERG FRESHMAN PRIZE, For best general Scholarship. HENRY WOLF BIKLE, - - - Gettysburg. WITH HONORABLE MENTION OF GEORGE F. ABLE, - Philadelphia. ELKANAH M. DUCK, - - - Spring Mills. REDDIG PRIZE IN ORATORY. HORACE M. WITMAN, - - ' - Harrisburg. WITH HONORABLE MENTION OF WILLIAM A. KUMP, - - - Hanover. HONORARY DEGREES. Doctor of Divinity, Rev. Frank Richards, Zanesville, Ohio. " " " " J. A. Singmaster, Allentown, Pa. " " " " J. L. Smith, E. End, Pittsburg, Pa. " " " " M. G. Boyer, Aitch, Pa. " " Science, Prof. Geo. W. Gross, York, Pa. Master of Arts, Clarence J. Reddig, Shippensburg, Pa. Doctor of Philosophy, (on examination) Rev. M. M. Kinard, Columbia, S. C. COLLEGE C0MM2NCENENT PROGRAMME. THURSDAY, JUNE Latin Salutatory, - Scientific Spirit, - . - - National Sentiment, The Retirement of Gladstone, The Benefits of Opposition, The Lesson of the Mountains, Lynch Law, its Cause and Cure, - Local Government, - The Academic Atmosphere, In the Conflict, with the Valedictory, 21ST, 1894. - DAVID W. VAN CAMP. ELMER M. STAHL. - WILLIAM F. LUTZ. BENJAMIN R. LANTZ. - FRANK E. FICKINGER. JULIUS F. SEEBACH. - PAUL W. KOLLER. HERBERT A. ALLISON. - MARGARET R. HIMES. - F. H. BLOOMHARDT. CONFERRING OF DEGREES. H. W. MCKNIGHT, D. D., LL. D., President of the College' CANDIDATES FOR DEGREES. Rev. John M. Axe, " Thomas B. Birch, Garnet Gehr, Esq., Rev. Samuel G. Heffelbower, Rev. John E- Hoick, " Albert O. Mullen, " August Pohlmann, " William G. Slifer, MASTER OF ARTS. Rev. Stanley Billheimer, " Wilton C. Dunlap, Robert N. Hartman, Ph. D., William Hersh, Esq., Rev. J. B. Markward, Luther C. Peter, M. D., Rev. Charles L. Ritter, William L. Smyser, THE COLLEGE MERCURY. IOI Rev. George F. Snyder, Charles W. Walker, Esq., Rev. Robert B. Wolf, F. P. Whitmer, '90. Rev. Martin L. Tate, " Edmund J. Wolf, " Noah Yeiser, '90, BACHELOR OF AKTS. Herbert Allen Allison, - call Platt Bastlan, - Fred Herman Bloomhardt, Frank Barndt, - Luekctt Ashton Bush, William Babylon Duttera John Super English, John Sherman Fair, - Frank Flcklnger, - James Whit e Gladhlll, Cora Elizabeth llartman, ■ Margaret Rebecca Hlmes, William Oscar Ibach, - Matthew Kemp, Charles Froneileld Kloss, Paul Warren Roller, Benjamin Eelgle Lantz, William Filler I.utz, Richard Warren Mottern, Jacob Crayton Nicholas, Julias Frederick seebach, Samuel Blddle Sorrlck, - Elmer McClellan Stahl, Clyde Bell Stover, David William Van Camp, - Gettysburg, Pa. Maple Hill, Pa. - Altoona, Pa. - Sumneytown, Pa. Harney, Md. - Gettysburg, Pa. Harrisburg, Pa. - Altoona, Pa. New Bloomfleld, Pa. - Jersey Shore, Mummasburg, Pa. - Gettysburg, Pa. Philadelphia, Pa. - Hazleton, Pa, Tyrone, Pa. Hanover, Pa - Hagerstown, Md. Bedford, Pa. Watsontown, Pa. - West Falrvlew, Pa. Waynesboro', Pa. Willlamsburg, Pa. - Hay's Mills, Pa. Hagerstown, Md. Plain Held, pa. BACHELOR OF SCIENCE. John Hoffer, Jr., Ralph Eaton Miller, William otterbine NIcklas, Harrisburg, Pa. Plnegrove, Pa. Chambersburg, Pa. COWIMENCEWIENT NOTES AND COL-LEGE LOCALS. The old officers of the Alumni Association were re-elected, at the meeting held in Brua Chapel, on Wednesday evening of Commence-ment week. The annual address before the alumni was delivered by George J. Benner, '78, of the Gettysburg Bar. His subject was: "The Signs of the Times.'' H. M. Clabaugh, Esq., '77, was elected alumni orator for next Commencement. Rev. Daniel Garland was re-elected alumni editor of THE MERCURY. Notices were read by the chairman of the obituary committee, of nine Alumni who died during the year: Rev. W. H. Lilly, '71; Rev. Dr. C. A. Hay, '39; Rev. J. Phillip Willard, '39; Rev. C. G. Focht, '87; Rev. H. M. Bickel, '48; Rev. A. C. Stup, '91; Rev. Henry Baker, '41; Rev. Henry L- Ziegenfuss, '66; J. Cassatt Neely, Esq, '56. FOUND.—A gold watch chain, the owner may procure the same by calling upon or ad-dressing Dr. P. M. Bikle, Gettysburg, Pa. The beautiful new flag that now wave from our dormitory merit and receive the admira-tion of every college man. The purchase of these flags is the accomplishment of a general student's movement. It is gratifying to see the patriotic spirit of the boys manifested in this way, especially here where all the sur-roundings call forth the highest and noblest feelings of patriotism. The college wishes to extend its thanks for the following contribu-tions:- From the Faculty, $7.50; class of '94, $5-Oo; '95. $4-5o; '97, $5-oo. The Phi Gamma Delta Fraternity held a banquet on Wednesday evening of Commence-ment week. The large and beautifully fur-nished halls of the new "Eagle Hotel" were used. Rev. D. Frank Garland, the alumni editor of the MERCURY was toast-master for the evening. The following toasts were pro-posed and ably responded to: "Welcome,"—E. H. Wert. "The Fraternity Idea,"—Rev. H. C. Alle-man. "Our Fraternity,"—Sterling Valentine. "The Early Days,"—Prof. E. S. Breiden-baugh, Sc. D. "Reminiscences,"—E. G. Miller. "The'Alumni,"—Geo. J. Benner. "The Active Chapter,"—F. H. Knubel. "The Ladies,"—L. A. Brewer. Some other addresses by the visiting Alumni followed. A very pleasant and enjoyable time was had by all. The annual banquet of "Philo Debating Club" was held on Thursday evening, June 7th, in Minuigh's parlors, on Baltimore street. A very pleasant time was enjoyed by all pres-ent. About 10 o'clock, were served, in a very tasteful and inviting manner, all the rich deli-cacies that go toward adorning the tables of modern Epicureans. After the voluptuous re-past was enjoyed, Mr. Rietz, President of the Club and toastmaster for the evening, called fe 102 THE COLLEGE MERCURY. upon a number of the boys, who kept the merry ball rolling for more than an hour by their witty and much appreciated responses. The boys then returned to College highly pleased, and with a secret vow to be more faithful and to do better work for old Philo. in the future. On Tuesday evening, the 19th inst., the Glee, Banjo and Mandolin Clubs of College, gave an entertainment in Brua Chapel. A new programme was rendered upon this occa-sion, and the performance throughout was es-pecially fine, meriting and receiving much praise from all who were present. The organ-izations are much indebted to Messrs. Nicho-las, Seminary, G. C. Baum, '93, for their act-ive interest in, and highly appreciated serv-ices for the several clubs. The second annual banquet of the Peisel-fannish Deitsch Gesellschaft was held in Min-nigh's parlors, on Chambersburg street, on Thursday evening, June 14th. The attendance was large and the evening was pleasantly spent by all. Toasts were responded to by a number of the members. The President, Mr. E. N. B. Erb, acted as toast master. The organization is in a nourishing condition. The President's reception was held on Thurs-day evening. It was a brilliant and successful affair. The recitation Hall was beautifully deco-rated with flowers and palms. The attendance was larger this year than it has been for a long time. The large number of Alumni and friends present was a gratifying feature. The Metronome Orchestra of Harrisburg furnished the music for the occasion as well as for the other exercises. They have received many compliments for their fine music. The Junior Annual, "The Spectrum," was put on sale last week. The book is the finest annual ever published here. The artistic finish as well as the nature of the matter has been deservedly commented upon. The class is to be congratulated upon its success in getting out such a meritorious annual. We hope other classes will meet with the same support from our loyal Alumni and friends, and that succeeding annuals will even surpass this one in beauty and elegance. The Board of Trustees met on June 20th 1894. Pres. McKnight's report was read and was very satisfactory, showing the college to be in a flourishing condition. The recommendation of Principal Klinger for the appointment of C. B. Van Ormer, as Tutor in the Preparatory Department was con-firmed by the Board. Rev. C. M. Stock, Rev. H. B. Wile, Mr. T. B. Patton and M. G. Boyer were elected members of the Board of Trustees to fill va-cancies. Mr. Benjamin Kunkle and Rev. Dr. Conrad were re-elected. Mr. McPherson succeeds himself as a mem-ber of the Executive Committee. The question of considering the advisability of establishing additional courses of degrees was referred to the Executive Committee to be reported next year. Among the visiting Alumni who were pres-ent at Commencement are the following: '46. Rev. W. M. Baum, D. D. '47. Rev. L. E. Albert, D. D. '48. Hon. Edw. McPherson, E. E- D. '50. Prof. M. Valentine, D. D., E. E- D. '51. Hon. David Wills. '55. Jacob Rinehart, M. D. '56. Robert E. Sibbet, M. D. 57. Rev. Prof. C. E. Keedy, M. D., Rev. D. McC. Gilbert, D. D. '58. Rev. E. S. Johnston. '59. Rev. J. G. Goettman, D. D. '61. Andrew T. Kistler. '62. Rev. M. L. Culler. '63. Prof. E. J. Wolf, D. D. '64. Rev. Frank Richards. '65. Rev T. C. Billheimer, D. D., Rev. M. G. Boyer, Rev. J. C. Roller, D. D. '66. Rev. H. S. Cook. '67. Hart Gilbert, Esq. THE COLLEGE MERCURY. 103 '68. John W. Hay, M. D., Prof. J. W. Richard, D. D. '70. Rev. J. T. Gladhill. '71. Rev Charles E. Hay, Rev. D. T. Koser, Rev. John Wagner. '72. George N. Acker, M. D., Rev. J. A. Koser, S. McC. Swope, Esq. '73. Rev. E. H. Leisenring, Rev. J. A. Singmaster. '74. Rev Chas. M. Stock, G. E. Titus, M. D. '75. Rev. E. D. Weigle, D. D., Rev. M. L-Young, Ph. D. '77. Rev. W. M. Baum, Jr., H. M. Cla-baugh, Esq., Rev. Harry B. Wile. '78. George J. Benner, Rev. J. A. Hart-man, Rev. J. F. Mackley. '79. J. F. Graff, Rev. Luther Kuhlman, H. C. Picking, A. C. Wentz, M. D. '80. Rev. A. H. F. Fischer, Rev. J. A. Metzgar, Rev. W. E. Stabler, Sterling G. Val-entine, Ph. D. '82. C. S. Duncan, Esq., Rev. M. H. Val-entine, Rev. H. H. Weber, G. M. Walter, Esq. '83. L. A. Brewer, Esq., J. B. McPherson, Esq., J. E. Musselman. '84. Rev. A. S. Fichthorn. '85. Rev. Edgar Grim Miller, Rev. Ed. Everett Hoshour, Rev. C. Reinewald, Rev. R. Stare. '87. Rev. H. C. Alleman, Rev. Amos A. Parr. '88. Rev. L. S. Black, Rev. D. Frank Gar-land. '89. Donald P. McPherson, John Reed Scott, Esq., Ira L. Tipton. '90. Rev. H. Anstadt, Rev. H. C. Bixler, Rev. E. E. Blint, Rev. F. S. Geesey, Rev. J. F. W. Kitzmeyer, George B. Kunkel, M. D., Rev. W. G. Minnick, Wm. B. Small, M. D. '91. Rev. Stanley Billheimer, Rev. T. B. Birch, Rev. S. G. Hefelbower, Wm. Hersh, Esq., Rev. E. J. Wolf, Rev. R. B. Wolf. '92. H. E. Berkey, C. G. Bikle, M. T. Brown, W. K. Damuth, D. P. Drawbaugh, Frank Hesse, C. H. Huber, G. J. M. Ketner. '93. G. C. Baum, J. J. Brallier, G. M. K. Diffenderfer, H. E. Gettier, A. A. Kelly, F. H. Knubel, J. R. Plank, A. J. Rudisill. Many other Alumni were present whose names could not be obtained. ALUiviNl- '68. Rev. J. W. Richard, D. D., of the Seminary, delivered the Baccalaureate Sermon to the graduating class of Kee Mar College, Hagerstown, Md., on June 3rd. '71. Rev. Dr. E. F. Bartholomew, of Au-gustana College, Rock Island, 111., will spend a year abroad for study. 'Rev. W. E. Fischer, of Shamokin, Pa., de-livered the Baccalaureate to the graduates of the High School of that place on June 3rd. The class numbered twenty-six and their com-mencement was a most creditable and delight-ful affair. '75. Rev. E. D. Weigle, of Altoona, Pa., received the title of D. D., when degrees were conferred at Selins Grove, Pa. '76. Rev. Prof. Jacob Yutzy, pastor of the Evangelical Lutheran church, of Selins Grove, has issued a "Memorial Jubilee Volume," con-taining a history of the church for the past half century. The work is a valuable acqui-sition to the history of the Lutheran church. '78. Mr. George J. Benner, Esq., of Gettys-burg, delivered the address before the alumni of the College on Wednesday evening, June 21st. '82. Rev. A. R. Steck, of Indianapolis, Ind., who preached a trial sermon lately in St. James church, has accepted the call extended to him by the congregation to be the successor of Dr. Swartz. Mr. Steck will soon enter upon his duties. '86. Rev. Prof. O. G. Klinger, Principal of the Preparatory department of College, deliv-ered the annual address before the Irving Col-lege C. E. Society, Sunday evening, June 3rd. '90. Rev. S. T. Nicholas, pastor of the Evangelical Lutheran church, of Allegheny, io4 THE COLLEGE MERCURY. was married to Miss Elizabeth Spangler, of Areudtsville, Pa. '90. Mr. George P. Kunkel, who has been engaged in the Reading Hospital for the past year will now set up practice for himself in Harrisburg. '90. Rev. W. G. Minnick, who was with us during commencement, is meeting with good success in his new field of labor, Harney, Md. Mr. Minnick had charge of the exercises at the dedication of the new cemetery in that place. '90. The many friends of Rev. J. W. F. Kitzmeyer, were glad to welcome him here again. Mr. Kitzmeyer has been engaged in Davis, W. Va., for the past year as a Lutheran pioneer and has been so successful that he has built a beautiful church. '91. Rev. W. C. Dunlap, of the graduating class of the Seminary, was married on June 6th, to Miss Irene Beck. Mr. and Mrs. Dun-lap will reside at Duncannon, Pa., to the pas-torate of which Mr. Dunlap was called. '91. Rev. C. L. Ritter, of the Senior Class J at Gettysburg Seminary has accepted a unani-mous call to the Fayetteville charge in Frank-lin Co., Pa. '91. Rev. A. O. Mullen, of the Seminary, has been elected pastor at Altamont, N. Y. '92. Mr. Maurice T. Brown, who is mer-chandising with his brother in Waynesboro, Pa., visited his many friends here during com-mencement. '92. Rev. G. Albert Getty, of Baltimore, was married to Miss Alathea W. Bernard, of Harford Co., Md. Rev. Milton Valentine per-formed the ceremony. '93. Mr. W. H. Ehrhart, of the Theological Seminary, is supplying a mission charge at Red Lion, York Co., Pa. '93. Mr. George Baum, for the past year a student at the University of Pennsylvania, and a member of their Banjo Club, was with us prior to commencement coaching the Instru-mental Clubs for the concert. '93. Mr. Wm. J. Gies, of Manheim, Pa., who has been a student at Yale for the past year, acquitted himself so well that he has been awarded a special scholarship by the University as an inducement for him to con-tinue his studies there in the cause of Biology, leading in two years to the degree of Ph. D. In addition, he has been offered the position for the coming year of assistant to Prof. R. H. Chittenden, the greatest Physiological Chem-istry expert in the United States and Professor in the Biological Laboratory of the University. '93. Mr. Wm. F. Bare, of the Seminary, will supply the mission charge at Greenmount, York Co., Pa., during the summer vacation. '93. Mr. Marion J. Kline, of Frederick, Md., a student in the Seminary, recently preached a very able sermon in his own church, of which Rev. Luther Kuhlman is pastor. Mr. Kline will supply St. Paul's Luth-eran church, Washington, D. C, during the absence of Rev. Dr. Domer. We congratu-late Mr. Kline on this excellent opportunity. JENNIS. DOUBLES—FIRST SERIES. Bloomhardt and Wheeler vs. Stover and Keffer. Dloorahardt and Wheeler: 6-1, 6-3. Barndt and Forney vs. Graff and Danner. Graff and Danner: 3-6, 7-5, 6-2. Baum and Byers vs. T,oudon and Stup. Baum and Byers: 6-4, 6-4. Fair and Monath vs. Carty and Bixler. Fair and Monath: 6-3, 6-4. Gladhill and Kain vs. Wiest and Hollinger. Gladhill and Kain: 6-4, 7-5. Kloss and Wolf vs. Hoffer and Feldman. Kloss and Wolf: 6-1, 6-4. Herr and Apple vs. I^antz and Heindel. I^antz and Heindel: 6-4, 4-6, 6-4. Fickinger and Moser vs. Keefer and Enniss. Fickinger and Moser: 6-1, 6-2. Crilly and Brosius vs. Eckels and Auckerman. Crilly and Brosius: 7-5. 6-2. SECOND SERIES. Graff and Danner vs. Kloss and Wolf. Kloss and Wolf: 3-6, 6-2, 6-1. Bloomhardt and Wheeler vs. Crilly and Brosius. Bloomhardt and Wheeler: 6-2, 6-1. Fair and Monath vs. Gladhill and Kain. Gladhill and Kain: 63, 6-4. Baum and Byers vs. Crilly and Brosius. Crilly and Brosius: 6-2, 2-6, 6-4. THE COLLEGE MERCURY. 105 RECITATION HALL LUTHERAN THEOLOGICAL SEMINARY GETTVJ5URG, PENN'A y A DeMPWOLF. ARCH'T. YORK, PENN'A. VIEW mOM THE NORTH THE NEW SEMINARY BUILDING. THIRD SERIES. Kloss and Wolf vs. Fickinger and Moser. Kloss and Wolf: 6-2, 3-6, 6-4. Crilly and Brosins vs. Gladliill and Kain. Gladhill and Kain: 6-i, 6-2. FOURTH SERIES. . Bloomhardt and Wheeler vs. Kloss and Wolf. Bloomhardt and Wheeler: 6-1, 5-7, 4-6, 6-1. 6-2. FIFTH SERIES. Bloomhardt and Wheeler vs. Gladhill and Kain. Bloomhardt and Wheeler: 6-2, 6*1, 9-7. SINGLES—FIRST SERIES. Gladhill vs. Barndt. Gladhill: 6-3,6-2. Lantz vs. Crilly. Crilly: 6-4, 6-4. Bloomhardt vs. Graff. Bloomhardt. (Forfeited.) Fair vs. London. Fair: 6-2, 6-0. Fickinger vs. Kloss. Fickinger: 6-2, 6-4. SECOND SERIES. Gladhill vs. Miller. Miller: 12-10, 6-4. Fickinger vs. Crilly. Crilly: 6-2, 6-8, 6-0. Bloomhardt vs. Fair. Bloomhardt: 6-0, 6-4. THIRD SERIES. Bloomhardt vs. Miller. Bloomhardt: 6-4, 6-2, 6-i. FOURTH SERIES. Bloomhardt vs. Crilly. 1 Bloomhardt: 6-4, 6-2, 6-3. INTER-FRATERNITY TOURNAMENT. Phi Delta Theta vs. Phi Gamma Delta. Phi Gamma Delta: 7-5, 6-3. Phi Kappa Psi vs. Sigma Chi. Phi Kappa Psi: 6-1, 6-0. Phi Kappa Psi vs. Phi Gamma Delta. Phi Gamma Delta: 4-6, 6-2, 6-3. Phi Gamma Delta vs. Alpha Tau Omega. Phi Gamma Delta: 6-0, 6-0. SEWIINARY NOTES. We are pleased to present to our readers a view of the new Seminary building, taken from plans submitted by the architect. The view is from the north-west side. The esti-mated cost of the new building and re-mod-eling of the old is sixty thousand dollars. On Sunday, May 27th, Rev. Dr. M. Valen-tine preached the baccalaureate sermon, tak-ing as his text: "The cloak that I left at Troas with Carpus, when thou comest, bring with thee." On Monday evening the Rev. Frank Man-hart, of Selin's Grove, delivered the annual lecture on "Christian Worship, its Forms and Spirit," and on Wednesday evening the ad- io6 THE COLLEGE MERCURY. dress to the Alumni was made by the Rev. E. D. Weigle, of Altoona. Thursday evening the regular graduating exercises were held in Christ church, and ora-tions were delivered by the following: "Ap-plied Christianity," John E. Hoick, Oswego, N. Y.; "Spener and his Influence," Harry Anstadt, York; "Christianity's Conquest of the World," G. Albert Getty, Baltimore. Dr. Valentine then delivered diplomas to the fol-lowing graduates: Harry Anstadt, York; John McM. Axe, Bellville; Fuller Bergstresser, Middletown, Md.; Johannes S. Braren, Brecklum, Ger-many; Stanley Billheimer, Gettysburg; Thos. B. Birch, Bloomsburg; Milton C. Dunlap, Pine Grove Mills; George Albert Getty, Bal-timore, Md.; S. Gring Hefelbower, Newville; William W. Hess, Gettysburg; Henderson N. Miller, Salisbury, N. C; Albert O. Mullen, Baltimore, Md.; Robert E. Patterson, China Grove, N. C, Charles E. Ritter, Keysville; William G. Slifer, Rohrersville, Md.; H. E. Sloop, China Grove, N. C; George F. Sny-der, Port Royal; Martin E. Tate, Everett; Robert B. Wolf, Edmund J. Wolf, Centre Hall. Nearly all the members of the graduating class have received calls and many have al-ready commenced their work. At a special meeting of the Board of Di-rectors, held on Thursday morning, the con-tract for the new building was given to Geo. S. Yinger, at $34,240. The following propositions, which the com-mittee wished the Board to consider, were recommended by them: I. The plans and specifications for re-modeling and re-constructing the old building. It is to be turned into a dormitory with 59 rooms, steam heating introduced, the middle stairway taken out, roof replaced with slate, and walls and chimneys repaired. These re-pairs to cost not less than $8,000. II. The completion of the dormer story of the new building. There are to be nineteen rooms in it and the sum is to be $3,559. III. Plans for the heating by steam. The time for opening bids was extended. IV. The erection of a boiler house, the bid of C. H. Stallsmith being the lowest at $2,- 591-93- V. The placing of steel shelving in the li-brary. The price is $2,550. VI. The water supply for the building and the houses of the professors. It will be neces-sary to get water from the town supply or pump it from the well to a tank, to be placed in the old building. VII. The erection of a house on the Sem-inary grounds for Prof. Richard, who has been living under discomforts and disadvantages, the cost not to exceed $4,500. Rev. P. G. Bell, of Altoona, has been ap-pointed Financial Agent of the Seminary, at a salary of $1,000 and traveling expenses. Messrs. P. H. and W. E. Gladfelter have con-tributed $3,000 towards the fund for the new building; Dr. Charles Baum and Mr. Getty have each contributed $250. ''Takes First (Place." The ramn stands for just what it is, flUje tot Biejefe built ~% for $125.00. »9 1032 Chestnut Street, PHILADELPHIA. BASEBALL AND LAWN TENNIS SS5S-? used exclusively through-out the U s. and Canada. Spalding's Trade mark is a guaran-tee that the goods are the best, complete Illustrated Catalogue ready. Sent free. ADVERTISEMENTS. EATON & BURNETT'S ENGLISH, BUSINESS, SHORT HAND UNO TYPE1IIING, (Training School FOR YOUNG MEN fl^D WOMEN-YOHN BROS., ^>-Sol© j\cjonts FOP-V JAUIGV, Hardrqan,, Voso, ©oqoVop, Sol'^ubept, AND OTHKR PIANOS. Harqli'n, F^aol-^ard, ©l^ieago ©ottage, AND OTHKR ORGANS. Its course of study is the most advanced, thor ough and practical Business and Counting House Training ever introdicced in any Busi-ness College. Catalogue Sen Free by Addressing BATON & BUFflVGTT, Baltimore and Charles Sts., BALTIMORE, MI) «S-No Vacation. JOEWZ. SHEtfDS. N£W GlGAR STORED Next door to W. M. 'Depot, Gettysburg, Ta. BARBERSHOP, Carlisle St., below Centre Square, H. W. EONG, Prop'r. MUSIC }E MUSICAL MEpAfpSE. We Guarantee Satisfaction in Timing, Replenishing and Retailing. No. 307 Market Street, HARRISBURC, PA. Sirtter & Selimidt. PLEASE GIVE US A CALL AND TRIAL. 2 doors above the Eagle Hotel, Main Street. TOLL Y HINESE LAUNDRY, Carlisle street, first square. All work done with readi?iess and dispatch. Give Hop a call. n 0., Hats and Gent's Furnisher, 33 North Third Street, Opera House Block, HARRISBURG, PA. BOOKS BOUGHT, SOLO 4 EXCHANGED. , £■ j*- 7>XEUS School and Theological 'Boohs A. SIFEOI-A-LT^-. 327 NOKTn CIIARI.ES ST., - - - - Baltimore, Md. B illiard t>4. f j Entrance examinations 1 Id daily throughput the *L year. Enrollment blanks on application. M Gall or send for descriptive printed matter con- \ cerning the School. gpragFvw'V1 ■arnFiw1wnn* *&V*V*St CENTRAL PENNSYLVANIA ; ^BOOK pMS. No. 20 N. Second St. N. W. Cor. Market Sq HARRISBURG, PA. Headquarters for LUTHERAN, METHODIST, PRESBYTERIAN. PROTESTANT EPISCOPAL, REFORMED. J INTERNATIONAL, OXFORD. BAGSTER, CAMBRIDGE, AMERICAN BIBLE SOCIETY Sunday School Libraries, Lesson Leaves, Helps, and General Supplies. THEOLOGICAL BOOKS. Latest publications always on sale. Special discount to Clergymen and Theo-logical Students. Agents wanted by our SUBSCRIPTION BOOK DEPARTMENT for rapidly selling Books. Lib-eral Terms. Exclusive territory oil early ap-plication. Write for information. SWALLOW

Dottorato di ricerca in Storia d'Europa: società, politica, istituzioni (XIX - XX secolo) ; La ricerca realizzata ha inteso studiare, in un'ottica di lungo periodo e in una prospettiva complessiva, ciò che ha rappresentato l'esperienza del fascismo in un contesto territoriale periferico e non omogeneo, di cui è espressione quel segmento dell'Umbria meridionale costituito in provincia nel gennaio 1927. Tale area si è rivelata un case study esemplare, in grado di offrire interessanti spunti interpretativi. In effetti, all'unico grande polo industriale della provincia, compreso nel territorio della conca ternana, si contrappone la restante parte del territorio provinciale, comprendente città come Orvieto e Amelia, contrassegnate da consolidate relazioni con le regioni limitrofe, espressione di un'Umbria verde, agricola e mezzadrile, ma anche francescana, terra d'arte, di misticismo, ritenuta dalla pubblicistica di regime "cuore" dell'Italia fascista. A partire da ciò, si è creduto opportuno impostare la ricerca attorno a tre questioni principali, ritenute essenziali per cogliere aspetti e dinamiche della società locale nel ventennio mussoliniano. Per fare questo è stata definita una griglia interpretativa funzionale a verificare il ruolo del Pnf nel quadro del rapporto centro-periferia, continuità-rottura. Si è così puntato a esaminare come il fascismo abbia influito sui processi di formazione e consolidamento dei ceti dirigenti locali, verificandone la capacità di rapportarsi con le vecchie élites, di promuoverne di nuove o, magari, di fare coesistere entrambe. Si è poi cercato di approfondire il ruolo che il partito ha svolto in ambito locale, la sua capacità di inserirsi nelle diverse dinamiche territoriali, di creare e controllare reti clientelari e, soprattutto, di rapportarsi con le due realtà che rimangono fuori dal suo controllo, il grande gruppo polisettoriale rappresentato dalla "Terni" polisettoriale di Bocciardo e la Chiesa locale, il tutto al fine di conseguire i propri obiettivi totalitari. Infine, si è affrontata la questione del consenso. In questo senso, è stato preso in considerazione non soltanto il ruolo della violenza attuata dal fascismo per conquistare il potere e la stessa azione repressiva dispiegatasi negli anni del regime, che si dimostra concreta e reale come è normale in una situazione di dittatura, ma si è provato a fare luce sul dissenso e sulle aree di rassegnazione o di consenso tiepido che sembrano persistere nella società locale. Nel procedere si è poi cercato di coniugare la storia politicoistituzionale con quella sociale e in parte economica, attraverso un costante lavoro di analisi e incrocio delle fonti studiate, scelta ritenuta utile per conseguire gli obiettivi prefissati. Certamente, la riflessione sulle origini, l'affermazione, il consolidamento del fascismo in provincia di Terni, offre sostanziali conferme a quanto una parte della storiografia aveva proposto. Nell'Umbria meridionale il fascismo, nei suoi vertici, sorge e si afferma come punto d'incontro dei ceti dominanti tradizionali. Esso si afferma in quanto strumento della reazione agraria e dei gruppi industriali monopolistici di 2 fronte alla conflittualità contadina e operaia e al dilagare del socialismo. La sconfitta delle élites politiche tradizionali alle elezioni politiche del 1919 e a quelle amministrative del 1920, che seguiva l'effervescenza sociale del biennio rosso; la stipula del patto colonico del 1920 sfavorevole per gli agrari; la stessa esperienza, sebbene breve e contraddittoria, dell'occupazione delle fabbriche, sullo sfondo di una situazione economica difficile, ne determina la reazione, che si concretizza per l'appunto nell'adesione al fascismo. Dapprima nella versione squadrista, capace di sconfiggere sul piano militare gli oppositori, anche grazie al diffuso sostegno degli apparati di sicurezza dello Stato, quindi come blocco elettorale e nuova struttura politica in grado di conquistare il potere, il fascismo si configura come una sorta di union sacrée contro il "bolscevismo", in cui confluiscono conservatorismo agrario ma anche impulsi industrialisti e modernizzatori. Più concretamente, esso viene accorpando tutte quelle correnti politiche, contrapposte tra loro nel primo quindicennio del secolo, che avevano costituito il frastagliato universo giolittiano. In questo senso, come l'analisi dei vertici del Pnf provinciale e degli amministratori locali ha permesso di verificare, sino al 1927 a essere protagonisti sulla scena politica locale sono le forze che tradizionalmente facevano parte del blocco agrario. In primo luogo i proprietari terrieri, molti dei quali appartenenti alla nobiltà, a cui si affiancano esponenti della borghesia delle professioni, le cui proprietà erano cresciute a cavallo tra Ottocento e Novecento, nonché alcuni settori espressione diretta del mondo rurale, come gli agenti di campagna, i fattori, ma anche quei contadini che nei primi anni venti erano riusciti ad accedere alla proprietà della terra. In provincia di Terni quindi, dalla conquista fascista sino all'introduzione della riforma podestarile ma, in gran parte, anche dopo, la presenza ai vertici delle amministrazioni municipali e di quella provinciale di esponenti del notabilato locale, essenzialmente aristocratici, proprietari terrieri, professionisti, si rivela dato costante che permette di accomunare la provincia di Terni a realtà come la Toscana, l'Emilia-Romagna e, anche, a parte dell'Italia meridionale. L'attuazione della riforma podestarile, con le prerogative concesse al prefetto nella nomina dei vertici delle amministrazioni comunali, non sembra variare di molto la situazione, almeno nella prima fase di attuazione della riforma. Come è emerso nei comuni della provincia di Terni, il criterio seguito dai prefetti per l'individuazione dei podestà era connesso con la rilevanza sociale ed economica riconosciuta in una comunità ai candidati alla carica che, senza dubbio, un titolo nobiliare e una professione adeguata erano in grado di assicurare, anche magari a scapito della mancanza di qualche requisito previsto dalla legge istitutiva della riforma podestarile. In questo senso, sembra dunque perpetuarsi un modello burocratico e ottimatizio insieme, grazie al quale il fascismo intendeva presentarsi alle comunità locali con un volto rassicurante, al fine di accattivarsi il favore della popolazione. L'analisi prosopografica dei profili relativi a presidi, consultori provinciali, podestà, membri delle consulte municipali, per il periodo 1926-1943, ha reso possibile definire un quadro che vede sostanzialmente confermata l'analisi fatta in una prospettiva nazionale da Luca Baldissara ormai più di una decina di anni 3 fa1. E' cosi emerso il carattere di classe della rappresentanza politico-amministrativa fascista in questi anni, sebbene con alcune differenze effetto delle specificità socioeconomiche caratterizzanti l'area esaminata. Nello specifico, l'esame condotto sul corpus di 147 amministratori (78 podestà e 69 commissari prefettizi) che si succedono nei Comuni della provincia nell'arco di tempo considerato, ha permesso di tracciare l'identikit di un funzionario con un'età compresa tra i quaranta e i cinquanta anni; in possesso di un titolo di studio elevato (laurea o diploma di scuola superiore); in cui la proprietà della terra riveste un ruolo essenziale, coerentemente al tessuto socio-economico prevalente in provincia, e in cui dal punto di vista della professione esercitata appare predominante la figura del libero professionista (in genere avvocato e notaio). Forte è poi il legame dei podestà con il Pnf, più della metà del campione individuato risulta nel partito dal biennio 1920-1922; al tempo stesso, la maggioranza delle designazioni effettuate dai prefetti avviene in accordo con la federazione provinciale fascista. Sembra quindi delinearsi un quadro d'assieme che nel corso degli anni trenta, in gran parte della provincia, vede la predominanza delle gerarchie notabilari nella gestione del potere locale. Da tale situazione si discosta in parte l'area industriale compresa tra Terni e Narni, in cui come avviene in altri contesti urbani o regionali, attraverso il Pnf si assiste all'ascesa di personalità espressione della media e piccola borghesia urbana, per i quali l'istituto podestarile diventa uno strumento di promozione sociale e di affermazione nella gerarchia del potere locale. L'immagine del governo locale che si profila non è però statica, appare invece dinamica e contrassegnata da una forte conflittualità che, a vari livelli, si dimostra uno dei tratti comuni percepibili sotto l'apparente pacificazione realizzata dal fascismo. La forte instabilità presente nelle amministrazioni comunali della provincia di Terni, attestata dall'elevato numero di commissari prefettizi e di podestà retribuiti che si succedono, è testimonianza non solo delle difficoltà incontrate dai prefetti nella selezione di un ceto dirigente adeguato ma, soprattutto, del tentativo delle élites tradizionali, attraversate da interessi diversi e relazioni clientelari e familiari molteplici, di resistere all'azione omologatrice del regime. Indubbiamente, lo Stato fascista, attraverso la promozione di un modello di podestà fondato su competenza, capacità di agire, allineamento alle direttive dei vertici, in nome della proclamata modernizzazione puntava a ricondurre le periferie sotto il controllo del centro. Ecco allora che la ricerca di una concreta azione di governo delle amministrazioni locali, frequentemente sollecitata dal prefetto, da perseguire, ad esempio, attraverso la realizzazione di opere pubbliche funzionali alla mobilitazione di settori diversi della società, diventava il riferimento attraverso cui misurare l'efficienza e, soprattutto, "l'operosità" degli amministratori locali. L'elevato turnover dei podestà rappresenta pertanto una spia che si presta a misurare significativamente le difficoltà incontrate dal regime nell'affermare la propria azione in periferia. Non di rado tuttavia l'intervento del prefetto sui podestà si rendeva necessario per stroncare le lotte intestine e di fazione che si scatenavano all'interno delle élites locali per la gestione del potere. Le modalità attraverso cui tali scontri si manifestano sembrano esprimere dinamiche del conflitto omogenee a quanto accertato da altri studi 1 Luca Baldissara, Tecnica e politica nell'amministrazione. Saggio sulle culture amministrative e di governo municipale fra anni Trenta e Cinquanta, Il Mulino, Bologna 1998. 4 riguardanti realtà comunali, provinciali e regionali diverse. Esse assumono la forma di lettere, esposti, denunzie anonime, che divengono lo strumento di lotta principale tra le fazioni in una dimensione comunale ma, come è stato accertato in chiave provinciale, anche tra i rappresentanti dei diversi poteri locali, oltre che all'interno degli stessi vertici della federazione fascista ternana. A partire dal 1927, con la nascita della Provincia e l'insediamento di istituzioni politiche e amministrative nella città capoluogo, anche per il fascismo locale inizia una fase nuova, l'esame della quale ha permesso di meglio comprendere come in questa realtà si viene definendo il rapporto con il centro. La genesi della nuova entità territoriale è frutto di una serie di variabili legate, da un lato, alle esigenze politiche amministrative dello Stato fascista divenuto regime; a cui si sovrappongono le dinamiche conflittuali interne al fascismo regionale, che portano alla pacificazione dello stesso e alla nascita della federazione provinciale del Pnf. Infine, un ruolo determinante lo ha l'affermazione della "Terni" polisettoriale, vero e proprio potere forte nella nuova provincia, in grado di dare vita a un originale sistema di fabbrica a metà strada tra paternalismo assistenziale e truck-system. Con essa il regime dialoga direttamente, baypassando la neonata federazione provinciale del Pnf e, se necessario, intervenendo per normalizzarla, come dimostra esemplarmente la vicenda politica e personale di Elia Rossi Passavanti, primo federale e podestà di Terni. In questo senso, la ricostruzione dei percorsi personali e professionali dei vertici dell'amministrazione statale (prefetti e questori), degli organi politici (federali, vicefederali, segretari amministrativi, componenti del Direttorio della federazione fascista) ed economici (membri del consiglio provinciale dell'economia, di quello delle corporazioni e del principale istituto bancario del capoluogo), è stata preziosa per le riflessioni che permette di realizzare rispetto al ruolo avuto dal Pnf in provincia e, specialmente, alle dinamiche politiche che si innescano nei rapporti che il partito instaura con le altre autorità, a cominciare da quella prefettizia. Proprio con riferimento ai prefetti, si è potuto osservare che sui nove che si succedono in provincia di Terni nel periodo considerato, ben sei provengono dal Pnf. Tale fatto non sottende necessariamente un'automatica collaborazione con la federazione fascista, quanto piuttosto sembra rispondere all'esigenza del centro di superare i contrasti esistenti tra la federazione fascista e la prefettura che, invece, è situazione ricorrente in provincia. Nel contempo, il succedersi di dodici federali alla guida del partito è prova di una significativa instabilità, dato peraltro ulteriormente confermato dalla netta prevalenza di personalità estranee all'ambiente locale, ben nove. Questo fatto non esprime solo una certa debolezza del fascismo locale, incapace di fornire un ceto dirigente adeguato, ma dimostra la stessa evoluzione che subisce la figura del segretario federale, nei termini di una spiccata professionalizzazione inquadrabile nel più generale contesto di crescente burocratizzazione del Pnf funzionale a consolidarne il ruolo di mediazione e di intervento nell'amministrazione dello Stato, che si rivela uno dei tratti tipici del Pnf staraciano. In questo senso, le guerre che si scatenano tra prefetto e federale nel corso degli anni trenta, ad esempio per la questione delle nomine dei podestà, in cui ruolo determinante lo acquista ancora una volta l'arma dell'esposto e della lettera anonima, attestano il tentativo portato avanti dal partito di far sentire il proprio peso al fine se non di sovrapporsi, quanto meno di affiancare lo Stato in periferia. Affiora così quella di5 mensione policratica che si configura come uno degli elementi caratterizzanti la politica in periferia negli anni del regime. Nonostante i contrasti che si scatenano tra i poteri, le lotte intestine all'interno del Pnf, la cronica debolezza dimostrata dai ceti dirigenti, la federazione provinciale fascista nel corso degli anni trenta riesce comunque a essere vitale e in grado di esercitare il proprio ruolo ai fini della fascistizzazione della società locale. D'altra parte, ai vertici del partito se si escludono i federali e i loro più stretti collaboratori, le restanti cariche continuano a essere gestite in larga parte dal medesimo nucleo originario fascista, fatto di appartenenti al ceto agrario e alla borghesia delle professioni provenienti, per la maggior parte, dall'area ternana. Ciò attesta lo scarso ricambio generazionale esistente all'interno della federazione, ma anche il peso politico ed economico ricoperto dal capoluogo rispetto all'intera provincia. Questi dirigenti fanno parte dei diversi Direttori federali che si succedono e, talvolta, ricoprono contemporaneamente, laddove la legislazione lo consente, incarichi in organismi quali il Consiglio provinciale dell'economia o, anche, alla guida della principale banca locale. Ai vertici del partito il peso degli appartenenti a settori della piccola borghesia e del ceto operaio è invece minore. Soltanto con l'approssimarsi del secondo conflitto mondiale, si fanno strada figure espressione del ceto impiegatizio, ma anche tecnici e qualche sindacalista con alle spalle una carriera nell'apparato burocratico della federazione provinciale, i quali assumono incarichi di un certo peso, come quello di segretario amministrativo o di componente del Direttorio. In questo modo sembra prefigurarsi, sebbene in maniera timida e non paragonabile a quanto accade in altre province, l'affermazione «dal basso e dalle periferie [di] una nuova classe dirigente del regime totalitario»2. Nel corso degli anni trenta dunque, sebbene tra molteplici difficoltà di natura anche economica, il Pnf riesce a dare vita in provincia a una struttura organizzativa in grado di penetrare e inquadrare la società locale. Peraltro, l'afflusso costante di contributi concessi da enti pubblici diversi (amministrazioni provinciali, comunali, Consiglio provinciale dell'economia) e soggetti privati (la Società "Terni" in primo luogo, ma anche altre aziende) a un partito alla continua ricerca di risorse, che la documentazione amministrativa della federazione ternana ha permesso di verificare, rappresenta testimonianza esemplare degli sforzi profusi dal regime per rendere il Pnf un volano di sviluppo del peculiare welfare funzionale alla fascistizzazione della società locale. In questa prospettiva, il rapporto con la Società "Terni" si è rivelato una chiave di lettura che non è possibile trascurare se si vuole comprendere la natura dell'esperienza fascista in provincia di Terni. Si è visto che la stessa nascita della nuova Provincia è connessa alla questione del controllo delle acque del sistema Nera-Velino, presupposto essenziale per la creazione dell'impresa polisettoriale; così come la stipula della convenzione tra il Comune di Terni e la società guidata da Bocciardo, sanziona di fatto in maniera prepotente la forza non solo della grande azienda, ma l'affermazione dello stesso "centro" sulla "periferia". Da quel momento e anche dopo l'inserimento della "Terni" nel sistema delle partecipazioni statali attra- 2 Marco Palla, Il partito e le classi dirigenti, in Renato Camurri, Stefano Cavazza, Id. (a cura di), Fascismi locali, "Ricerche di Storia politica", a. X, nuova serie, dicembre 2010, 3/10, p. 296. 6 verso l'Iri, operazione che garantì allo Stato il controllo pubblico sull'azienda e sul suo assetto produttivo, la grande impresa per il fascismo ma, più in generale, per la stessa società locale diventa emblematicamente una madre-matrigna. Essa viene percepita come un complesso capitalistico che invade la città e, con i suoi vertici, in grado di dialogare con il centro e, anche, direttamente con il duce, si pone rispetto al Pnf locale in una situazione super partes. Non è così casuale che i federali presentino come risultato della loro azione politica i buoni rapporti che riescono a intrattenere con i vertici aziendali, i quali peraltro si dimostrano costantemente impermeabili all'influenza della federazione fascista. D'altra parte, a partire dalla stipula della convenzione del 1927 e per tutto il decennio successivo la "Terni", insieme al partito, appare senza alcun dubbio uno dei pilastri del regime in provincia. Non soltanto sostiene la federazione provinciale con contributi costanti, essenziali per assicurargli la possibilità di svolgere la propria azione sul territorio; ma, più in generale, con tutto il suo peso di grande gruppo polisettoriale sposa in pieno le politiche economiche, sindacali, sociali del regime, garantendo allo stesso le condizioni per affermare «un sistema di aggregazione/costruzione del consenso/controllo sociale e politico che si adegua al modello del regime reazionario di massa»3. In queste dinamiche si inserisce anche, per quanto è stato possibile accertare in relazione alle fonti disponibili, l'atteggiamento tenuto dalla Chiesa cattolica locale nei riguardi del fascismo. L'analisi condotta con riferimento specifico alla diocesi di Terni-Narni e al vescovo Cesare Boccoleri che la guida nel Ventennio fascista, ha permesso di accertare che, come succede in altre diocesi italiane e coerentemente con le scelte fatte dai vertici vaticani, la Chiesa ternana sembra tenere una posizione di sostanziale appoggio al fascismo e di collaborazione con il Pnf. Ciò emerge in maniera evidente in alcuni momenti: ad esempio, in occasione delle campagne promosse dal regime sul terreno economico e sociale, come per la Battaglia del grano e, soprattutto, dopo la stipula del Concordato, o nel corso della guerra d'Etiopia e di Spagna. Al tempo stesso, anche quando si hanno tensioni nei rapporti tra Stato e Chiesa (per effetto della crisi del 1931 sulle prerogative dell'Azione cattolica o in occasione dell'introduzione delle leggi razziali), le conseguenze concrete per la Chiesa locale sono di scarso rilievo e, comunque, tali da non incidere sostanzialmente sulla natura dei rapporti esistenti con la federazione fascista. Anche la Chiesa locale quindi, sebbene con l'obiettivo di preservare e, per quanto possibile, incrementare la presenza cattolica nella società locale, contribuisce nella sostanza a consolidare e, anche, ampliare il consenso al regime. In particolare, essa si dimostra attiva nel favorire, specialmente nelle aree rurali, quell'azione di «modernizzazione politica» di natura reazionaria, conseguenza del tentativo di organizzazione della società italiana secondo criteri gerarchici e accentratori, che il fascismo è impegnato a portare avanti in periferia. Certamente, un ruolo essenziale ai fini della creazione e, soprattutto, del mantenimento del consenso lo esercita anche la costante opera di vigilanza e repressione di ogni forma di dissenso organizzato e di attività politica di opposizione, che si attua in provincia per opera degli apparati di sicurezza dello Stato fascista. Tale azione si rivela particolarmente efficace se negli anni del regime solo i comunisti, essenzial- 3 Renato Covino, L'invenzione di una regione, Quattroemme, Perugia 1995, p. 58. 7 mente nell'area industriale ternana, riescono a mantenere in vita, per quanto a fatica e in misura ridotta, una forma di opposizione organizzata. E tuttavia, il fatto che continuamente le autorità, sebbene nell'ambito del riconoscimento di quanto fatto dalle diverse organizzazioni del partito a favore del ceto operaio, lamentassero l'inadeguato grado di "comprensione fascista", quando non la scarsa fascistizzazione dei lavoratori delle industrie ternane e la loro "pericolosità" politica, sembra essere la conferma implicita di come in provincia, non solo non scompare l'insofferenza e il dissenso, anche politicamente organizzato, ma, più in generale, sotto la camicia nera, a prescindere dalla propaganda e dall'attività delle differenti istituzioni del regime, non vengono meno nemmeno gli interessi molteplici che contrassegnano la società locale e le diverse realtà presenti sul territorio. In ultima analisi, il fascismo locale appare in grado di esercitare un ruolo attivo nel disegno di fascistizzazione della società, coerentemente con l'accelerazione nel processo di creazione dello Stato totalitario di cui è strumento il Pnf staraciano. Il partito si rivela dunque un vero e proprio centro di potere, espressione di un regime autoritario e tendenzialmente totalitario, con cui, inevitabilmente, tutti i cittadini si trovano a confrontarsi per le necessità della vita quotidiana: in altre parole, a dover essere, almeno una volta nella vita, fascisti. ; This research project is an in-depth study, in a comprehensive and long-term perspective, of what Fascism represented at a local level in a peripheral and non-homogeneous context, as in the case of the Southern Umbria areas, established as an administrative province in 1927. This specific geographical district flagged-up all the prerequisites for an exemplary case study, featuring several significant explanatory points. To this unique large provincial administrative industrial hub located within the Terni basin, other districts, part of the same province, remained juxtaposed. Within their respective areas, these districts included towns such as Orvieto and Amelia, which had strong links with the neighbouring communities, representing the rural, agricultural and mezzadrile aspects of Umbria, land of Saint Francis of Assisi, rich in art and religious meanings, which the Fascist Regime came to proclaim officially as the "heart" of Fascist Italy. On the basis of these introductory remarks, the study focuses its scope of research on three main points, all but essential to understand fully the aspects and dynamics of the local society during the Fascist period, also referred to as the ventennio mussoliniano. An interpretative functional grid has been designed with a view to describe the role of the National Fascist Party (Nfp) within the centre-periphery and continuity-innovation relationships with the previous regime. The study seeks to investigate how Fascism exerted its influence on the establishment and process of strengthening of the local ruling ranks, attesting its ability to relate with the old dominant élites, or promote the emerging of new ones or, in addition, facilitate and support the coexistence of both. Furthermore, the research focuses on the role exerted by the Nfp at a local level, its capability to affect the various localised dynamics of power, to create and control networks of affiliates and, above all, to relate with the two main subjects which remained independent from its control, the important industrial group represented by "Terni" of Bocciardo and the local Catholic Church, with an overarching aim to achieve its totalitarian objectives. Finally, the question of popular consent has also been scrutinised. At one level, the study analyses the 2 role of fascist violence deployed to obtain power and the repressive actions carried out under the Regime, which were highly effective, as one might expect under a dictatorship. At another level, it investigates the popular dissent and the grey areas of passive acceptance and weak consent which were common among strata of the local population. Additionally, in a broader perspective, political and institutional historical analysis has been coupled with social and economic investigation, through a systematic scrutiny and cross-examination of the main sources, as a methodological approach needful to the achievement of the final outcomes of the research. Findings on the origins, development, and strengthening of Fascism within the Terni province appear to concur with the conclusions reached by previous historical research. In the Southern areas of Umbria, Fascism, at its highest level, was brought into power and successfully established by the traditional ruling classes. The establishment of Fascism was supported and facilitated by the agrarian reaction and the monopolistic industrial groups threatened by the discontent of the rural and working classes and the rapid advancement of Socialism. The political defeat of the traditional ruling élites at the 1919 general election and the 1920 local elections, which followed the social turmoil of the so-called red biennium; the agreement of the 1920 patto colonico, disadvantageous to landowners; the occupation of factories, though a brief and contradictory experience, against a background of economic difficulty, caused their reaction and prompted their acceptance and support for Fascism. Firstly, Fascism, in the form of Fascist action squads and their capability of defeating its opponents militarily, with the extensive assistance of the State security services, then as an electoral block and political force capable to achieve power, presented itself as a sort of union sacrée against the threat of Bolshevism into which various groups appear to converge: the agrarian conservatism but also industrial and more modern forces. Undoubtedly, Fascism drew together different political forces, which during the first decade of the twentieth-century had been mutually antagonistic, and segments of the complex and divided political establishment of the Giolitti era. The scrutiny of the highest levels of the local Nfp and civil servants has revealed that, at least till 1927, the main political figures belonged to those forces already part of the agrarian block. Firstly, the landowners, many of whom belonged to the local nobility, supported by members of the professional bourgeoisie, whose estates and wealth had augmented during the nineteenth- and twentieth-century, and other sectors which were the direct expression of the rural milieus, such as the rural agents, farmers, but also those peasants whom, during the first two decades of the twentieth-century, had succeeded in becoming landowners themselves. Therefore in the Terni province, from the establishment of the Fascist regime to the introduction of the office of podestà and, for some time even after, 3 the highest offices of the municipal and provincial administration were held by members of the local nobility, primarily aristocrats, landowners and professionals. This is an invariable characteristic which put the Terni province in alignment with similar situations in Tuscany, Emilia Romagna and other areas of Southern Italy. The administrative reform and the establishment of the podestà authority, together with the prerogatives of the prefectures in appointing members of the highest offices within the municipal administrations, did not radically change, at least during the early phases of the reform, established practice. A survey of the municipalities located within the Terni province, shows that the prefects in the selection process to appoint the podestà took greatly into account the candidates' social and economic status of and, without doubt, a honorific title and tenure of highly considered profession were often sufficient criteria for a candidate to be nominated even when lacking some of the prescribed requisites as outlined by the administrative reform. The Fascist regime therefore, in perpetuating a bureaucratic and grandees system, showed an intention to reassure the existing ruling élites and obtain the support of the local population. A prosopographical analysis of the biographical profiles of headmasters, members of the provincial advice bureaus, podestà, members of the municipal advisory councils, during the 1926-1943 period, has made it possible to outline a summary framework which strongly corroborates the analysis carried out at a national level by Luca Baldissarra over a decade ago.1 What has emerged from this analysis is the class-based character of the Fascist political and administrative representation during those years, though presenting various differences linked to the social and economic specificity of the area scrutinised. In more depth, the study carried out on a corpus of 147 civil servants (78 podestà and 69 prefectural officers) employed by the municipalities of the province during the examined period, made it possible to draw up a profile of the typical officer: between forty and fifty years of age; highly educated (having achieved a high-school or university degree); often a landowner, a characteristic consistent with the social and economic structure prevailing throughout the province, and among whom the status of self-employed (generally lawyer or public notary) represented the most frequent professional position held. Relations between the podestà and the Nfp appear to have been particularly close, over half of the sample identified is composed by individuals who had joined the Fascist Party at an early stage, during 1920-1922; additionally, the majority of the appointments made by the prefects were agreed in advance with the Provincial Fascist Federation. It would therefore appear that during the 1930s, in 1 Luca Baldissara, Tecnica e politica nell'amministrazione. Saggio sulle culture amministrative e di governo municipale fra anni Trenta e Cinquanta, Il Mulino, Bologna 1998. 4 large areas of the province, the highest hierarchies of grandees were the prominent figures holding local high office. The industrial area comprised within the administrative territories of the two municipalities of Terni and Narni, however, appears to contrast with other districts of the province. In this area, as for similar cases in other municipalities or other regional administrations, the Nfp supported the emergence of members of the small and medium local urban bourgeoisie, as the office of podestà became a vehicle of social advancement and an opportunity to climb up the local hierarchy of power. Despite the apparent pacification established forcibly by the Fascist regime, the dynamics of power within the local government remained characterised by extreme unrest and strong conflict at various levels. The sizeable number of prefectural commissioners and remunerated podestà who succeeded in office, often in rapid succession, bears witness to the instability which marred almost all the municipal administrations of Terni province. This is evidence of the obstacles encountered by the prefects during the selection process of a qualified managerial class but, above all, of the resistance put up by the traditional élites of power, motivated by divergent interests and loyalty to various networks of familial and personal relations, to the process of homologation pursued by the Fascist regime. Undoubtedly, the Fascist regime, in implementing a model of podestà based on competence, on the energetic ability to act, on its alignment to official directives, and in order to achieve a modernisation of the administrative system, aimed at placing the local authorities under the prescriptive control of a centralised State. The actual administrative actions implemented by the local administrative offices, frequently under the guidance and pressure of the Prefects, as for example in the case of the accomplishment of public works functional to the civil mobilisation of various segments of the local community, became a measure of their efficiency and, above all, a measurement of how industrious the local administrators should be. The high turn-over of podestà is a clear indication of how difficult it was for the Fascist regime to implement its plans of action in peripheral areas. Additionally, direct intervention by the Prefects was often necessary to put an end to rivalries and internal power struggles which frequently broke out among local élites. These clashes and their manifestations appear to be similar in their dynamics, as pointed out by previous studies, to other cases occurred in different municipalities, provinces and regions. Resorting to anonymous letters, official complaints, accusations, came to represent the instrument to attack and weaken the opposite factions at a local level, within the municipalities, but also within the provincial administration, among the various representatives of the local administration and even the highest offices of the Terni Fascist Federation. From 1927, following the establishment of the 5 Province and the set up of political and administrative authorities in Terni, now seat of local government, a new phase emerged for the local Fascist Party too. The study of this new province has facilitated the understanding of its relations with central authorities. The establishment of this new local administration was the result of various circumstances linked to the political requirements of the Fascist State following the transition to a totalitarian regime. Additionally, the internal conflict dynamics of the regional Fascist Party played an important role. These led to the inner pacification of the Party and the set up of a Nfp Provincial Federation. Finally, the establishment of "Terni" had a pivotal role too. "Società Terni" (also referred to as "La Terni") came to represent the real "strong power" of the province, capable of imposing a factory regimen based partially on paternalistic assistance and partially on a truck-system model. The Fascist regime dealt directly with "Terni", bypassing the newly-established Nfp Provincial Federation and, where necessary, intervened to impose its authority, as the political and personal vicissitudes of Elia Rossi Passavanti, the first Federal secretary and podestà of Terni, exemplified. In this perspective, drawing together personal and professional career paths of the highest officers (prefects and police commissioners), of both political (federals, deputy federals, administrative secretaries, members of the Fascist Federation Federal Bureau) and economic authorities (members of the Provincial Economic Council, members of the Provincial Corporations Council and of the main bank) has represented an invaluable study, conducive to the understanding of the Nfp's role within the province and, in addition, of the political dynamics at play among the Fascist Party and other authorities, such as the prefectures. With specific reference to the prefects, it is worth noticing that of the nine prefects in office in the Terni province during the period under scrutiny, as many as six were Nfp members. This situation, however, did not necessarily imply a spontaneous collaboration between the prefectures and the Fascist Federation, but it would appear to have been a response to the need of overcoming the conflictual antinomy between the two authorities, which was a recurrent event throughout the Terni province. In addition, the succession of twelve Federals as leaders of the Fascist Party bears witness to a pervasive instability, a fact which is also confirmed by the noticeable preference given to individuals, as many as nine, unconnected with the local milieu. This is certainly a clear manifestation of the local Fascist Party's weakness - which appeared unable to express and produce capable managerial ranks - and of the evolution of the Federal Secretary's role, becoming more and more a professional one, in the context of the remarkable bureaucratisation of the Nfp, aimed at strengthening its mediatory and interventional role on the local administration, one of the main characteristics of the Nfp 6 under the leadership of Starace. Within this framework, the contrast between the prefects and the Fascist Federal secretaries during the 1930s, with regard, as a case in point, to the appointments of the podestà, and the crucial utilisation of official complaints and anonymous letters, bears witness to the Party's attempt to impose its decisions or, at least, to influence the administration at a local level. This, in turn, resulted in a situation of polycracy, which was one of the factors denoting local politics during the Fascist regime. During the 1930s, despite deep rooted conflict among the authorities, the internal power struggles within the Nfp and the endemic ineptitudes of the ruling class, the Fascist Provincial Federation was successful in exerting and promoting the fascistisation of the local community. It is manifest that the highest authorities within the National Fascist Party, with the exception of the Federals and their closest advisors, remained the domain of the original Fascist core, composed by members of the rural class and the bourgeoisie originating primarily from the Terni area. This explains the inadequate generational change within the Fascist Federation and, in addition, the political and economic importance of the Terni area in comparison to the entire province. These political figures were part of the various Federal Bureau and, in some cases at the same time, if the law permitted, held additional offices in different institutional bodies, such as the Economic Provincial Council or were in charge of the main local bank. On the contrary, the influence exerted on the high levels of the National Fascist Party by the small bourgeoisie or by members of the working class remained negligible. It was only with the approach of the Second World War that members of the clerical class, but also technicians and a few tradeunionists already employed within the bureaucratic structure of the Provincial Federation, acquired an enhanced importance and gained access to higher office, such as administrative secretaries or members of the Federal Bureau. The Terni area too, though in a more limited way, which bears not comparison with other provinces, saw the rising «from the bottom and the periphery of a new ruling class within the totalitarian regime»2. During the 1930s therefore, despite various difficulties, including economic issues, the Nfp was successful in creating at a provincial level an organisational structure capable of influencing and organising the local community. Additionally, the regular flow of financial contributions bestowed by various public authorities (provincial administrations, municipalities, Provincial Economic Council) and private companies ("La Terni", first of all, but other businesses too) to a political party constantly seeking financial backing, as thoroughly documented by records of the Terni Fascist Federation, bears witness to the outstanding efforts the Regime made to 2 Marco Palla, Il partito e le classi dirigenti, in Renato Camurri, Stefano Cavazza, Id. (a cura di), Fascismi locali, "Ricerche di Storia politica", a. X, nuova serie, dicembre 2010, 3/10, p. 296. 7 successfully present the Nfp as a conducive mean to the development of this specific welfare model, with a view to promote the fascistisation of the local community. In this perspective, the Nfp's relation with the "Società Terni" is key to understanding the nature of the Fascist Regime and its role within the Terni province. The establishment of a Province was connected to the control of the water-system of the two rivers Nera-Velino, essential to create an industrial hub; similar reasons were behind the agreement stipulated between the Terni municipality and the Bocciardo Company, which came to sanction resolutely the importance of the Company and, additionally, the supremacy of the "centre" over the "periphery". It was from this period and following the inclusion of "Società Terni" within the system of state-controlled industries through the Institute for Industrial Reconstruction, a transaction which secured State control over the Company and its productive branches, that "La Terni" became firmly linked to Fascism and, more in general, to the local community, though in a controversial and ambivalent mutual relation. The Company was perceived as a capitalistic enterprise which took over the city, its directors being able to negotiate with the central Government directly and with the Duce himself, taking a super partes position in relation to the local Nfp. It was not a fortuitous occurrence that the Federal secretaries gauged their political influence against the effectiveness and strength of the relations they were able to maintain with the executive directors of "Società Terni", whom, on their part, appeared to be impenetrable to any influence exerted by the local Fascist Federation. Additionally, following the 1927 agreement and during the ensuing decade, "La Terni", in conjunction with the Fascist Party, appeared to become, without doubt, one of the main pillars of the province. At one level, it supported the Fascist Provincial Federation through a constant flow of financial contributions, vital to bankroll the Federation's activities within the province; but, at a more general level, asserting its influence as a large industrial group, it was capable of shaping the economic, trade-union and social policies of the Fascist regime, creating those conditions to establish «a system of aggregation/disaggregation of the social and political consensus/control conforming to the mass reactionary regime model»3. Within this dynamic interactions, and on the basis of documents available, the local Catholic Church played a significant role in relation to the Fascist Party. With reference to the specific case of the Terni-Narni dioceses and bishop Cesare Boccoleri, the Church's main leader during the Fascist ventennio, this research has showed that, as in the case of other Italian 3 Renato Covino, L'invenzione di una regione, Quattroemme, Perugia 1995, p. 58. 8 dioceses and in alignment with the decisions taken by the Vatican, the Church authorities in Terni supported the Fascist apparatus and adhered to a policy of collaboration with the Nfp. This was particularly manifest on specific occasions: for example during the economic and social campaigns promoted by the Regime, as a case in point the so-called "Battle of the wheat" and, above all, following the 1929 Concordat with the Catholic Church, or during the Ethiopian and Spanish conflicts. At the same time, even when tensions arose and marred the relations between the Fascist regime and the Catholic Church (following the 1931 crisis caused by the limitations imposed on the prerogatives of Azione Cattolica or the adoption of the 1938 racial laws), the consequences for the local Church were negligible and did not appear to affect the on-going relations with the local Fascist Federation. The local Church therefore in pursuing the aim of preserving and, wherever possible, augmenting the Church's influence on the local community, contributed to reinforce and widen consensus for the Fascist regime. More specifically, the Church's actions were particularly effective in encouraging, especially in rural areas, that precise process of "political modernisation", though reactionary at its core, based on organising the entire Italian society on hierarchical and centralising criteria, which Fascism was promoting particularly at a local level. Additionally, and without doubt, the important function to create and, above all, to maintain a high level of consensus was exerted by the pervasive surveillance and repression of any form of dissent and political opposition, enforced within the province by the Fascist security services. A repressive action which was extremely effective and, during the dictatorship, only the Communist Party, despite being hemmed in to the Terni industrial area, was able to maintain, albeit with great difficulty and in a limited way, a form of organised resistance. The fact that the Fascist authorities continuously, though recognising what had been achieved by the Party's multifarious organisations to favour and support the working classes, lamented the feeble "fascistisation" of the Terni industrial workforce and their being "politically dangerous", would appear to confirm implicitly that throughout the province the opposition and political dissent had not completely ceased. More in general, under the "black shirts", despite the propaganda and the activities of various Fascist authorities and institutions, it remained evident that the diversified interests which characterised the local society and the different realities rooted at local level persisted. Ultimately, the local Fascist Party appeared capable of exerting an active role in the "fascistisation" process of society, in alignment with the creation and implementation of a totalitarian state, being the main objective of the National Fascist Party under the leadership of Starace. The Nfp was therefore a real centre of power, expression of an authoritarian 9 regime leaning toward totalitarianism. A regime against which all citizens had to relate for their everyday life needs: that is to say, all citizens had to act, at least outwardly, as fascists.

The Mercury November. 1893 ADVERTISEMENTS. IReabing IRailroab The "Royal "Route" To thS StUd^ts oF New and Direct Line To and From QETTT5BURQ. Fast, Frequent and Superbly Equipped Train Service Between NEW YORK, PHILADELPHIA, Allentown, Pottsville, Williamsport, Reading, Harrisburg and Interior Pennsylvania Points, with through connections to and from all parts of the Middle States, New England and the West. Visitors to America's Greatest Battlefield can obtain through tickets and baggage checks, via this new and most picturesque route, at all principal stations and ticket offices throughout the country. I. A. SWEIGARD, C. G. HANCOCK, General Manager. Gen. Pass. Agt. Barber Sfy°P> CHARLES C. SEFTON, PROPRIETOR. BALTIMORE STREET. THE PLACE FOR STUDENTS TO GO. ONLY FIRST-CLASS WORK yHU$rc af]d ^ffc Qoris^Vatopy. Chartered 1850, offers Classic, Normal, Music and Art courses for Diploma and Degrees ; comprises three large brick buildings, situated on a beautiful eminence, a lovely campus, library, apparatus, hot and cold mountain water, steam heat, gas light, electric bells, a suite of rooms nicely furnished for every two or three students, music lessons on Pipe Organ, Reed Organ, Piano, Violin, Guitar, Mandolin, Banjo, and Cornet. Lessons in Drawing, Crayoning, Pastel, China and Oil Painting. German and French languages taught and spoken. Special attention paid to Elocution and Voice Culture. Normal course with Diploma for teaching. Strict attention given to Physical, Social, and Religious culture. Kee Mar College is located in a most attractive, refined, and healthful city of 14,000 people. SEND FOR CATALOGUE AND JOURNAL TO Rev. C. L. KEEDY, A. M., M. D.F President, Hagerstown, Mdr QANDERS & OTAYMAN Beg to call attention to their splendid exhibit of the leading makes of Pianos and Organs Including the famous ESTEY ORGAN, WEBER, DECKER BROS., ESTEY, FISCHER, AND IVERS AND POND PIANOS. Also a full line of Sheet Music, Music Books, and Musical Instruments of all kinds, including Violins, Mandolins, Banjos, Guitars, Cornets, Autoharps, &c. SANDERS &. STAYMAN, 13 NORTH CHARLES ST., BALTIMORE, MD. 934 F STREET, N. W., WASHINGTON, D. C. Music Sent " On Selection." Catalogues Free. We are Sole Agents for the Wonderful "AEOLIAN," an Orchestra in Your Own Parlor, With You as Musical Director. Spalding's Livery Stable, STRATTON ST., GETTYSBURG, PA. Branch Office, E. S. Faber's Cigar Store. Hacks, Carriages, Wagonettes, Double Teams, Riding Horses, Large Wagons Capable of Holding Sixty Persons at a Time. COMPETENT GUIDES FOR THE BATTLEFIELD. CHAS. J. SPALDING, Proprietor. -#|i ll1llllllltllllll1llll"lllll'lll)llll'illHIIIIIIIIIUIIIIIH-ll'IIIIMHIIIIIIIIIIIIIIIIl;lll||||llll ((Sp- Gettysburg Carriage Works, CHAS. J. SPALDING, Proprietor. WEST MIDDLE STREET. BUILDER OF oattep§ * and ^ferp's ^upmii>hep§, TRUNKS, LEATHER GOODS, AND VALISES, 12 W. MARKET ST., YORK, PA. Special Attention to Mail Orders. H. S. Benner, Choice Family Groceries, Chambcrsburg St., Gettysburg, Pa. Coffees, Teas, Flour, Fish, and Canned Goods. Queensware, Glassware, Etc. PITZBH HOUSE. A temperance house. Pleasant and home-like. Teams and Guides to all points of interest on the battle-field. REASONABLE RATES. 127 ChambersboFg St., Gettysburg, Pa. JOHN E. PITZER. MEMBER POST 9, G. A. R. J. W. EIGHOLTZ & GO., DEALERS IN PIANOS, Or^GR^S, IWUSIC, MUSICAL* IJSlSTftTjJVIEjMTS, ST^IfiGS, Ete. 12 BALTIMORE ST., GETTYSBURG, PA. SAMUEL* FABE$, -&pine Cigars ^ Smokers' Mieles-^ CHAMBERSBURG ST., GETTYSBURG. J. H. MYERS, Fashionable Tailor, Clothier* — AND— You alcuays find the Iiatest Styles for Gents' LCJardrobes. No. 11 BALTIMORE STREET, GETTYSBURG, PA. ADVERTISEMENTS. in College prises ©octets Baboes Bbtf3e nDebals Stationery The most successful designers of College and University Badges in the Country Estimates Designs on Applieation BAILEY BANKS BIDDLE Chestnut and Twelfth Streets Philadelphia, "Pa. Mary had a Little Lamb, (Stamp jour Memory.) It's wool was all the go— We make it up in BUSINESS SUITS for S1 5.00 you know. These Custom-Made Suits are popular throughout America— because they represent the very Quintessence of Nobby Oresi, and are essential to every business man who cares one lota for economy and APPEAR-ANCE. Send us 6 cents in stamps, stating kind of gar-ment or suit desired, and we will forward you SAMPLES of Cheviots, Cassimeres, etc., Self-measurement rules and fashion plate. YOU DO THIS and we do the rest. Balti more cheapest market. KEELER the largest custorc producer. Full Dress Suits, ■ $25.00 Up. Trousers, . $4.00 Uf. Frock Suits, - • $18.00 Up Overcoats, ■ • ■ $18.00 Up. JOnN M. KEELER, S N. Calvert St. Baltimore, Hd, "Suffer no longer the extortions of local tailors Correspondence Solicited With Responsible Parties Desiring to Act as Agents. OEM'S AGME HALL (JMIEE IUfflEItt, ^ ruitrmtm 5 and 7 W. Baltimore Street, Annex 6 and 8 S. Charles St., BALTIMORE, MD. NEW SPRING STYLES Of Suits and Overcoats now ready at 20 to 30 per cent, under com-petitors' prices. Write for Samples and Price List. WILLIAM SMALL, DIM DQOR nniER AND Doon DUIDEH 6 WEST MARKET STREET, YORK, PENNA. w. s. SCHRODER, DEALER IN Hats and CaPs? Boots and ShogS? No. 6 Balto Street, Gettysburg. ADVERTISEMENTS. p. D. SCHRIVER, Draper, • • Importer, • • fl^D JVterehant Tailor, 23 Baltimore Street, GETTYSBURG, PA. The College Mercury. Vol. I. Gettysburg, Pa., November, 1893. No. 7. THE COLLEGE MERCURY, Published each month during the college year by the Students of Pennsylvania (Gettysburg) College. EBITO-RIAL. STAFF. Editor: JULIUS F. SEEBACH, '94. Associate Editors ; FREDH. BLOOMHARDT,'94. FRANK E. FICKINGER, '94. HENRY E. CLARE, 95. WALDO D. MAYNARD, '95. PAUL \V. KOLLER, '94. ROSCOE C. WRIGHT, '95. WJLMEK A. HARTMAN, '95. Alumni Association Editor : D. FRANK GARLAND, Baltimore, Md. Business Manager : BENJAMIN R. LANTZ, '94. Assistant Business Manager : CHARLES F. KLOSS, '94. rr f One volume (ten months), . . . . $1.00 lERMS:i Single copies, 15 Payable in Advance. All Students are requested to hand us matter for publication. The Alumni and ex-members of the College will favor us by send-ing information concerning their whereabouts, or any items they may think would be interesting for publication. All subscriptions and business matters should be addressed to the Husiness Manager. Matter intended for publication should be addressed to the Editor. Address, THE COLLEGE MERCURY, Gettysburg, Pa. CO/N TENTS. EDITORIALS, . 107 THE MOST PRECIOUS THING IN THE WORLD, . . . log COLLEGE LOCALS, no ALUMNI, 114 FRATERNITY NOTES, . 116 ATHLETICS, 117 TOWN AND SEMINARY, 120 LITERARY SOCIETIES, .,,,.,.,.,,. 12.1 ]\I EVER in the history of the institution has * there been as much enthusiasm displayed in athletics as this year. From the very be-ginning the interest has never once flagged, and each struggle of our foot-ball team with its rivals has but strengthened the feeling. But, notwithstanding this encouraging feature, there have been serious drawbacks to the highest development of athletics, especially this season, and the blame lies on the students in general. First in order stands the lack of an athletic field. We have been expecting material aid from some of the patrons of the college, and rightly; but there is no need of looking for the consummation of our wishes until we apply ourselves actively and individually to the task. Such an effort was to be made last year, and all the members of the Athletic Association were asked to canvass, but the plan fell through. Whose fault was it ? Next in order stands the throat enthusi-asm of many that makes them utterly oblivious of the fact that they have pocket-books. This was noticeable at the home game with F. and M. If there is one thing sure, it is that foot-ball cannot be carried on by faith and noise. Money is needed, especially the money of those who forget to pay. Self-respect, if not love for their college, should prevent such action on the part of those to whom this applies. The third hindrance is the lack of system in the business methods of the Associa-tion and the committees in charge of the finances. This is not a fault peculiar to our-selves or to athletics alone. To judge from the various comments of exchanges, it is general, but what we want is a remedy here. It is folly to expect the interest of athletics to ioS THE COLLEGE MERCURY. move on smoothly without careful planning, attention to details, and observance of the time set aside for the business meetings of the Association. Let there be more interest taken in these things. Personal, individual responsi-bility has been the lack so far—let it be so no more. THERE has been much said at different times to the effect that the future success of our college depended on better equipment and a more diversified course of study. It is true that, in these times of progress, the col-lege with the greatest number of courses, the most complete departments, and the largest corps of instructors forges ahead of her rivals in a material sense, but such advancement does not always measure the success of an in-stitution. While all these things are necessary, and must be kept up to the highest notch of efficiency, there is another, still more neces-sary, that touches the student-body more nearly. The equipment may be never so per-fect, but, if there is lack of earnest application on the part of the students, its full efficiency is lost. What is needed then is a greater sense of obligation, for present opportunity is very present duty, and duty neglected is a debt un-paid, an account dishonored. It speaks ill for the morality of the young man whose parents keep him at college, laboring under the fond delusion that he will be an honor to them, to find him scattering their money and hopes like so much sand. That young man is common enough, but he is a credit to no one and a bane' to his college. The fewer there are of such creatures within college walls the better, and the more we strive to prevent the increase of such an clement here the brighter will grow the fame of our Alma Mater. It is worth the effort, for in its wake will follow the full regard of our superiors, with that will come sclf-respect, and after these will come, as a neces-sary consequence, that much to be desired state af affairs — student self-government! j Can we not push the venture to a glorious end ? if * p\0 we not want a well-organized Press Association here ? It would add greatly to the name of our Alma Mater, and help us to bring her more prominently before the public. There were the beginnings of one last year, and its work was very encouraging, but the time has come for thorough and permanent organization. By it the various influential dailies and weeklies can be brought to publish accurate news of our doings, and thus many misconceptions be removed from the public mind. It is well known how our news is ac-credited to other colleges of almost similar name. Let a number of the students organize themselves, correspond with the city and their \ county papers, and thus rouse an interest in their own college in all parts of the State that will never die, but keep on increasing. Who- ; ever will take the initiative will surely succeed and his shadow will never grow less. * * * IN a late issue of The Wittcnberger appeared I the following resolutions passed by the Faculty, together with an expression of the appreciation of the students under its training: Resolved, That, during this college year, examinations be dispensed with, with the proviso that any student who fails , to reach a grade of 80 per cent, will be required to take ex-aminations ; andprovidedfurther, That absences which arc I not made up, and failures to recite, shall seriously detract from the term grade. Resolved, That this action shall not interfere with the right of a professor to give any class a test at any time. The editors of THE MERCURY feel sure that they voice the sentiments of the students in asking the Faculty to consider this action with I a view to adopting something similar. Vari-ous plans of this kind have been tried at many of our larger institutions with great success, and, if there is any good thing in the educa-tional line, we do not want to fail to lay hands on it and " hold fast." Under the present sys-tem, with a large class of the students, little THE COLLEGE MERCURY. 109 study is done until the close of the term. The other system will offer an incentive. May we not expect some definite action ? THE MOST PRECIOUS THING IN THE WORLD. '""TIME," Webster says, " is a particular part of duration, whether past, present, or future." This is manifestly true ; but what is the significance of " duration " here ? Turning the leaves of the dictionary we find this : " Duration ; continuance in time." Now we are back to our starting point, and have de-scribed a circle, the emblem of eternity. Evi-dently, even Webster found it a hard task to define time. We all know what it means, but have difficulty in expressing ourselves. This subtle thing that so resists all definition has a peculiar property of increasing in worth as it is used wisely; time, improved, so en-riches the possessor that all succeeding time will bring him more for its exchange. It is equally true, that time, misused, is continually falling in value, until, at last, it is exchanged at a rate much below par. Time is commonly divided into past, present, and future; but the mystic line that separates one from the other is hard to determine. Even while we say, " This is the present," it joins the past and the future takes its place. Noise-lessly, often without observation, the great j changes are made. " Still on it creeps, each | little moment at another's heels." Sometimes it passes with the speed of electricity; again, . every moment seems burdened with a weight of lead. Not only our conditions, but our characters affect the passage of time. " Time-travels in divers paces with divers persons." The past is constantly growing, and increas-ing in value. We can learn lessons from its mistakes and trials, its successes and joys. 1 But we must bear in mind that it is gone for-ever and past all recall; therefore, let it bury its dead. The future, though indefinite and intangible, ' has a special charm. It is so delightful to dream of what may come to pass in that far, sweet sometime. But day dreams, though be-witching, do not count for much in this matter-of- fact world; and, for every-day practice, " The Future is to be made, and the Present is the time to make it." We are selfish creatures, and use everything for the gain we imagine it secures. If pos-sible, we mean to gain something every day. The intention may be almost unsuspected in ourselves, but it is there, nevertheless. We constantly have a choice of many things in exchange for our time, and we take what we consider the most valuable. This is not say-ing that we always choose the best. Often our judgment is at fault; sometimes we are perverse and look no farther than present • good. This idea of choosing the best is im-portant. We cannot have all things; there-fore, we do well, if we think carefully, and then take only the best and greatest. At times we are so placed that there is little choice. Only one way is open, and we are obliged to do our unpleasant tasks, day after day. The only choice then is between fretting for what is withheld out of God's wise care for us, and patient doing whatever He gives. The drudgery that duty requires, when cheerfully done, has its own reward in the way of a special blessing. Time is used, misused, and not used. One who does not use his time is like a miser, keeping his gold hidden in a chest, and not allowing a starving beggar even a peep at its yellow brightness. He who misuses his time may be compared to a spendthrift, thinking only of the present, and regardless of the morrow. But the one who uses time is like an economical man, who buys only what he really wants, and always remembers that " A penny saved is two-pence earned." Some people, while meaning to use their time well, manage to waste a great deal of it. There is such a thing as economy of time, and it is just as important as Political Econ- no THE COLLEGE MERCURY. Dili}-. It is a sad thing to waste time, for it never, never comes back again. Surely, time is the most precious as well as the most slippery thing in the world. It is valuable, for everything that any one ever has is received in exchange for time. It is " legal tender " for knowledge, pleasure, money; for crimes, heart-aches, and tears. Some set a higher price on it than others; we know this by the different methods people have of spend-ing their days. Unlike many precious things, it is not amount, but use, that makes us rich in this treasure. " Part with it as with money, sparing; pay- No moment, lint in purchase of its worth; And what it's worth, ask death-beds; they can tell." The fact that different ones place different values upon their time is illustrated every-where, but perhaps most forcibly among a body of students. The four years of a college course are a blessing that few possess. Some of the favored few treat it in a way that at last can bring nothing but regret; some carelessly, just letting the days drift on, and some, wisely, as a sacred opportunity. There are the stud-ents who go to college because they are sent, and who are sent because something must be done with them. Perhaps they remain four years and then go home, with what? Has there been gain in knowledge? Has there been development, physical, mental, or moral ? Has some weaker brother been helped to re-sist temptation ? No. It would be better for all the rest of the students if that one had never come to them. Then there are students who study when they feel like it; who go to recitation unprepared, or worse still, prepared in a way that gives no benefit, if that suits them better; who please themselves and do not worry over anything, not even duty. Others go to the opposite extreme and study continually, forgetting that college life offers lessons which are not in books and can be learned only by personal contact with their fellows. But there are a few who are awake to ah opportunities. They not only study with their might, but take an inter-est in athletics, the work of the literary socie-ties, and, above all, each other. There is no telling what ideas revolve in your neighbor's brain until you interest yourself in him; then you may be surprised to find that he needs just you, with your help and sympathy. It is not best to work always. No one can work all the time, but some mistaken people are foolish enough to try. There is a vast difference between wasting time and playing. One of the best uses to which time can be put is to simply and heartily have a " good time," and it is not well to make the " good times " so few that we forget how to enjoy them. Every one who is living has time. It is a precious possession, and is given to us for a purpose. What is this purpose? Can it be that because of wrong doings in a former ex-istence we are given a chance for improvement here? Are these days of grace? Or is it because we have tried- to do our poor little best somewhere else that we are given this happy world in which to do better and to help others on ? Ah! there is the secret; if we only help some one else, though it be but a little, our time is well spent. God only knows why time is given to us; sometime we may learn. " Look not mournfully into the Past, it comes not back again ; wisely improve the Present, it is thine; go forth to meet the shadowy Future without fear and with a manly heart." E. M. L, '96. COLLEGE LOCALS. FRED H. BLOOMHARDT and WILMER A. HARTMAN, Editors. THE month of October usually brings with it some occasion which lingers long in the memory of the Gettysburg student. A few years ago, Comte de Paris and the sur-viving generals of the battle held a reception in Brua Chapel. Last year the " Corn Ex-change Regiment " visited the college in a body. None the less enjoyable was the re-ception tendered to the Columbia Club, of THE COLLEGE MERCURY. 111 Philadelphia, in Philo. Hall, October 7th. As the distinguished party reached the " Tiber," the campus became aglow with fire-works, while the welcome of the boys, ex-pressed by their " yells," nearly drowned the music of the Grand Army Band. Mr. Harry Olewine, '97, of Hazelton, opened the programme with a piano solo. President McKnight, in a very pleasant address, spoke the words of welcome. Mr. C. O. Shaar, '96, of Steelton, then sang a solo, after which Mr. W. H. Sellheim, '94, of Philadelphia, for the students, presented to Mrs. John Wiseman, who donated the splendid Howard clock in the tower of Recitation Hall, a large basket of roses. Mr. R. O. Moon, of the Philadelphia Bar, responded in fitting terms to the compli-ment. Other speeches were made by Corporal J. L. Smith, Director of Public Safety A. M. Beitler, Councilman Franklin M. Harris, John E. Hanifen, Dr. Lehman, and David Watts. Director Beitler was presented with a paste-board revolver with which to arm his police-men, and Corporal Sm'th with one of "Wood-ward's " famous inkstands, to be used when he writes a new volume of the history of the " Corn Exchange Regiment." Frequent inquiries have led the editors to seek information concerning the probability of securing electric lights in college. An arc light will soon dispel the darkness on the campus, but none will be placed in the build-ings and rooms, much to the disappointment of the student body, which, if allowed to de-cide it, would, we believe, to a man declare for electric lighting. The extra expense would be borne cheerfully, for then there would be no more worry and trouble with lamps. Rumor also says that a portion of the beau-tiful new power-house will be devoted to the use of the college for a course in electricity, but nothing authentic can be obtained about it. The lecture course committee of the Y. M. C. A. has been extremely fortunate in securing the " Ollie Torbett Concert Co." for October 31st. This company, it will be remembered, gave a concert here last December. In addi-tion to the Swedish Sextette, the company consists of Miss Ollie Torbett, the violinist, and Mr. Moquist, the pianist. The programme, we understand, will be given entirely in Eng-lish, or nearly so, if desired. The popular prices, 50 and 35 cents, will be charged. Every person who can do so should embrace this opportunity of hearing one of the most famous concert companies be-fore the American public to-day. We trust that they will be greeted with even a larger audience than last year. The final selection of members for the Glee Club was made on Thursday, October 19th. They have all been assigned to their respective places, and regular practice is the rule they have promised to observe. The following is the list as it stands: First Tenors. W. H. NICHOLAS, J. C. NICHOLAS, C. G. BIKLK, N. S. HEINDEL, I-'. E. FlCKINGER, W. B. DUTTF.RA, M. J. KLINE, ~\. C. BOWERS, J. W. OTT, C. J. STEI'HENSON. Second Tenors. C. NICHOLAS, W. O. IUACII. First Bass. W. A. KUMP, A. C. CARTY. Second Bass. H. R. SMITH, D. E. RUE, E. GAIil I . W. H. Nicholas has been elected leader of the Glee Club. Already the members have made great strides forward under his efficient leadership, and we are1 assured that this year's work will surpass last year's in many ways. We may congratulate ourselves on this bright outlook. Another addition has been made to the Guitar Club in the person of Stable, '97. All of the clubs are now filled. The opening concert of the season will be given November 24th, in Brua Chapel. By a notice on the bulletin-board we learn that the Prohibitionists of College are to have a preliminary oratorical contest preparatory to a grand final with the choice speakers of the various colleges of the State. Let all take part, and may the best one be chosen to rep-resent our own " Gettysburg." The Literary Society of the Preparatory Department has taken measures to establish a reading-room and library in the near future. This is a step in the right direction, and one that cannot be commended too highly. On Thursday evening, October 5th, Rev. W. E. Main, Teacher of Elocution, of Hagers- ti2 THE COLLEGE MERCURY. town, gave a free lecture on " The Chained Giant, How to Release Him." There was a fair-sized audience in Brua Chapel, which listened attentively to the many excellent points brought out by the speaker. Mr. Main desires to form a class in college, which should be largely attended. We are pleased to see the boys' old friend and janitor, Mr. Gwinn, again on the campus, after a severe attack "of malarial fever. Mr. Harlan E. Glazier, of Dryden, N. Y., formerly of Union College, is the latest acquisition to the Sophomore Class. Dr. Bikle attended the sessions of the Maryland Synod, at Baltimore, a short time ago. Miss Anna C. Karcher, of Germantown, and Miss Mary H. Cruwys, of Bryn Mawr, will be guests at the home of Dr. and Mrs. H. B. Nixon for several.months. Our campus is a favored spot. Dr. Breidenbaugh and Rev. L. S. Black-were enthusiastic spectators of the Dickinson- Gettysburg foot-ball game, while attending Synod at Carlisle. Dr. Day, of Africa, conducted Chapel exer-cises, Monday, October 9th. After these exercises an opportunity was given for asking questions concerning his work, which was fully used by the students. Mr. B. R. Lantz, '94, spent the week October 9th-16th at his home in Hagerstown, Md. He saw everything at the " great and only fair," and insists that the "Columbian Exposition of 1893 " is not in it with Hagers-town. " Matt " Kemp, the erudite manager of the observatory, wishes to announce to " all whom it may concern " that he receives visitors on Thursday night only. At a recent meeting the Class of '95 elected the following officers: President, W. A. Hart-man;' Vice-President, E. H. Wert; Secretary, J. E. Byers ; Treasurer, W. E. Apple, and Historian, F. M. Keffer. Prof. B.—" What is the meaning- of ' spor-tula'?" ' K., '95—" I think it means a picnic." " Socio" (translating "fuhr bergari wie bergufiter)—" And they rode the hill up and they rode the hill down." S., '94 (disgusted with Hardy)—" He ought to have his head rubbed before he tries to write solid analytics. Perhaps he would make it a little pla(i)ner." Prep, (translating Vergil)—" Three times—I tried to—cast—my arms about—her neck— that is as far as I got, Professor." Prof. K.—" I think that was far enough." " Sweitzer's " new instrument for measuring the moisture in the air is the " chronometer." His time in playing on his mandolin is also run by this same instrument. Dr. N. must have taken a course in poetry at Johns Hopkins besides his Ph.D. This is his latest: "And this is the force which we'll talk about later, Which piles up the water about the equator." Prof. H. to Mr. G., '94—" Mr. G.,What is a ' One-Price Store'?" Mr. G.—"A Jew store." Mr. W., '95, was engaged the other day in hunting the precipitate among the bottles. Mr. E., '95, on the evening of the reception to the Columbia Club, asked " Where that derfiVati.on was from ?" One of the " co-eds " of '97 inquired the other evening, as she went down the carnpus, "Why they never light the lamp-post any more?" We wonder who would be able to tell her? Dr. M., to a bright Junior—" With what did you acidify that ?." Junior—" ' Hydraulic ' acid." A chest of rice was received on Baltimore Hill, Friday evening, October 6th. Particulars will be given to any one calling at 17 Middle. M.*S. Q. K., '94 (imparting knowledge to a coming orator) —" In using monosyllables, you must always accent them on the first syllable." A Senior, who is quite a prodigy in natural philosophy, announces the startling informa-tion that a " horse power " is the " power of a horse." THE COLLEGE MERCURY. i r Who was the man that put a nickel in the collection-basket and took out four pennies ? Mr. N., '94, in sanitary science—" Boiling kills the life out of these here bacteria." We clip the following from the Harrisburg Telegraph: "John Hofferand , both of Harrisburg, have been taken to the State Lunatic Hospital here." Anxious student—"Shall we have Greek j to-day?" " No ; Dr. Baugher has gone away to attend j his funeral." The reading public is informed by F., '95, that the Bigloiv Papers are written in " verse and poetry." S., '94, to K., '94—" Say, Matt, where's the transom instrument ?" Pres. "Plainfield" (in society)—"We will now have a piece of music consisting of the Misses Keith and Overdear." S., '96, wants to know if the Old Testament is the only Hebrew that is extinct. Dr. H. (in Biblical)—" Who was Samuel's mother ?" R., '96—" I don't know ; but Eli was his father, and his mother used to take him a little coat eveiy year." L., '98—" If ever I join a fraternity, it will be that one with the blue and orange flag for a badge. It seems to be the biggest one around here." Y. M. C. A. NOTES. Our Y. M. C. A. continues in its usual un-obtrusive manner to keep before the minds of the students the importance and pleasure of being in the service of the Master. The topics discussed at each meeting are purely Scriptural ones, which elicit remarks from numbers of young men present, and the prayerful discus-sion of which cannot be otherwise than helpful in spiritual growth. There are now in the hands of the students, copies of the annual letter from Rev. John Aberly, the " Students' Missionary to India." The desire is there earnestly expressed that the Students' Missionary be supported en-tirely by the students, which can be done only " by co-operation and systematic, regular giving." All students will be given an oppor-tunity to aid in this most laudable undertak-ing, and it is hoped that our standard in mis-sionary work, heretofore somewhat low, may be considerably raised during the coming year. The Bible classes which have been organized meet regularly each week, and it is believed much profitable work is being done in this way. There is still ample material for addi-tional classes. At a recent business meeting three delegates were elected to represent the Y. M. C. A. at the State convention soon to be held at Wilkes- Barre. The sum of $25 was subscribed for State work. Good music is now, as ever, a prominent feature in our Y. M. C. A. devotional meet-ings. Let all students attend and help to make it better. It is a matter of comment that the new stu-dents have not been systematically canvassed to obtain their applications for membership. This is unfortunate, especially at the begin-ning of the school year, and it is hoped that the committee will soon begin and complete a thorough canvass of the building. GENERAL COLLEGE NEWS. On September 1st the thirty-fifth anniver-sary of the founding of Missionary Institute, Selin's Grove, was celebrated with appropriate exercises. The faculties of the various colleges of the land seem determined to do away with " haz-ing" altogether. Nearly every daily paper contains an account of some expulsion or dis-missal. At Princeton, three students were dis-missed and cannot enter any other college, three expelled permanently, two until January 1st, and two until March 1st, for hazing a Freshman. Professor Josiah Jackson, who has taught higher mathematics in State College for 15 years, died suddenly, October 10th, at Chester, while on a leave of absence. The college journal is an opening to the field of practical journalism, and yet there seems to be an inherent disposition on the part of most of our students to M4 THE COLLEGE MERCURY. neglect the college journal, never con-tributing anything unless almost compelled to. Such should not be the case. Students who have a college paper to support ought to take enough interest in it at least to keep it alive without being continually asked and coaxed to contribute. By mutual consent all old stale articles should be debarred from a college journal; there is certainly enough [ originality in most schools to furnish four or five literary articles a month. Fellow-students, please take notice and prepare something now, that you may be ready to answer " yes " when the hustler comes around.—The Midland. In a college in Western Pennsylvania it is customary for the Junior Class to furnish music for the Senior address. On a recent occasion as the Senior Class was marching to the plat-form headed by the President of the college, the Juniors began, " See that mighty host ad-vancing, Satan leading on."—Ex. Of President Cleveland's cabinet officers, Gresham graduated at Bloomington Univer-sity; Lamont'and Morgan, Union; Smith, Union, Ga.; Olney, Brown; Herbert, Univer-sity of Virginia; Bissell, Yale; Carlisle re-ceived a common school education.— The Occi-dent. Last year the United States spent $155,- 000,000 for education, while great Britain spent S}5,000,000, and France only $25,000,000.— Ex. HORSE POWER. 'Tis strange, to say the least, In this advancing hour, The grinding mill of college Is still run by horse power.—Brunonian. Two Chinese women have taken the exami-nation for admission to the medical depart-ment of the University of Michigan.—The (Occident. Freshman year—" Comedy of Errors." Sophomore year'—" Much Ado About Nothing." Junior year—"As You Like It." Senior year—"All's Well that Ends Well." —Ex. Nearly half of the men who have graduated at Monmouth College have selected their j wives from the girls who were with them in > college.—The Occident. ALUMNI. FRANK E. FICKINGER, Editor. '39. The children of Loysville Orphan Home are gathering funds for the purpose of erecting a monument to the founder of the Home—Rev. Father Willard. They have al-ready contributed $10 themselves, and will be very grateful for every assistance ren-dered them. Address Charles A. Widle, Superintendent, Tressler Home, Loysville, Perry County, Pa. '41. Rev. Dr. E. Miller has resigned the Lutheran pastorate at Shrewsbury, Pa., to take effect April 1st, 1894. '41. Rev. Dr. M. J. Allcman recently dedi-cated a neat little church near Roundtown, York County, Pa., which he is serving as pas-tor pro tern. The church is in a live Lutheran community, and ouglit to flourish. '53. Rev. P. Bergstresser, D. D., is now to be addressed at Rockwood, Pa., where he located a few days since. '55. Dr. Huber will preach on next Sunday at the dedication of Messiah Lutheran Church, Philadelphia, Pa., of which he was formerly the pastor, and of which Rev. M. H. Valen-tine, '82, is now the pastor. Dr. Valentine, '50, and Prof. Charles H. Huber, '92, will also take part in the ceremonies of the week. '57. Dr. H. L. Baugher assisted, on the 22cl ult, in the dedication of the new Lutheran Church of the West Fairview charge, near Harrisburg, Pa., of which Rev. Nicholas is pastor. '57. Rev. J. A. Earnest, D. D., of Mifflin-burg, Pa., was elected president of the Central Pennsylvania Synod, at its recent session at Bellefonte, Pa. '60. Rev. George U. Wenner, D. D., of Christ Lutheran Church, New York city, celebrated the silver jubilee of his ordination and the twenty-fifth anniversary of his pas-torate on October 22d. A reception was tendered him by his congregation on the fol-lowing Monday evening. '63. Rev. Dr. Wolf delivered the address at the laying of the corner-stone of the St. James THE COLLEGE MERCURY. ii5 Lutheran Chapel at Frederick, Md., on Sunday afternoon. '67. The Lutheran Board of Publication have extended a call to Rev. Charles S. Albert, 1). D., pastor of St. Mark's Lutheran Church, of Baltimore, to become Literary Editor. Dr. Albert has accepted the position and resigned his present field, to take effect January 1st. '69. At Penbrooky a few miles northeast of Harrisburg, Pa., a new congregation has been organized by Rev. W. L. Heisler. A lot has been secured on which it is proposed to erect a $5,000 brick church. It will only be a matter of a few years when Penbrook will be part of Harrisburg. '70. Rev. J. M. Reimensnyder and family, of Milton, Pa., are greatly bereaved by the I death of their daughter, Miss Anna C, who was taken from them recently. Dr. Baugher officiated at the funeral ceremonies. '72. Rev. John Brubaker, while his wife has been lying- ill in Gettysburg, has been serving the Mt. Joy congregation near town. '72. Rev. J. H. Leeser presented strong petitions to the West Penna. Synod for restor-ation to the ministry, from which he has been deposed, but Sjmod refused to reinstate him. '74. The Rev. C. M. Stock, pastor of St. Mark's Lutheran Church, of Hanover, was recently surprised by a gift from his congrega-tion of a purse containing money to defray expenses to the World's Fair. '74. Rev. J. A. Wirt, of Hughesville, Pa., has enlarged his lecture-room and dedicated the same on October 22d. Dr. E. J. Wolf, of the Seminary, took part in the dedication cere-monies. '75. Rev. M. L. Beard, for the last six years paster of the Boonsboro' charge, Md., has been elected pastor of the Middletown charge in the same State as successor to Rev. P. Bergstresser, D. D. '75. Rev. J. Milton Snyder has resigned as pastor of the Funkstown (Md.) charge, resig-nation taking effect October 1st, 1893. '75. The First Lutheran congregation, of Altoona, Pa., of which Rev. E. D. Weigle is pastor, has been offered $45,000 for their pres-ent church property. They own a lot on another street, and will probably build a new church next summer. 'jy. Mr. Benjamin K. Miller, Jr., Esq., of Milwaukee, Wis., has declined the offer of the professorship of English ' and American law in the Imperial Japanese University at Tokio. 'JJ. Rev. C. S. Trump barely escaped being elected President of the Maryland Synod of the Lutheran Church, recently in session in Baltimore. 'jy. Rev. J. J. Young, D. D., pastor of St. John's Lutheran Church, New York city, has entered upon his duties there and was installed on Sunday, October 22d. Receptions were held on Monday and Tuesday evenings following. '']']. Rev. H. B. Wile, of Carlisle, is now, and has been for quite a while, preaching to the Indians of the Indian Training School every Sunday afternoon. 'So. Rev. J. A. Metzger, of Hanover, was elected Secretary of the West Penna. Synod, which convened a short time ago in Carlisle. '82. Rev. H. H. Weber, General Secretary of the Church Extension Board, took ill at the meeting of the Central Pennsylvania Synod at Bellefonte, Pa. '84. M. D. Detweiler, Esq., of Harrisburg, Pa., was complimented by the Grand Jury of the September Quarter Sessions as follows : " District-Attorney Detweiler by his skill and ability, energy and perseverance in bringing criminals to the bar of justice for prompt trial, his untiring industry in the methodical ar-rangements and management of the multitude of cases that are pressed upon the attention of the court and grand jury, by which time and expense are economized, has gained for him-self, not only our thanks but the gratitude of the public." '85. Rev. H. M. Heilman has taken charge of a new Lutheran Mission in Altoona, Pa. '86. Rev. Prof. O. G. Klinger, of the Pre-paratory Department, took a trip to the World's Fair about the middle of October. '87. Rev. Sydney E. Bateman's congrega-tion, All Saints' Lutheran Church, of Phila-delphia, Pa., are about to erect a beautiful and commodious chapel on their lot recently pur chased. n6 THE COLLEGE MERCURY. '88. Rev. Leander Goetz, of Newberry, Pa., was married lately to Miss Rebecca Lucas, of East Carver, Mass. '89. Rev. C. B. Etter, of the Second Church, of Akron, O., has already a membership of 62. '89. Rev. W. L. Rutherford, who resigned as pastor of St. Mark's, Steelton, Pa., is re-considering the step, as his congregation unanimously refused to accept his resignation. '89. Rev. John VVeidley has been doing ex-cellent work as pastor of Bethany Mission Church at Pittsburgh, Pa., constantly increas-ing his membership. '90. Chas. Fager is filling the position of Professor of Chemistry and Physiology in the Harrisburg High School. '93. Mr. A. C. Hain is teaching Latin at Hartwick Seminary and at the same time pur-suing a course in theology in the same insti-tution, and is not assistant professor of Ger-man as stated in our last. We beg the gentle-man's pardon. '93. J. Ranson Plank and W. H. Deardorff are attending Jefferson Medical College, Phil-adelphia. '94. John Rice is employed in Altoona, Pa., on the City Passenger Railway. '95. Mr. Ivan Hoff, now studying law at Westminster, Md., spent a few days in our midst recently, witnessing the F. and M. foot-ball game on Saturday, October 14th. '95. Mr. Luther H. Waring left New York September 30th, on the North German Lloyd steamship, " Elbe," for Bremen. He expects to remain abroad two years, studying at Leip-sic University and traveling in Great Britain, France, Italy, Greece, Switzerland, Egypt, Palestine, etc., and hopes to cover Germany itself pretty thoroughly. F-RATE-RNITy MOTES. PAUL W. ROLLER, Editor. PHI KAPPA PSI. Bro. Garrett B. Levan, of Harrisburg, spent a few days recently in our midst. Bro. Horace Witman left school to take in the sights of the World's Fair for several weeks. Bro. Carroll Graff, '97, was initiated October 12th. . Bro. Howard Sadtler, of Baltimore, paid us a flying visit not long ago. A new walk has been placed in front of our chapter-house, and interior improvements will begin shortly. Bro. Bowers, '93, has returned to Seminary Our chapter now numbers nine active mem-bers. PHI GAMMA DELTA. Bro. Madara, '95, has entered the College of Physicians and Surgeons at Baltimore in-stead of the University of Pennsylvania, as stated in our last issue. Bro. G. Baum, '93, is pursuing a course in architecture at the University of Pennsylvania. Bro. Chas. S. Albert,'67, of Baltimore, Md., has been elected editor-in-chief of the Luth-eran Publication Society. Bro. Huber, '92, preached in the Messiah Lutheran Church of Philadelphia, on the 15th in st. Bro. Herr, '97, recently passed a few days with friends at York, Pa. Bro. Anstadt, '90, was licensed by the West Pennsylvania Synod at its recent session. The marriage of Bro. Blint, '90, to Miss Emma A. Munro took place in the First Bap-tist Church at Lock Haven, Pa., on the 26th inst. We" were pleased to see Bro. Garland in our midst recently. The National Convention of Phi Gamma Delta was held at Minneapolis, Minn., on the 18th inst. SIGMA CHI. Our chapter has been greatly strengthened by the addition of four brothers : Monath, '97; Bixler, Jr., '98; Sigafoos, '94, and Olewine, '97- Bro. M. V. Miller, '95, is studying medicine under a physician at Gilberts, Pa., preparatory to entering the Medico-Chirurgical Institute, of Philadelphia. THE COLLEGE MERCURY. 117 Bros. McPherson, '83, and Loudon, '96, represented the local chapter at the Congress (if College Fraternities at the World's Fair. Bro. Stuckenberg, '96, has engaged in busi-ness at Cincinnati, O. Bro. Fox, '95, of Washington, D. C, spent a few days with college friends at the opening of the present term. Bro. Hays, Dickinson, '94, and Manager of the Dickinson Foot-ball Team, was the guest of Bro. McPherson on Saturday, October 7th. Bro. Humrichouse, '97, has entered the business firm of his father at Baltimore. Bro. H. M. Wolf, '84, of Mifflinburg, Pa., visited the family of Bro. Bikle last month. Pro. Monath recently spent a few days with friends at Hagerstown and his parents at Chambersburg. Bros. Bixler, Jr., and Bixler, Sr., and Ole-wine spent Tuesday, October 17th, in Balti- j more. Bros. McPherson and Zeigenfuss,'66, assisted in re-habilitating the Alpha-Rho Chapter of our fraternity at Lehigh University on the evening of September 14th, 1893. Bro. Frank Hersh, '92, who has been spend-ing his vacation at his home in Gettysburg, has returned to his duties at Pittsburgh, Pa. PHI DELTA THETA. Bro. Shaw, who did not return at the begin-ning of this year, paid a visit to our chapter recently. Bro. Ehrhart, '93, has been engaged to lead the Mandolin Club. Bro. Van Camp, '94, and Eckels, '95, paid a visit to the Dickinson chapter September 30th. The convention which was to have been held this month at Syracuse, N. Y., has been postponed one year at the request of the N. Y. Alpha, owing to its financial stringency. ALPHA TAU OMEGA. Bro. G. M. Brown, '85, paid the chapter a short visit recently. Bro. Brown has been seriously ill during the summer, but has re-gained his health again. Bro. Bacon, '94, now of the firm A. D. Bacon & Co., Harrisburg, Pa., recently spent a day in Gettysburg, looking up old acquaint-ances. Bro. George Kyner, attorney-at-law, Cham-bersburg, Pa., made a short business call in Gettysburg recently. Bro. W. H. Menges, '96, was royally enter-tained by the N. Y. Beta Theta Chapter at Cornell while on a visit to Ithaca with the foot-ball eleven; also by the Penna. Tau Chapter at the University' of Pa. ATHLETICS. HENRY E. CLARE, Editor. THE College foot-ball team opened its. season very creditably, September 30th, by a well-contested game with Cornell Uni-versity, at Ithaca, N. Y. The Cornell players expected a hard contest, but they did not ex-pect the Gettysburg team to plow repeatedly through their heavy rush-line, making at times gains, of 10 and 15 yards. This was " the revelation of the surprising strength of their opponents," as the Cornell Daily Sun puts it, and necessitated, as the Ithaca daily journal said, " the hardest kind of work to prevent them from scoring." The team played with a vim and determination that surprised the spectators and brought forth repeated ap-plause. The game was called at 3.13 P.M. Gettys-burg put the ball into play, and advanced it about 20 yards into Cornell's territory. Here the ball was lost and forced back. The ball then passed from one side to the other, some-times being in Cornell's territory, and then again in Gettysburg's. Several times it looked like a touch-down for Gettysburg, but each time excellent tackling on Cornell's part pre-vented it. Then Cornell having the ball, passed it to Robbins, who tried to run around the end. He was tackled by Moser, who re-ceived such an ugly gash above the eye that he was partially stunned, and was unable to hold him. Thus, having a clear field, he made Cornell's first touch-down at the end of 23 minutes. Goal was kicked. In the second half, Cornell succeeded only by the most desperate work in making two touch-downs. Probably it was this work that ixS THE COLLEGE MERCURY. Harper s Weekly referred to when it said: " Cornell was called upon to do actually desperate work to keep the Gettysburg team ' from scoring." They failed goal on one of the two touch-downs, making the score 16-0. Twenty-five minute halves were played. The team was well pleased with its delightful trip, and the treatment received while at Ithaca. The result of the Cornell game sent a thrill of enthusiasm through the boys, and all those who love their Alma Mater and have her welfare at heart. All were proud that it had been so conclusively proved that Gettysburg College could, in some respects, rank with the best institutions of the land. The feeling of those days of elation are beyond description. But the joy and pride were all short-lived and destined to be blasted. The Faculty of that institution, the Seminary, which we have lately learned to regard with awe, issued a decree which caused dismay throughout the camp. It was to the effect that no Seminarian would be allowed to play foot-ball on the College team. Coming as it did on the eve of one of our hardest contests, it was doubly disastrous to our hopes: Three old experienced players, the captain, quarter-back, and right guard, were compelled to leave the team, their places being filled by inexperienced players. The prospects, which before seemed so auspicious, now assumed a far different aspect. Not-withstanding this disastrous set-back, the team decided to fulfill all its engagements, and re-organized at once. The next game scheduled was with the University of Pennsylvania, at Philadelphia, Fa., October 14th. The game was called at 2.30 P. M. From the beginning, the 'Varsity team had things its own way. The Gettys-burg team, in its crippled condition, was no equal to a team whose average weight was easily 30 pounds more than its own, and one that had been in training for several months. Nevertheless they made a stubborn resistance, and forced the 'Varsity team to work hard for what they got. The 'Varsity team succeeded in running up a score of 74-0, which result may be ascribed to the action spoken of in the previous paragraph, namely, the Seminary de-cree. Thirty-minute halves were played. Umpire, Buehler. Referee, Schoff. The next game on the schedule was the one with Dickinson, at Carlisle, October 1 ith. The team left here on the morning of the nth, and played the game in the afternoon, begin-ing at 2.30. The Dickinson boys turned out in great crowds to see the game, expecting this contest to be Gettysburg's Waterloo. They counted only on the crippled condition of Gettysburg's team, forgetting the determina-tion and endurance of the " High-Water Mark " men, although wounded. The Gettys-burg team went into the contest with that spirit which has characterized all its games. They knew that Dickinson had been espe-cially preparing for this game, and to this end had procured outside help. But, notwithstand-ing this, and the disadvantage of playing on a strange ground, the Gettysburg team, by its superior playing and training, rolled up a.score of 24 to 14, in their favor. Nothing could have been more of a sur-prise to the Dickinson boys. They had been confident of success, and were totally un-prepared for anything else. A more despond-ent lot of fellows than they could scarcely have been found as they, thoroughly crest-fallen, wended their way in groups to their re-spective hiding-places. Not only were the Dickinson boys humiliated, but all their sym-pathizers, and on the following morning Dr. Reid, their president, strictly charged the students, assembled in chapel, that if they did not defeat Gettysburg in the return game on November 4th, the team would not be allowed to play any longer. We certainly pity the boys, and would be a little easy with them in the return game, but we have a reputation to sustain, and therefore warn them not to come over here with as much confidence as they evinced on the nth. By taking our advice their disappointment will not be so keen. A royal reception awaited the team on its return. When the news of victory reached Gettysburg, the students at once prepared a glorious welcome for the victors. As soon as the train stopped, they were carried to a con-veyance and hauled in triumphal procession through the town to the music of the band. Drs. McKnight and Bikle delivered speeches on the occasion. October 14th witnessed a far different scene. It was the first game played on the home grounds this season. The Franklin and Mar-shall team came here with the expectation of rolling up a nice score, but they also were destined to feel the pangs of disappointment. THE COLLEGE MERCURY. 119 The game was an exceptionally hard one, the ball being kept near the centre of the field throughout most of the game. Gettysburg succeeded in keeping it on F. & M.'s side of the centre line most of the time. F. & M. scored a touch-down in the first half by what the spectators said was a forward pass, but this was not recognized by the umpire, an F. & M. man. In the second half, the ball was kept almost continually in F. & M.'s territory, and several times the ball was dangerously near its goal, but was fumbled. Gettysburg scored one touch-down making the score 4-4. The F. & M. boys were glad to escape with this, as it looked very bad for them in the sec-ond half, and several touch-downs for Gettys-burg were only prevented by unfortunate fum-bles. The game was very interesting and showed up some fine playing. A very strong second team has been organ-ized by Captain Emmert, which promises to do some exceljent work. The excellent work of the team this season can be attributed to the efficient coaching of Mr. Harry Buehler. He certainly deserves the thanks of the college for his interest and labors. Although much interest is manifested by the students in foot-ball, yet the support which it receives falls far short of what it should be. If the home games arc not better supported by the students, this season will be, financially, a failure. Two-thirds of the crowd on the field October 14th were there without tickets. None should be allowed on the field without a ticket. One who claims to be interested in athletics should be ashamed to show his face on the grounds without one. Let each one lend his aid in making this a profitable season. The action of the West Pennsylvania Synod, asking that the students of the college be pre-vented from playing foot-ball, caused not a little surprise when it was announced. Coupled as it is with several other recommendations, and passed at a time when a full vote of the Synod could not be had, it is not such a sur-prising thing. It is a satisfaction to us that its advocates did not dare to bring it up earlier, but chose a time when all such measures are rushed through, when only a partial vote can be had. Again it is a satisfaction that they so openly evinced their hostility to all modern im-provements and movements which have brought this college abreast with the times, and not only to foot-ball. The surprising feature of the request is that the ministers of this Synod should for a mo-ment suppose the students of this age to be satisfied with the sports ©r so-called sports which they delighted in while at college. The carrying of calves to the third and fourth stories of the dormitory and letting them jump out the windows, raids on farm-houses, and carrying away wagons, fodder, etc., and plac-ing them in the halls of the building, the blow-ing up of professors, and other puerile sports too numerous to mention are above the dig-nity of the student of 1893. Again, it is surprising that these ministers with their broad scope of vision should fail to see the advantage derived from foot-ball, both for the college and for the student. Numerous benefits could be enumerated, but they are all so apparent to the mind disposed to be reasonable that it is unnecessary. In conclu-sion, we will say that no fear is entertained for the perpetuity of foot-ball at this college. The students of the institution have too much con-fidence in the intelligence and reasonableness of the Board of Trustees to suppose for a mo-ment that they would do anything detrimental to the college or anything which would reflect on their judgment and wisdom. A game of foot-ball was played with the Bucknell University team, Saturday, Septem-ber 21st, at Lewisburg, Pa. The teams lined up 10.30 A. M. Bucknell won the toss and took the ball. By repeated runs around the ends and through tackles, the Bucknell boys succeeded in making a touch-down in a few minutes. One more touch-down was made by them in the first half, making the score 12-0 in their favor. In the second half, Gettysburg took the ball and forced it almost to the goal-line, where it was lost by fumbling. Several times Gettysburg carried the ball near the goal, but it was lost each time through the careless playing of some of the team. In this half Bucknell made another touch-down. About four minutes before the end of the half, Buck-nell had the ball near the centre. Smith took it and kicked it near the goal-line, but here it was fumbled again, and Bucknell secured the ball. Smith again received the ball, and made a drop kick from the field as time was 120 THE COLLEGE MERCURY. called. Thus the score stood 23-0 in favor of Bucknell. Owing to the crippled condition of the team. Manager Kloss had canceled this game, but the Bucknell manager protested so vehe-mently, and so many at home were dissatis-fied, that the only thing to be done was to go and do as well as possible. The two half-backs had been sick the whole of the previous week, and, for the same reason, the line was broken up, leaving the team without practice. This sad condition would not have prevented them from scoring against Bucknell, or prob-ably winning the game, had not the ball been fumbled so frequently by several of the players. This became a feature of the game, and discouraged the better players. Only the six first points were really earned ones for Bucknell, the others being given to them by this careless playing. Bucknell's team was probably 15 pounds heavier on an average than ours, yet in bucking the line our team : was the superior. The team is being changed somewhat, and better results are looked for on the 28th. TOWN AAJTD SEMINTVRg ROSCOE C. WRIGHT, Editor. XOWN. REV. JOEL SVVARTZ, 1). D" has resigned as pastor of St. James Lutheran Church, in which charge he has labored faithfully for 12 years. Action will betaken on his resigna-tion at the congregational meeting in January. The Potomac Synod of the Reformed Church convened in the Reformed Church of Gettysburg, Rev. T. J. Barkley, pastor loci, on October 17th. The Synodical sermon was preached by Rev. J. G. Noss, of Silver Run, Md. On Sunday evening, (Ictober 8th, Ur. Day, our missionary from Africa, gave an excellent address in the College Church on the work which is being done in the African Mission field. Dr. Day sails for Africa the last of ()ctober. The members and friends of the 6th Penna. Cavalry visited the field of Gettysburg, Sep-tember 30th, in charge of General Leiper. In the evening a camp-fire was held in the court-house, at which a programme consisting of songs, addresses, and humorous recitations was rendered. Captain Long conducted the party over the field. Geo. J. Benrier, Esq., and Hon. David Wills, attorneys for Win. H. Tipton, the battle-field photographer, have filed a plaintiff's statement claiming $10,000 damages against Gen. Daniel E. Sickles. The claim grew out of the diffi-culty caused by Tipton's attempt to photo-graph some New York regiments last July, when Sickles interfered. S. McSwope, Esq., has been retained as counsel by General Sickles. The case will come up at the November court. On October 5th a large flag-staff was dedi-cated at General Meade's headquarters, on Cemetery Ridge. The pole is the tallest in the State, being 150 feet high. It is made of Oregon pine, and was turned at Cramp's ship-yards, Philadelphia. The services were held under the auspices of the Loyal Legion Commandry of Pa. The following programme was rendered. Salute—Light Battery C ,. 3d U. S. Artillery. Music—"Hail Columbia," ' . G. A. R. Band. Prayer—Chaplain, H. C. McCook. Address Brevet-Major-Gen. D. McM. Gregg. Address, . . Governor Pattison. Unfurling of flag by Master George Gordon Meade, grand-son of General Meade. Salute, Light Battery C. After the dedicatory services the veterans and visitors visited the battle-field in charge of Captain Minnich, returning to Harrisburg in the evening. The members of the 21st Penna. Cavalry arrived here October 5th, from their reunion at Chambersburg. They dedicated a monu-ment on the Baltimore Pike, at which Major Robert Bell delivered one of the addresses/ Work on the power-house at the corner of Washington and Railroad Streets, which was suspended for some time, has been resumed. Arc lights have been put at all street cross-ings, and in many of the stores. Electric cars leave the town for Round Top every half-hour. The opposition to the road which was manifest last spring has subsided, and the electric rail-way is now looked upon in its proper light as an improvement to the village of Gettysburg. The old veterans have not torn up the road as THE COLLEGE MERCURY. 121 some apparently misguided persons wished them to do, but rather consider it a great privi-lege to visit the historic battle-field for a sum much less than that charged during the past years. Rev. Harpster and wife, late of Canton, Ohio, visited friends in Gettysburg the first of the month. Rev. Mr. Harpster resigned the pastorate of the Lutheran Church of Canton, to enter the India Mission Field. SEMINARY. Rev. Archibald E. Dietz, a member of the class of '92, and at present pastor of the Luth-eran Church at Rhinebeck, N. Y., was mar-ried October 18th, to Miss Carolien Wells Secor of that place. THE MERCURY extends congratulations. Dr. J. G. Morris will give his lectures on Science and Revelation this fall instead of next spring. The contract for the new ' building will be given out October 21st. The number of students this year is 74, as compared with 68 last year. This' is the larg-est number in the history of the institution. All of the rooms in the dormitory are occu-pied, many of the s'tudents rooming in town. At the recent session of the Central Penn-sylvania Synod held at Bellefonte, Messrs. John M. Axe, Ed. Wolf, Frank Snyder, Samuel Ulrich, W. C. Dunlap, and Bruce Wolf were licensed. Rev. McGill of the class of '93 is studying law in Louisville, Kentucky. The following gentlemen were licensed at the recent session of the Maryland Synod: G. Albert Getty, A. Pohlmann, A. O. Mullen, C. L. Ritter, W. G. Slifer, Henderson Miller, Henry H. Sloop, and A. C. Stup. Revs. J. F. W. Kitzmeyer, of Davis, W. Va., and W. H. Minnick, of Middletown, Md., were ordained. Rev. George H. Reen, of Mansfield, Ohio, was married October 18th, to Miss Ida Bell Gilbert, at the home of the bride's parents, Captain and Mrs. Calvin Gilbert, on Cham-bersburg Street, Gettysburg. May happiness attend them ! August Pohlmann, of the present Senior Class, has been accepted by the Board of Foreign Missions to go as a missionary to Africa. He has taken up his residence in Bal-timore in order to attend medical lectures in the University of Maryland, and will read his last year of theology in connection with it. Dr. Day now has the promise of the helper he asked for while here. The Seminary Faculty has adopted the plan of marking attendance at chapel exercises in the morning. It would not do to give the reason for this action, but there is »a con-spicuous absence of the we-can-do-as-we-please air from the faces of the theologucs. The contracts have been awarded for the new Seminary building, and ground was broken on Thursday, October 26th. The building surpasses every one's conception in its completeness and adaptability. In addition to the chapel, library, and other rooms, it is to contain what has long been wished for, a gymnasium and its bathing adjuncts. LITE-R7VRLI SOeiETIES. WALDO D. MAYNARD, Editor. A GREAT deal of interest is now mani-fested in certain colleges in inter-collegi-ate debates and oratorical contests. In various colleges in Illinois, Ohio, and Wisconsin it is considered a greater honor to win a debate than to be victorious in an athletic contest. The University of Wisconsin has two socie-ties which have had men training all summer for a joint debate. Why would it not be a good plan for Phrena. and Philo. to pursue some such plan as this ? By taking the best debaters for the contest, it would have a tendency to arouse greater interest in debate on the part of those who are inclined to disregard this branch of society work. The societies might have one of these joint debates each term or oftener if they proved a success. We have an oratorical con-test, why not have a joint debate? We think, judging from the experiences of others, our efforts could be turned in this direction with a great deal of profit. Why could we not have in this State an inter-collegiate debate? Harvard and Yale 122 THE| COLLEGE MERCURY. have such a contest each year, and likewise many of the Western colleges. The interest in athletics, which seems to be the predominant spirit in colleges of to-dav, might be replaced during this season of the year by something which would tend to awaken a greater interest in literary pursuits. We often hear the statement made that the true purpose for which one goes to college is lost sight of. We fear that often there are sufficient reasons for such remarks, and there is among a certain class no little prejudice against sending a young man to college. We think that some of this opposition might be overcome if the educational part of college life was brought more directly before the public. We have a number of smaller colleges in the State, and provision could easily be made for such contests. They have been found to accomplish wonderful results in other States.- Why shall not the literary societies of Gettysburg College be the originators of an inter-collegiate debate? If we cannot extend it throughout the whole State, let it be con-fined to those colleges which are a compara-tively short distance from each other. PHENA. NOTES. The first of Phrena.'s series of meeting's for the consideration of historical subjects was held October 6th. The hall was filled both by the students and a goodly number of people from town. All were well pleased with the pro-gramme and the manner in which each per-formed his part. The subject on this occasion was " The American Revolution." The following is the programme : (Iration—" The Sowing of the Seed," . . MUSIC. Essay—" Lexington—its significance," . Recitation—" The Declaration of Inde-pendence, . S. C. Burger. Essay—" Washington at Valley Forge," . . H. W. Shinier. MUSIC. Recitation—" Resistance to British Aggres-sion," L. C. Manges. Oration—" Arnold, the Traitor," . Lafayette—A Character Sketch, . MUSIC. Essay—" Franklin at the Court of France,1 Recitation—" The American Sailor," . . Oration—"Our Heritage," MUSIC. R. C. Wright. I. O. Moser. W. D. Ernest. E. M. Stahl. W. C. Spayde. P. D. Hoover. J. W. Ott. Messrs. Ireland and Turnbaugh, '97, have been elected members of the society. The following were recently elected officers of Phrena.: President, Lantz, '94; Vice-Presi-dent, Wright, '95 ; Recording Secretary, Moser, '96; Critics, Bell, '95 ; Stahl and Barndt, 94; Librarian, Leidich, '95 ; Assistant Librarian, Ott, '97 ; Monitor, Biklc, '97 ; Chaplain, Bru-baker, '96. A committee has been appointed to re-cata-logue the books in the Library,. PHILO. NOTES. On September 29th, the society rendered its second programme in its series of American Author's Evenings. Those who participated in the exercise did credit both to themselves and the society. Philo. is to be congratulated upon the success which has characterized these special meetings. They are not only entertaining but there is a great deal of instruction and information to be gathered from them. We give below the programme rendered at that time. Whittier was the author under consideration. Vocal Solo, C. F. Wiest. Selection—" Proem," C. II. Brosius. Essay—" Effect of .Religious Faith and Training on Whittier's Career," . . . . M. Kemp. Essay—" Mo.'g Megone," N. C. Barbehefm Selection—'!' Toussaint L'Ouverture," . . R. W. Mottern. Selection—"The Hero," . U. K. Apple. Piano Solo, H. Olewine. Essay—" The Pennsylvania Pilgrim," . . C. F. Wiest. Selection—" The Hive at Gettysburg," . . C. W. Loudon. Essay—"Snow Bound," E. H. Wert. Selection—" Barclay of Ury," W. H. Sellheim. Selection—" My Soul and I," M. G. Rietz. Criticism of Whittier, J. S. English. Flute Solo, H. R. Smith. Debate. instrumental Duet, Messrs. Erb and Ibach. October 13th Philo. elected the following officers: President, Bloomhardt, '94; Vice- President, Rietz, '95 ; Recording Secretary, Manifold, '96; Corresponding Secretary, Criljy, '95 ; Marshal, Abel, '97 ; Critics, Miss Himes, '94, Sigafoos and Allison, '94. The following gentlemen have been elected members of the society: Auckerman, '97; Beltzhoover, '97 ; A. B. and C. R. Coble, '97 ; Wheeler, '97, Witman, '95, and Keffer, '95. The re-cataloguing of the Library has been completed. Under the new system, one can learn at once if the Library contains the book for which he is looking. ADVERTISEMENTS. Wanamaker's. PROFESSIONAL CARDS. What makes Wanamaker's so dis-tinctively Wanamaker's is the spirit that actuates the merchandising—all the time striving to serve our customers better and better, shortening the road from producer to consumer and saving to patrons every possible penny of cost. How well we have done it is a matter ! of history, how well we shall do is what concerns us. The look is always ahead. \ Every part of the store shows points of unusual interest. Sporting Goods. Things for wear. Things for home helping. And there are lower-than-ever prices on many of them. JOHN WANAMAKER. SEND FOR CATALOGUE OF 1 Uth^VTTT^ yOUJSG IflQIZS* NEAR. BALTIMORE, 1VID. This widely known, thoroughly equipped, and extensively patronized School will open its 41st Annual Sesson, Sept. 13th, 1893. All the Departments of a High Grade Seminary. Address, Rev. J. H. TURNER, A. M., Principal, LUTHERVILLE, MD. CHRty-iES S. DUflCR^, '82, ATTORNEY AND COUNSELLOR-AT-LAW, Baltimore Street, . GETTYSBURG, PA. CHflS. E. STAHliH, '87, ATTORNEY-AT-LAW, Baltimoi-e Stx-eet, GETTYSBURG, PA. DR. CHAS, B, STOUFFER, OFFICE, STAR AND SENTINEL BUILDING, GETTYSBURG. PA. fj fiber's Y)vlio Store, Baltimore Street, GETTYSBURG, PA. Prescriptions Carefully Compounded. ISatest Styles ii} Hats, Shoes, AND Gents' paraishings, R. M. ELLIOTT'S. N. B.—Stiff Hats made to Fit the Head in two minutes. A. D. BUEHLER&CO., Headquarters for Stationery and Blank Books. LOWEST CASH PRICES. VI ADVERTISEMENTS. DECKER BROTHERS' PIANOS. Absolute Evenness of Touch, Richness and Brilliancy of Tone, Extraordinary Singing Quality, Unequaled Workmanship, Power of Standing in Tune longer than any other Piano made, are among the characteristic qualities of DECKER BROS. PIANOS, 33 Union Square, flerja York. Used in Philo. Hall at Gettysburg College. GO TO C.A.BLOCHER'S Jeujelpy Stove iov Souvenir *" Spoons, Sword Pins, &c. ReP^nS a SPecraTtLj. Post Office Corner, Centre Square. DKEKA Fine Stationery and Engraving House, 1121 Chestnut St., Philadelphia. COLLEGE INVITATIONS^ ! WEDDING INVITATIONS CLASS STATIONERY i VISITING CARDS SOCIETY STATIONERY BANQUET MENUS PROGRAMMES, BADGES DIPLOMAS AND MEDALS STEEL PLATE ENGRAVING FOR FRATERNITIES, CLASSES AND COLLEGE ANNUALS. All work is executed in the establishment under the personal supervis-ion of Mr. Dreka, and only in the best manner. Unequaled facilities and long practical experience enable us to produce the newest styles and most artistic effects, while our reputation is a guarantee of the quality of the productions of this house. ADVERTISEMENTS. vn R. H. REININGER, Merchant * Tailor. & * % & THE BEST WORK AT THE LOWEST PRICES. Suits from $12.00 to $40.00. Pants from $4.00 to $12.00. NEXT DOOR TO POST OFFICE, UP-STAIRS. CENTRAL SQUARE. PETE THORNE, Shaving $ Hair Cutting Parlors. Pl-RST eUASS ARTISTS. CENTRAL SQUARE. FLEMMING & TROXEL, Billiard AND Pool "Rooms. BALTIMORE STREET. flJVIOS ECI^E^T, DEALER IN Hats, Shirts, Shoes, Ties, Umbrellas, . Gloves, Satchels, Hose, Pocket Books, Trunks, Telescopes, Rubbers, Etc., Etc. AMOS ECKERT. SPECIRIi TO STUOEflTS. Fine Tailoring. JOSEPH JACOBS, Merchant Tailor, Chambersburg Street, (Below Eagle Hotel) GETTYSBURG, PA. Red Front Cigar Store . R. H. RUPP, Proprietor. JSlo. 8 Baltimore St., Gettysburg. The place for a fine Cigar or a good chew. Solid Havana filler, 5 for 25c. An elegant article. A FINE ASSORTMENT OF PIPES AND SMOKING MIXTURES. V11I ADVERTISEMENTS. ESTABLISHED 1876. PE/NKOSE MgE-RS, YVZ/rroindKER ™ JEWELER. Liat*ge Stock of Ldatehes, Clocks, Jexxtelfy, ete., on Hand. That Man is Out GETTYSBURG SOUVENIR SPOONS. COLLEGE SOUVENIR SPOONS. WHO BUYS HIS BASE BALL, . BICYCLE, . . LAWN TENNIS <-^- ^£-a OUTING, YACHTING AND BOATINQ SUPPLIES, 10 BALTIMORE STREET, GETTYSBURG, PA. Students' Headquarters IS AT J. R. STINE & SON'S CLOTHING STORE The Cheapest Clothing and Gents' Furnishings in Gettysburg. MERCHANT TAILORING ELSEWHERE . THAN AT . A. Q. SPALDING & BROS. CHICAGO, NEW YORK, PHILADELPHIA, To8Mulis.ui St. 243 Broadway, 1032 ChestuutSt. DnnLEnELD LIVERY. Rear of Washington House, Opposite W. M. R. R. Depot. GETTYSBURG, PA. m^. All Kinds of Teams. Good Riding Horses. -:o: A SPECIALTY. COME AND SEE US. J. R. STINE & SON, THE LEADING CLOTHIERS, MAIN STREET, GETTYSBURG, PA, The Battlefield a Specialty, With First-Class Guides. DAVID McCLEARY, Prop.

The Mercury January, 1894 ADVERTISEMENTS. IRailroab "The "Royal "Route" New and Direct Line To and From QETTYSBURQ. Fast, Frequent and Superbly. Equipped Train Service Between NEW YORK, PHILADELPHIA, Allentown, Pottsville, Williamsport, Reading, Harrisburg and Interior Pennsylvania Points, with through connections to and from all parts of the Middle States, New England and the West. Visitors to America's Greatest Battlefield can obtain through tickets and baggage checks, via this new and most picturesque route, at all principal stations and ticket offices throughout the country. I. A. SWEIGARD, C. G. HANCOCK, General Manager. Gen. Pass. Agt. Barber Sfy°P> CHARLES C. SEFTON, PROPRIETOR. BALTIMORE STREET. THE PLACE FOR STUDENTS TO GO. ONLY FIRST-CLASS WORK, K& /Wat* C°ff£SS and /ViUgrc arjd ^v-fc £or)S£r«VatOr° REPAIRING PROMPTLY DONE. ADVERTISEMENTS. Irving College, For LJoung Ladies. A Lutheran School for Lutheran girls. Chartered 1856. Confers degrees of A. B., and M. E. L. Experienced Fac-ulty. French and German spoken. Music—full conserva-tory course—piano, organ, pipe organ, violin, guitar, voice. Specialist in elocution and physical culture. Fine brick building, splendidly furnished, steam heat. Pupils carefully drilled sociably. Course high, thorough. Twenty minutes' ride from Harrisburg. Art a specialty. The only Lutheran school for girls in Pennsylvania. Synchronized time. Elec-tric bells. Send for catalogue. PROF. E. E. CAMPBELL, A. M.,- President, Mechanicsburg, Pa. F. WEBEK & CO. Drawing: Materials and $p: Drawing Instruments DRAWING PAPER, PENCILS, &C. A LARGE ASSORTMENT OF DRAWING MATERIALS OF ALL KINDS. J. WOODFIN MINIFIE, Manager, No. 5 NORTH CHARLES ST., BALTIMORE, MD. Special Attention to Orders by Mail. Main Office, 1125 Chestnut St., Philadelphia. # {|attepg> * and ||?ei?'§ fupni§bei®§, "@K® TRUNKS, LEATHER GOODS, AND VALISES, 12 W. MARKET ST., YORK, PA. Special Attention to Mail Orders. H. S. Benner, Choice Family Groceries,, Chambcrsburg St., Gettysburg, Pa. Coffees, Teas, Flour, Fish, and Canned Goods. Queensware, Glassware, Etc. PITZER HOUSE. A temperance house. Pleasant and home-like. Teams and Guides to all points of interest on the battle-field. REASONABLE RATES. 127Chambersbarg St.,Gettysburg, Pa. JOHN E. PITZER. MEMBER POST 9, G. A. R. J. W. EIGHOLTZ & GO., DEALERS IN PIANOS, OP.GAJiS, IWTJSIC, STfWlGS, Ete. 12 BALTIMORE ST., GETTYSBURG, PA. SAJWUELi FABEP,, ~&Fine Cigars & Smokers' Mieles**- CHAMBERSBURG ST., GETTYSBURG. J. H. MYERS, Fashionable Tailor, Clothier1 —AND— [fenf^' Fufnighbi1. You alutays find the liatest Styles tov Gents' OUardrobes. No. 11 BALTIMORE STREET, GETTYSBURG, PA. ADVERTISEMENTS. in College pvises Society Babges fliri3e flfoebals Stationery The most successful designers of College and University Badges in the Country Estimates Designs on Applieation BAILEY BANKS BIDDLE Chestnut and Twelfth Streets Philadelphia, "Pa. ,Hary had a Little Lamb, (Stam? your Memory.) It's wool was all the go— We make it up in BUSINESS SUITS for SI 5.00 you know. These Cuitorn-Made Suits are popular throughout America— because they represent the very Quintessence of Nobby Dress, and are essential to every business man who cares one lota for economy and APPEAR-ANCE. Send us 6 cents in stamps, staling kind of gar-ment or suit desired, and we will forward you SAMPLES of Cheviots, Cassimeres, etc., Self-measurement rules and fashion plate. YOU DO THIS and we do the rest. Ealti more cheapest market. KEELER the largest custom producer. Full Dress Suits Trousers, - - Frock Suits, - Overcoats, - > JOnN M. KEELER, 5 N. Calvert St. Baltimore, Hd. "Suffer no longer the extortions of loc*-l tailors ' $25.00 Up. S4.00 Up. $18.00 Up $18.00 Up. Correspondence Solicited With Responsible Parties Desiring to Act as Agents. THUTH WEflflS JO ]HSK Because it needs none. It bows at no human shrine, seeks neither place nor applause; it only asks a hearing, and so, too, do we. Our immense Fall and Winter stock is full of rare and choice bargains. Stylish Men's Suits and Overcoats at $IO, $12, $15, $20. We'll buy them back if you don't like them. Sole agents for Youman Silk and Derby Hats. Oehm's Acme Hall, CLOTHIERS, HATTERS, FURNISHERS BALTO AND CHARLES STS., Baltimore, Md. WILLIAM SMALL, DLM D0OK tlnHEK AND DOORMm 6 WEST MARKET STREET, YORK, PENNA. IV ADVERTISEMENTS. F. D. SCHRIVER, Draper, Importer, • A^D JVterehant Tailor, 23 Baltimore Street GETTYSBURG, PA. GETTYSBURG COLLEGE FOOT-BALL TEAM, SEASON OF 1893. k The College Mercury. Vol. I. Gettysburg, Pa., January, 1894. No. 9. THE COLLEGE MERCURY, Published each month during the college year by the Students of Pennsylvania (Gettysburg) College. STAFF. Editor : FRED H. BLOOMHARDT, '94. Associate Editors : FRANK E. FICKINGER,'94. ORVILLE L. SIGAFOOS,'94. HENRY E. CLARE, 95. WALDO D. MAYNARD, '95. PAUL W. KOLLER, '94. ROSCOE C. WRIGHT, '95. WILMER A. HARTMAN, '95. Alumni Association Editor: D. FRANK GARLAND, Baltimore, Md. Business Manager ; BENJAMIN R. LANTZ, '94. Assistant Business Manager: CHARLES F. KLOSS, '94. TERMS • /One volume (ten months), . . . . $1.00 ' \ Single copies, 15 Payable in Advance. All Students are requested to hand us matter for publication. The Alumni and ex-members of the College will favor us by send-ing information concerning their whereabouts, or any items they may think would be interesting for publication. All subscriptions and business matters should be addressed to the Business Manager. Matter intended for publication should be addressed to the Editor. Address, THE COLLEGE MERCURY, Gettysburg, Pa. eOMTE/STS. EDITORIALS, ; 139 GRADUATE LIFE AT JOHNS HOPKINS UNIVERSITY, . 140 CONVERSATION, '. . 142 THE MUSICAL CLUB'S TRIP, 144 THE TRUSTEES MEET, 145 COLLEGE LOCALS, 146 ALUMNI, 149 FRATERNITY NOTES, 151 ATHLETICS, 152 TOWN AND SEMINARY, 153 LITERARY SOCIETIES 154 EBITO-RIAL. A HAPPY NEW YEAR TO ALL. \I7ITH this issue, THE MERCURY appears with two changes in its Board of Edi-tors. It is, indeed, very unfortunate that the efficient Editor was compelled to resign on ac-count of ill-health and pressure of work. But since such is the case, it will be the purpose of the reconstructed Staff to do their utmost to make the " Students' Paper " as attractive and entertaining as possible. These, of course, are not the only essentials of a good journal, but they help to secure attention for the weightier material. The supplement to this number is an engraving of the victorious foot-ball team of the season of '93, which doubtless will be highly prized by THE MERCURY readers. * * * /"^HRISTMAS vacation, the happiest time ^-^ in a college man's life, is over, and work has taken the place of two weeks' enjoyment. In view of the " good time " that most of the students have had, it is not surprising that many of the recitations are wearing a kind of holiday attire. In a few days, however, things will have drifted back to their accustomed channels. * JUDGING from our exchanges, it would be ^ supposed that the " proverbial waste-basket" of the editors has not been filled to overflowing by productions of the students. College men should consider it an honor to have their thoughts find place in their journals. There should be an active competition for the space given to these articles. Then the standard of the paper would be raised and his 140 THE COLLEGE MERCURY. own powers would receive such benefit as he cannot receive from any other branch of college work. * * T/ NOWING well that an attractive Annual A^- is of much benefit and credit to our col-lege, The Spectrum Staff have decided to en-large their book. This will make the cost much more than formerly. In order to make it a financial success, it must have the support of the students and Alumni. It is hoped that any one who desires to aid in this work, either by subscription or by an advertisement, will communicate with the business manager, Mr. H. M. Witman, Gettysburg, Pa. * * COOT-BALL, CHANGE IN RULES.—It is now proposed by three of the larger college teams to change the rules of foot-ball. The proposition is to make a decided change, so as to eliminate some of the features which have proved themselves dangerous to the safety of the players and prevent such " acci-dents " as have recently occurred. Yale, Har-vard, and Princeton are announced to begin the work, and it is supposed that this move-ment will meet with approval everywhere. If " rough play " and " interference " could be eliminated, the game would certainly be very much improved, and there would be no need for Synodical or Conference objection to the game. We trust it will be done speedily, so that the almost brutalizing methods employed, which lead to death in many cases, will be entirely forbidden. We hail this movement with joy. We are thoroughly in sympathy with inter-collegiate games, and think they are helpful to the institutions and the students, but deplore the present methods employed, which certainly do endanger life and limb. The Alumni of the college rejoice in the many victories gained for our Alma Mater in the re-cent campaign, and are delighted with the gentlemanly deportment of the team in the contests. '"TO THE ALUMNI.—This paper is for you as * well as for the students of the college. It comes to you in the interests of the institu-tion you love. It is, therefore, in a sense your' paper, devoted to the advancement and growth .of Pennsylvania College, which is your col-lege above all others. Rally to its support. It is not published to make money for its edi-tors and managers. The accumulating gains, if there should be any, will accrue to the liter-ary societies in the. college. It is for them alone. They must be fostered and encour-aged in every way possible. Subscribing, therefore, for THE MERCURY will aid the two societies in a substantial way, and will bring to you every month the news of your college, fresh, interesting, helpful. Send in your sub-scriptions at once. We speak here as an Alumnus to the Alumni. G. GRADUATE LIFE AT JOHNS HOPKINS UNI-VERSITY. TN the busy round of undergraduate life in an American college, the student is often apt, in the struggle for a higher plane of men-tal activity, to forget the existence of a great sphere of thought and action far above and beyond his own little world. It is the world of workers, thinkers, revolu-tionizers, and the student fresh from the neces-sarily narrow fields of college work stands almost dismayed at the widening vistas which everywhere meet his view. Nor can one who has not dwelt in such a world and come under the thrilling influence of its great men and great thoughts altogether realize its peculiar charm. It is an arena of tireless activity, and once in the circle the student seldom looks behind with regretful longings for the easy life of col-lege days. To be sure such conditions are not frequently met with, but even in our own country there are a few institutions which present them in their entirety. Among such schools of ad- THE COLLEGE MERCURY. 141 V vanced work in America, perhaps none stands in a more conspicuous position or exerts a broader influence than the Johns Hopkins University. It approaches nearest to our ideal, the German Universities. Its Faculty contains some of the most prominent and inspiring men on this side of the Atlantic, and the men sent forth from its walls are exerting an influence worthy of their institution throughout our halls of learning. Surrounded by such influences and aroused by such examples of successful work, it will be interesting perhaps to look into the life of a graduate student and see wherein lies the secret of his success. It might be answered in a word—in hard work. He has ceased to deal with glittering generalities and beautiful theories, and is brought face to face with hard facts. He soon loses much of the inter-est he formerly took in non-pertinent subjects amid the engrossment of his life work and de-votes his best efforts to it alone. This may help to explain the sudden metamorphosis of the loiterer along the more flowery paths of learning into . the preoccupied thoughtful worker who is ready to face any obstacle, be it ever so rough and hard to surmount. It is his life work, and all else must fall aside and leave him ready for the struggle. It has ever been the aim of this university to send out fin-ished men, and in this the student is a willing co-worker, and, as,has been repeatedly said by those acquainted with the facts, American students of this class are harder students than the Germans themselves. Most especially is this true in those studies requiring laborious laboratory work. There are at present in the university more than two hundred and fifty post-graduate stu-dents who are divided among these subjects— Languages, History, and Politics, Physics, Mathemathics, and Astronomy, Chemistry and the Biological Sciences. These students may further be divided by the character of their work into the laboratory workers, which in-cludes all students of Pure Science, and into reading students, into which class those fol-lowing Languages and Historical subjects naturally fall, though it must not be understood that those engaged in laboratory work are not readers. Far from it. Their lamps burn the midnight oil most frequently. When the student enters the university he selects a principal subject or major and two allied subordinate subjects known as First and Second Minors. The Minor subjects occupy him, all told, about eight hours a week each for one year. The principal subjects under which the student is classified occupies him in general three years, and one of these must be devoted to original investigation in some new field of work, or old one it may be, whose bounds need widening. This work forms the subject of his thesis for the degree of Doctor of Philosophy. In some departments, there is a growing tendency to lengthen the course to four years. Should this be the final result the university will stand second to none in the excellence of its work. As I have said, in such work as this one begins to look at things as they are and not as they may appear at a casual glance. He goes to the fountain-head for his inspiration, and soon learns how others have worked, and to imitate their example. Each department has its own appropriate laboratory—using the word in the original sense—and its own library, where all the works of importance are collected, and all the journals and scientific magazines are constantly received. The chemical department alone receives about 15 publications, of which several come weekly and the rest monthly. Of these probably three are in our mother tongue, while the rest range through French, German, Italian, and Russian, with an occa-sional waif from the land of Japan, which, however, usually " blooms to blush unseen." Such a course of work is necessarily special-izing in its tendency, and, I had almost said, isolating. The student in Sciences begins lab-oratory work on Monday morning and never lays aside his apparatus till Friday night. 142 THE COLLEGE MERCURY. Of course he fags a little now and then, when the natural perversity of inanimate objects begins to assert itself, but the Doctor's de-gree, at the end of the race is a never-failing spur. Perhaps I have left the reader under the impression that a graduate student's life is all one weary grind. However, it has a few bright spots. There is a Graduate Students' Association, which holds monthly social gath-erings, where one can brush away the cobwebs from the neglected corners of his brain and learn what his fellow-workers are doing. There are, too, several clubs in the various departments, which, though actuated by the thirst for knowledge primarily, yet have a spice of good fellowship and sociability. Besides, there are the Journal Meetings and Semina-ries, where students can occasionally air their views in original papers. The Journal Meeting especially is an excel-lent factor in keeping us in touch with our own sphere of work. To read all the journals and sift out the wheat from the chaff which finds its way even into scientific papers—cut and dried as they may seem—is evidently a Herculean task, but by the Journal Meeting we have the important- papers presented in compact and generally interesting form, and are entertained and profited at once. An ideal method, surely. Of course we miss the jolly life of college clays, and probably we feel a little sick of the grind at first; but, like the Lotos Eaters, we soon forget the scene of our earlier efforts, when fed on the strong meat of higher thought. With us Time flies on rapid wings, and, though it seems but yesterday that we knocked timidly at the portals, already we are talking of our work with ill-concealed pride in having found another clue to the great labyrinth of Knowledge. We have tasted the waters of the Pierian spring and are ready to drink deeply. R. N. H.,'91. CONVERSATION. T F there is one thing to learn at college, it is to do critical, independent study and think-ing. "A man kens just as much as he's taught himsel', and na mair." A man's mind should become inquiring, desirous of knowing the reason for everything, accepting statements after diligent inquiry only. Yet, although we recommend independent thought, it must be remembered to examine a subject from every standpoint. No man has concentrated within himself all thought upon any question. No matter how learned he may be, there is always room to acquire more, and he can always obtain something from others. There is a want felt by a number of our students who are eager in the pursuit of knowledge, viz.: the need of conversation, as distinguished from talk. Conversation turns upon affairs of higher interest, is more serious, more intellectual, and brings forth and de-velops one's innate powers and acquirements. It is often complained that we have too much serious matter in our studies to converse with interest upon topics of worth. But the true student is always interested in his work, and one finds no trouble in conversing upon a subject interesting to him. But, outside of his studies, there is always something in which one delights, and which would be profitable and pleasing to others; certainly we could relish conversation upon some worthy topic much better than this fragmentary talk upon matters so trivial that it becomes a burden to listen. Life is a race. In the business world men are earnestly active, pursuing their plans with unceasing energy. It is true that our school days are our happy days, the days of pleasure, yet pleasure is not incompatible with diligent study. All men of power have been earnest students. At school their thoughts were high and noble, due to the purposed career before them for which they prepared themselves with unswerving fidelity. In youth are laid the THE COLLEGE MERCURY. H3 foundations of the future life. Ruskin objects to hearing the' follies of youth talked of " indulgently." " Then," he says, " must the habits of thought be begun." Therefore, we find the ambitious student sincere and earnest in his work. He is here to learn, he feels that he needs every moment to add to his development, his mind is ever open to the reception of truth and eagerly seeking it. He profits by everything of value that he hears; trivial matters do not interest him, nor those who deal in them. " Talkers," says Bacon, " are commonly vain and credu-lous withal ; for he that talkctli what he knoweth, will also talk what he knoweth not." He will choose companions with the same high aims as himself, for he receives little sympathy or encouragement from others. The selection of friends is a duty of the most important interest to us. We all need friends, those whom we know intimately, and who know us, and who can be mutual aids to each other. Before we can admit any one into our life as a friend, we must know something of him, his disposition, in what he is interested. He must be made to know us, and this can be done by our life and conversation only. It is strange how often we are acquainted with persons for years, sometimes even live with them, and yet know little of them, often look upon them as inferior, till some extended conversation reveals hidden thoughts and beauties of which we never dreamed. At college, particularly, should such friendships be formed, for they are generally the most enduring. We are told repeatedly to cultivate the ac-quaintance of men superior to ourselves, to be filled with their thoughts, to catch their spirit, to receive the benefit of their molding power upon our lives. A man grows stronger in proportion as he grapples with questions and strives for objects just a little in ad-vance of him. So the acquaintance of men superior to ourselves elevates our standard of excellence and instills the ambition to attain to it. Young men go to our universities to come into contact with the great minds of the age, but better yet is it to cultivate the friendship of fellow-students superior to ourselves. The greatest of Greek philosophers said that there are ideas in every man, thoughts latent, of which he himself is absolutely ignorant, and that he who can draw these forth confers an inestimable benefit, and is profited himself. No one can do this so well as a companion with kindred ideas and filled with the same desire to learn. The human mind is closed to most truths, and remains in total ignorance of them till opened by some agency. We are aiming at the fullest development and widest expansion of the mind; for this a plentiful introduction of ideas is necessary. Study and reading partly supply these, but what and how to study and read ? And even then we do not sap a subject thoroughly. Everything looks a little different when passed through the prism of other minds, and the suggestions of others are continually opening to us new fields of thought and inquiry. It is impossible to travel over the entire field of human knowledge; all that a man can do to-day is to specialize, yet considerable can be learned in almost every department if properly sought. He is wise who in his daily contact with his fellows extracts from each the gist of what he has learned, perhaps, by severe study. Much ground must be traversed to acquire a few truths which can be learned in a short conversation. How often in our classes a student is asked his opinion upon a certain point, and cannot give any. True, to give an intelligent opinion upon any subject requires a thoughtful and dili-gent study of it, yet, with our limited knowl-edge, if before recitations the points in the lessons were discussed and conclusions drawn, we feel sure that not only when asked for an opinion would it be forthcoming, but a good habit also would be formed. Wherever we may go among young men, it 144 THE COLLEGE MERCURY. seems necessary to become acquainted with the slang expressions in use among them. Fortunately, we need not form friendships with them. We believe that all lovers of good English concur in the wish that the aesthetic nature of man be cultivated. Slang is so habitual with a great many of our young men that it is difficult for them to find expression in good English. Conversation upon interest-ing and important topics, we believe, would accomplish this if entered upon for the pur-pose of mutual benefit. Do not fear, either, to use big words if they express the thought exactly. Men with little ideas may use little words habitually. " Conversation maketh a ready man." No power is of any value unless it can be used. We are not disciplining our minds to make them mere reservoirs for the reception of knowledge, but we want to use them. The ability upon occasion to call to mind whatever we may have learned, and which is possessed by few, is well worth striving after. Telling something we know, too, makes it sink still more deeply in our memories. Good manners, it is claimed, will serve as an introduction to the best society everywhere. This is certainly to be desired. But the kernel of good manners is a good heart, and their adornment, a cultivated mind united with en-gaging conversation. Brilliant conversation of itself, no matter how unprepossessing may be one's appearance will attract and make friends. " People used to say that they never knew what conversation could be till they had heard Carlyle, seated at his table with his pipe." Mirabeau, although rough and brutish in ap-pearance, charmed every one with his brilliant conversation and was passionately admired, particularly by the women. We have spoken only of the value of con-versation to ourselves ; its influence upon oth-ers is without limit. For these and many other reasons which might be given, we think that the art of conversation should be culti-vated. A. F. G. '97. THE MUSICAL CLUB'S TRIP. /^N Friday, December 8th, the Glee, Banjo, ^^ and Mandolin Clubs of the College filled their first engagement outside of Gettys-burg at Westminster, Md. The Club left the Western Maryland depot on Friday morning in a special car gayly decorated with college colors and banners. Although crippled to some extent by the absence and sickness of some of their members, they felt not the slightest hesitation after the success of their entertainment given in Brua Chapel the week previous. The programme, although not rendered in the style in which the boys could have de-sired, was nevertheless received with high favor by the delighted audience. Odd Fel-lows' Hall, the only building of the kind in the town, although small, was packed with Westminster's wealthiest people and hand-somest girls and with the students of Western Maryland College. After the entertainment, a surprise of a most agreeable nature awaited the boys in the shape of a reception tendered the Clubs by Mr. H. M. C. Claybaugh, Esq., and wife. When the boys arrived at the residence of their warm-hearted host and hostess they were met by a bevy of twenty-five of Maryland's fairest daughters. Here a most enjoyable evening was spent, which came to an end only too soon, and at 12 o'clock the boys left, filled with praise for the hospitality of Westminster's citizens and its attractive ladies. Early next morning the boys assembled at the train, bid-ding good-bye to their genial host and newly-formed friends, and as the train pulled out of the station and the last looks were taken at the receding town many a staunch Pennsylva-nian was heard softly singing, " Maryland, my Maryland," and all agree that the trip to Westminster was by far the most enjoyable ever taken by the Clubs. One week later, on Friday, December 15th, the Banjo and Mandolin Clubs gave an enter- THE COLLEGE MERCURY. 145 tainment in Zion Lutheran Church, of Harris-burg, under the auspices of the Luther Union. The large Sunday-school room was decorated with orange and blue, and was crowded with an inspiring audience, whose enthusiasm for the college and appreciation for the music was evidenced in many ways. Although, on account of death, the reception that had been planned was not given, yet the boys spent a very enjoyable time in the city noted for its beautiful women. This trip to Harrisburg has revealed the fact that we have legions of friends there, and it is quite sure that when the entire organization takes its trip to Harrisburg in January a warm reception will be given them. The concert which was scheduled for Han-over, December 19th, was postponed until a later date. THE TRUSTEES MEET. A. SPECIAL meeting of the Board of Trus-tees of Pennsylvania College was called for last Thursday evening. There was a full attendance. The meeting was called for the purpose of receiving and acting upon the report of,the Special Committee (Graff, Albert, Baum, Dun-bar, and McPherson), appointed at the annual meeting upon the action of certain Synods which criticised the resolutions of the Board passed in June, 1892, when establishing the Strong Professorship of English Bible and Chaplain, and which asked for Synodical representation in the Board of Trustees. The report of the Committee was fully considered in detail, amended, and adopted as follows with entire unanimity: Resolved, 1st. That the Board most earnestly repudiates the construction placed upon its action, when establishing the Strong professorship, as an entire misconception of the intent thereof, and the Board deeply deplores the fact that the misconception has caused misunderstanding, and has given wholly unnecessary alarm as to the status of our Col-lege. 2d. That the Board maintains the principle involved in its action, viz.: No denominational teaching in the class work required of all students of the College, with ample provision for the teaching of Lutheran doctrine by the Chap-lain to all students who may be willing to receive it, as the proper policy for the administration of our College, as in ac-cord with the policy pursued by all our Colleges and by this College from its beginning, and as entirely consistent with the Lutheran status of this College. 3d. That with a desire to remove all occas'on for uncer-tainty, we add the following statement to Item III of former action : " It is to be u iderstood that this action shall in no way be regarded as affecting the status of the College as a Lutheran Institution." In regard to the Synods who have requested representation by Synods in the Board of Trustee's of the College, and have asked for such modifications of its Charter as will enable them to secure in that form definite Synodical representation with rotary membership, the following resolutions were adopted: Resolved, 1st. That while we cannot see our way clear to grant the request of the Synods referred to, in the precise form in which it is made, we direct, in order to allay all un-easiness in regard to the Lutheran control of the Institution, and to give assurance thereof, the officers of the Board to apply to the Court of Adams County, and to ask the inser-tion in Section 6 of the Charter, after the words " Board of Trustees," where they first occur, the words " of whom not less than three-fourths shall always be members of the Lutheran Church." 2d. That the Board in filling vacancies as they from time to time occur, will, by the election of new Trustees, secure as far as possible a ratable representation to all Synods in its territory, especially to such as give to the College their undivided support. All the above action was adopted by the Board with unanimity, and having been sub-mitted to the Faculty, it was concurred in by them, who each and all agreed to accept this action in its entirety as a final settlement of these questions, to frown upon all agitation to unsettle it, and to use their best endeavors to overcome existing discontent and to restore confidence in the College. The meeting of the Board was looked for-ward to with anxiety, owing to the feeling which had been aroused, and the happy and unanimous solution of all the difficulties which confronted the Board led to general congratu-lation upon the result. Rev. Dr. McKnight, President of the Col- 146 THE COLLEGE MERCURY. lege, presented to the Board, on meeting, his resignation of the Presidency, to take effect on April 1st, 1894, in order to enable him to ac-cept the call to become pastor of St. Paul's Evangelical Church at Easton. This matter was duly considered in all its aspects, where-upon the Board unanimously declined to ac-cept it and requested its withdrawal. To this request Dr. McKnight on Friday morning as-sented. On motion the Board expressed its satisfac-tion at the pleasure and profit afforded the students last year by Rev. Dr. Huber's course of lectures on Luther's Shorter Catechisms, and requested a repetition of them this year, and that they may be made a feature in his course of instruction. Adjourned.—Star and Sentinel. eOLLEGE LOCALS. ORVILLE L. SIGAFOOS and WILMER A. HARTMAN, Editors. TPIE Preparatory department closed on the 15th ult. The verdancy of the Freshmen is only surpassed by their originality. This was shown by their holding their last class meeting on the steps in Recitation Hall. A midwinter athletic contest will be held in the Gymnasium. Some of the students are already practicing for the event. Fassold, '95, and Brosius, '95, were called home before the close of last term because of the deaths of relatives. Dr. Baugher attended the meeting of the International Sunday-school Committee last month at Boston. The College Banjo and Mandolin Clubs furnished music at a concert in Zion's Lutheran Church, Harrisburg, on Friday evening, Dec. 15th. Owing to the illness of Physical Director Aukerman, Weist, '95, conducted the class drills during the closing weeks of last term. Dr. Menges has fully recovered from his illness and is again about his duties. Mrs. DeYoe, of Harrisburg, and Miss Mc- Knight, of Brazil, are the guests of Dr. and Mrs. McKnight. The musical organizations have several tours in prospect during the present term. Sickness prevailed to a larger extent in col-lege during the closing weeks of last term than for a number of years. Owing to a num-ber of students being confined to their rooms and several returning home because of sick-ness,, the opinion became prevalent that ex-aminations would probably be omitted. This hope of the students was partly realized by the action of the Faculty, in that only two exami-nations would be required of each.class. Those two subjects were chosen which came on Monday and Tuesday mornings in the sched-ule of recitations. The following were the branches: Seniors, Astronomy and Political Economy; Juniors, English and Latin ; Sophomores, Greek and Latin; Freshmen, Greek and Latin. A large audience gathered in Brua-Chapel on Friday evening, Nov. 24th, to listen to the initial concert of the College Glee, Banjo and Mandolin Clubs. The reputation which the Clubs had established during past years added to the faithful practice since the opening of college, united in stimulating interest in the occasion and in arousing the expectation of the auditors for the rendering of a musical programme of a high order. Neither were they disappointed. Ample evidence was given of the enjoyment of the programme by liberal applause and repeated encores. The following is the programme in full : PART FIRST. 1. The Water Mill, Macy. GLEE CLUB. 2. Newport Galop, Jennings. BANJO CLOT. 3. Danube Waves Waltzes, Arr. by Maxcy. MANDOLIN CLUB. 4. Down by the Riverside, Shepard. MR. KLINE AND GLEE CLUB. 5. Virginia Bells, Lansing. BANJO CLUB. 6. Medley, . GLEE CLUB. PART SECOND. 1. Gettysburg College Medley, Arr. by Baum. MANDOLIN CLUB. 2. Minstrels' Carnival, Grover. MESSRS. ECKELS, HERSH, BIKLE, IIERR. THE COLLEGE MERCURY. 147 3. A Southern Zephyr, Arr. by Hersh. BANJO CLUB. 4. My Old Kentucky Home, Foster. MR. W. H. NICHOLAS AND GLEE CLUB. 5. Flash Galop, Lansing. BANJO CLUB. 6. Evening Bells, Sheard. GLEE CLUB. The rumor of Dr. McKnight's possible resig-nation of the Presidency has been received with universal regret by all connected with the institution. A mass meeting of the students was held Thursday afternoon, December 14th, in Brua Chapel, for the purpose of inducing him to remain. Strong resolutions were unani-mously passed asking the Board of Trustees not to accept it, should it be presented. The Proctor wishes to announce to all the students that, with the beginning of this term, all absences from the required services must be accounted for within two weeks after the time. All excuses presented after the stated time will be refused. Some excuses that have hitherto been considered valid will not be ac-cepted hereafter. The lecture course tickets will be on sale in a day or two. Have your order and money ready when the Committee comes around, and patronize the Y. M. C. A. to the best of your ability. Dr. S. to M., '94—" What characterizes mountain air ?" Mr. M.—" It is very embracing." Dr. S.—" How does it effect the heart ?" Mr. M.—" It produces lung disease." Dr. N., in Freshman Class, Mathematics— " Is there a man that don't see that proof?" Co-ed.—"/don't, Doctor." R., '95, to W., '95 (in laboratory)—"Say, Werty, do you have to dilute the distilled water before using it ?" A " Prep." has signified his intention to join the " Philo. Debating Fraternity." We were in hopes that higher critics would ever stand aloof from the Lutheran Church, but were surprised to find H., '94, in a recent recitation, asserting himself in that direction. He expounded at considerable length in " Evi-dences " on Saul of " Tyrus." Dr. N. (in astronomy, on Monday morning) —" I was reading up a lunar theory last night " —(quickly correcting himself)—" Oh ! no, not last night! It was night before last." Prof. H. to M., '94—" Is this law which we are speaking of universal ?" Mr. M.—" Well, yes, sir, it's universal to some extent." The cause of the frequent tardiness of K., '94, has ever been a problem beyond the solu-tion of the students. This is Dr. N.'s expla-nation, which he gave to the Seniors recently: " Mr. K., having charge of the Observatory, goes on Observatory time, and Observatory time is slower than college time." That trip of the musical organizations to Westminster last month was one conspicuous for jokes at the expense of the boys, if nothing more. One of the young ladies asked " why they carried a Jew along ?" Another declared that those cheeks of S., '97, were painted. Two of the members who had been assigned lodg-ings at a distinguished townsman's house were met by the Senator himself when they rang for admittance. After a survey of the duet, his majesty remarked that he did not have any marriageable daughters, and then sent them to the hotel. The effect, according to their own statement, was so appalling they " couldn't eat any dinner." A certain lady asked the manager to send two of the finest gentlemen in the clubs to her house. Ask the manager who was there, and then ask one of the other fellows what the lady afterward remarked concerning her guest. Dr. S. to Mr. V., '94—" How would you test for hard water?" Mr. V.—" Dissolve a little of it in alcohol, and then use a viscid filter." " Our Pearlie " wishes to find some facts in the Life of Luther. Picking up Grote's History of Greece, he remarks, triumphantly: " That is just what I want." Failing in this, he ex-plores Geike's Hours with the Bible. He is now perusing Skeat's Etymological Dictionary. Dr. H. speaks about the strangeness of the fact that there were no Smiths among the Israelites. Strange community! Y. M. C. A. NOTES. The Y. M. C. A., on December 14th, held its last business meeting of the term. Owing to the absence of quite a number of the mem- 148 THE COLLEGE MERCURY. bers of the different Committees, the reports of committee work usually given at that time were deferred, and may be expected early next term. The funds belonging to the Association were ordered to be invested in such a manner as to yield an increased amount of interest. We hope, during the coming year, to make addition to these funds, which will be eventu-ally appropriated to the erection of a suitable Y. M. C. A. building. A hearty and liberal patronage of our lecture course will help, we trust, to accomplish this. The Association deplores the possible inter-ference with its lecture course by a prior entertainment in the chapel, and trusts that there will be no conflicting of interests. With the beginning of a new year and a new term, let us anew exert our efforts in winning young men for Christ, as that is our mission in college. A retrospect of the past term shows much for our encouragement, and Gettysburg College is far better with than she would be without this organization. GENERAL COLLEGE NEWS. The November number of the Ohio State Inter-Colegiate Record contains a full-page cut of Recitation Hall of Gettysburg College.' That co-education is making a wonderful advance is shown by the fact that 500 women are in attendance at the University of Michigan. Lehigh University has in prospect one of the finest Laboratories in the world. It will cost $200,000. The large colleges of the country as to the number of students stand in the following order: Harvard, Johns Hopkins, Cornell, Columbia, and Yale.—Ex.' Yale recitations have been changed from one hour to 50 minutes.—Ex. There are 430 colleges in the United States, with 122,523 students.—Ex. Dartmouth has turned out 40 College Presi-dents, 200 College Professors, 60 members of Congress, and 24 Governors.—Ex. The college yell is a purely American inven-tion, and is unknown in other countries. In England the students simply cheer or scream the name of the college or university. No attempt is made at a rhythmical, measured yell as in tliis country.—Depauw Weekly. Improvements of the near future at Yale are a covered base-ball ground and a campus lighted by electricity. " Young gentlemen," said a Professor to his class in Evolution, " when I am endeavoring to explain to you the peculiarities of a monkey I want you to look straight at me."—Ex. Caps and gowns have been adopted by this year's Senior classes at Amherst, Dartmouth, Harvard, Lafayette, Princeton, Williams, and Yale. German boys are said to be the strongest intellectually in the world, Irish boys the wittiest, French boys the cleverest, and American boys the brightest.—Ex. The New University of Chicago already has over 1,000 students.—Ex. THE MERCURY is pleased to add to its list of exchanges The Radiator, published by the A A 2, fraternity of the Hillhouse High School of New Haven, Conn., and the Echo of the Illinois Wesleyan University, both of which are excellent journals, published in an attrac-tive form and full of interesting college news. Muhlenberg College is agitating a move-ment which will do away with the afternoon recitation and transfer it to the morning. The Bucknell Mirror is now issued semi-monthly. In the past 25 years 19 college buildings have been added to the Princeton campus. In the last seven years Yale has scored 886 points to her opponents' 88 on the foot-ball field. James Kitchens, of the class of 1819, of the U. of Pa., is the oldest living college graduate. Miss S.—" When 1 was a child I spake as a child, but now that I am a man, or very nearly one, I act as a man."—Ex. The largest salary which any college pro-fessor receives is $20,000, the annual income of Prof. Turner, of Edinburgh. THE COLLEGE MERCURY. 149 Governor Pattison of Pennsylvania deliv-ered an address on the " Higher Education of Women" at the recent dedication of the " Latin School" of the Woman's College of Baltimore. " Where are you going, my pretty maid?" " I am going to college, sir," she said, " For I am an ambitious gay co-ed, And I am going to college, sir," she said. " And what is your fortune, my pretty maid ?" "To be independent, sir," she said, " And able to earn my butter and bread By what I learn in college," she said. " I believe I will marry you, my pretty maid." " Oh ! no thank you, no thank you, sir," she said, " You are wealthy and worldly, but not well-bred, Not manly as college boys, sir," she said. S. M. G. in The Occident. The registering of the Freshman classes at Yale has been completed, and the lists show 380 students in the academic and 222 in the scientific department. Over 9,000 students attend the University of Paris. The Class of '93, University of Michigan, numbered 731, the largest ever graduated from an American college. Yale, Harvard, Brown, Princeton, Leland Stanford, Cornell, University of Wisconsin, and University of Michigan now publish daily papers, and the University of Pennsylvania will begin the publication of one soon. Man wants but little here below, Is a sentiment we love, And, judging by his conduct here, He won't get much above. ALUM/SI. FRANK E. FICKINGER, Editor. '41. Rev. Henry Baker, D. D., one of the oldest living Alumni, who was stricken with paralysis about two weeks ago, is gradually passing away at his home in Altoona, Pa. '46. The Philadelphia Ledger, of Friday, December 1st, contained a portrait engraving of Rev. W. M. Baum, D. D., pastor of St. Mat-thew's, together with a very full report of his Thanksgiving sermon. '55. Revs. O. G. Klinger, '86, and Eli Huber, D. D., '55, addressed the Christian Endeavor Convention of Adams County, Pa., at Arendts-ville, Pa., lately. '56. Rev. G. W. Leisher, of Duncannon, Pa., has accepted a call to the Boalsburg charge in Centre County, Pa., lately served by Rev. Wm. A. Trostle. '56. Rev. J. W. Schwartz, D. D., of Worth-ington, Pa., informs us that at a meeting of his Synod action was taken to organize a Western Alumni Association, and that a meeting will soon be called for that purpose at Trinity Lutheran Church, Allegheny, Pa. '57. Dr. H. L. Baugher will preach in St. Mark's Lutheran Church, the one formerly served by Dr. C. S. Albert, on the first Sunday of the new year, January 7th. '57. The committee on the Revision of the Hymnal portion of the Book of Worship of the General Synod met recently in Dr. D. M. Gilbert's church in Harrisburg, Pa. The com-mittee consists of Drs. Gilbert, H. L. Baugher, '57 ; W. E. Parson, '67 ; Rev. H. B. Wile, '77, and Rev. E. H. Delk. The next meeting will be held some time in February, probably in Gettysburg. '59. Rev. J. G. Goettman, D. D., of Alle-gheny City, Pa., attended the December meet-ing of the Board of Church Extension, in the interests of several missions in the Pittsburgh Synod. On Sunday, November 26th, 1893, he celebrated his 30th anniversary as pastor of Trinity Lutheran Church of Allegheny. '61. Rev. M. L. Kunkleman, of Norcatur, Kan., has accepted a call to Wayne, Neb., and will,take charge there in the near future. '61. On Tuesday evening, December 5th, Dr. J. B. Reimensnyder, of New York, deliv-ered an address in the " Morgan Lecture Course" before the faculty and students of Auburn Theological Seminary on " The Sig-nificance of the Lutheran Church for Chris-trianity." '62. Hon. F. E. Beltzhoover has lately in-troduced a bill into the House of Representa-tives for the transferring of the Pension Bureau from the Interior to the War Department. '63. Dr. Enders, of York, being sick with the grippe, Dr. E. J. Wolf filled his pulpit on the 10th inst, preaching and holding communion in the morning in German, and at night preach-ing in English and conducting a large English communion. ISO THE COLLEGE MERCURY. '65. Dr. J. C. Roller's congregation, Han-over, Pa., celebrated its 150th anniversary by-appropriate services during the entire week of November I9th-26th. Quiteanumberaidedthe pastor in the jubilee services, prominent among whom were Drs. H. L. Baugher, L. E. Albert, E. J. Wolf, Charles E. Hay, and Rev. J. J. Al-bert. The history of the church is varied, but of continued prosperity, and the congregation is a glory to the denomination to which it belongs. '66. A. J. Riley, Esq., who declined the ap-pointment as President Judge of Blair County, is now Solicitor of the Pennsylvania Railroad Co. '67. Rev. Dr. Charles S. Albert was pre-sented with a purse containing $250 in gold by the congregation of St. Mark's Lutheran Church, of Baltimore, at the reception tendered himself and family before leaving for Phila-delphia. '69. The new Lutheran Church at Daven-port, Neb., was dedicated on November 12th, Rev. J. A. Clutz, D. D., president of Midland College, preaching the sermon. '73. Rev. J. F. Hartman, of Altoona, Pa., has been appointed to and accepted the editor-ship of the Keystone Christian Endeavor Herald. '73. Rev. T. J. Yost, of Altamont, N. Y., has received a call to the Lutheran Church at Montoursville, Lycoming Co., Pa. '73. Rev. VV. S. Freas, D. D., has been elected pastor of St. Mark's Lutheran Church, Baltimore, to succeed Dr. Charles S. Albert, but has declined the call. Dr. Freas is presi-dent of the Board of Church Extension, and secretary of the General Synod, and has had a highly successful pastorate at St. Paul's, York, Pa. Dr. Freas recently celebrated the eighth anniversary of his ministry in York, Pa. '75. Rev. E. D. Weigle, of the First Luth-eran Church, of Altoona, Pa., preached the annual Thanksgiving sermon before Pride of Mountain City Council, No. 472, and Coun-cil No. 152, Junior Order United American Mechanics. '78. Rev. Albert E. Bell, of Boiling Springs, Pa., has been unanimously elected pastor of St. Mark's, York, Pa., recently made vacant by the resignation of Rev. Mr. Bowers. It is hoped that Mr. Bell will accept the call. Un-til a pastor arrives upon the territory, Rev. Wm. C. Bare, '93, will be in charge. '79. Rev. Luther Kuhlman's congregation at Frederick, Md., are improving the parson-age by having another story added to it. '80. Rev. George S. Bowers, late of St. Luke's, York, Pa., preached his opening ser-mon at St. Mark's, Hagerstown, Md., on Sun-day, December 3d. '82. Rev. J.E. Zerger, of St. Paul's Church, Leetonia, O., has resigned, to take effect Feb-ruary 1st, 1894, and accepted a unanimous call to the Lutheran Church at Mt. Holly Springs, Pa., this change having become nec-essary on account of the health of Rev. Zerger's family. '83. Rev. George W. Baughman, of Everett, Pa., has accepted a call to the Uniontown charge in Maryland. '83. L. A. Brewer has been elected treas-urer, and is one-sixth owner of the Republican Printing Company, of Cedar Rapids, la. '84. Rev. Andrew S. Fichthorn, a few weeks since, resigned as secretary of the P. R. R. branch of the Y. M. C. A. at Tyrone, Pa. The following week he was unanimously elected secretary of the Association at Washington, Pa., at an annual salary of $1,000. This call he declined, preferring the work of the active ministry. His health is now fully restored, and he is well qualified in every way to do good work in any field. '85. Rev. G. G. M. Brown has removed from Union Bridge, Md., to Everett, Bedford County, Pa. '88. The members and many kind friends of Grace Lutheran Church, Canal Dover, O., tendered their new pastor and wife, Rev. John J. Hill, a very fitting reception on Thurs-day evening, November 16th. '89. Rev. C. B. Etter, of the Second (St. Paul's) Church, Akron, O., has been tendered a call to the pastorate of the Sharon Charge, near Wads-worth, O., and will probably accept. '90. Rev. F. S. Geesey, ofthe Trinity charge, York Co., Pa., was installed on last Sunday, December 10th. '90. Rev. G. H. Reen, pastor of St. Luke's at Mansfield, was installed on Sunday, Novem- THE COLLEGE MERCURY. I5i ber 26th. Dr. L. A. Gotwald, '57, delivering the charge to the pastor in the morning, and that to the people in the evening. '91. Schmucker Duncan, now pursuing a course in Philosophy at Yale, spent the Christmas holidays with his mother at home in Gettysburg. '91. Rev. A. Pohlmann, recently appointed missionary for the Lutheran Church to Africa, has been making a tour through the churches of Eastern Pennsylvania, talking in the interest of missions. He recently addressed large crowds of students at the Clarion State Nor-mal School. '91. Frank Swartz, at present a student in Hartford Theological Seminary, spent Thanks-giving week with his parents in Gettysburg. '91. Rev. A. C. Stup is to be addressed at Asheville, N. C. '93. Honor Luffer Wilhelm is the editor of an interesting college paper and one that should be in the hands of every student.— T/ie Inter- Collegiate Record. Little grains of sand, Drops of H20, Make the mighty sugar trust, And the broker's dough. F-RTVTE-RNITy /NOTES. PAUL W. KOLLER, Editor. PHI KAPPA PSI. Bro. Lutz, '94, spent his holiday vacation " doing " Baltimore, Washington, Philadelphia, and New York. Bro. Keffer, '95, visited friends in Pittsburgh during most of the Christmas holidays. Bros. Carty, '96, and Graff, '97, are about again after a brief illness. Bro. Claybaugh, 'yj, gave a reception to the musical clubs at his home in Westminster, Md. PHI GAMMA DELTA. Bros. Rietz, '95, and Aukerman, '97, were compelled to leave college before the close of the term on account of sickness. Bro. Herr, '97, also went home with an attack of the grip, but returned for the examinations. Bro. D. F. Garland, '88, spent a short time in our midst recently. His church is growing wonderfully and the entire section of the city in the neighborhood is being built up. We are represented on the musical clubs this year by the following men : On the Glee Club—Bro. Fickinger; on the Banjo Club— Bros. Baum and Fickinger; on the Mandolin Club—Bros. Wert, Herr, Baum, and Fickin-ger. Bro. E. E. Blint, '90, pastor of the First Lutheran Church of Littlestown, Pa., paid a visit to Gettysburg with his wife a short time ago. Bro. S. B. Martin, '90, spent his Christmas vacation with his parents in Gettysburg. Bro. D. A. Buehler, '91, is at present at home, having severed his connection with the firm in which he has been employed for the last two years. SIGMA CHI. A chapter of Sigma Chi is being organized at the University of Chicago. Sigma is one of the five Greek-letter societies which have thus far taken possession of this new fraternity territory. Bro. McPherson, '83, spent several days last month visiting friends in Baltimore. Bro. Hersh, '91, has removed his law office to the rooms in the Star and Sentinel Build-ing on Baltimore Street. Bro. Damuth, '92, spent part of his vaca-tion as the guest of friends in Harrisburg. Bro. Olewine, '97, was called home on busi-ness before the close of last term. Bro. Trowbridge, '82, who was compelled to relinquish his duties for a season as pastor of St Paul's Church, Baltimore, because of ill-ness, has returned to his pastorate after a rest, much improved in health. ALPHA TAU OMEGA. Bro. Lewis Gehrhart, '85, of Martinsburg, West Va., spent Thanksgiving in Gettysburg. Bro. Gehrhart, in connection with his law prac-tice, is editing the Martinsburg Independent. Bros. Hutton, Cable, and Menges spent Thanksgiving at home. Bro. G. G. M. Brown resigned his charge at Union Bridge to accept a call from the con-gregation at Everett, Pa. 152 THE COLLEGE MERCURY. Bros. H. G. Mentzer, '87, and J. C. Clug-ston, '89, have formed a partnership, having purchased a drug store in Waynesboro, Pa., where they will do business under the firm name, Mentzer & Clugston. Bro. Mentzer is a graduate of the Philadelphia College of Pharmacy, Bro. Clugston a graduate of the Baltimore Pharmaceutical College. Chapters have recently been established at the Polytechnic Institute, Terre Haute, Ind., and at the University of Nebraska, Lincoln, Neb. ATHLETICS. HENRY E. CLARE, Editor. THURSDAY, November 30th, our team closed the foot-ball' season with a very creditable game with York Collegiate Institute at York, Pa. The game proved an easy vic-tory for our team. After a few ineffectual on-slaughts the York men despaired of making any impression on our line or of running the ends. Punting was then resorted to, with veiy little effect, although the York full-back, Van Baman, did some fine work. In this way only couldtheyput the ball on our territory, and then only momentarily. Our men had no difficulty in breaking through their line or running the ends. Emmert made some veiy long runs, as did Mottern. The bucking of Apple was very effective. Manifold did the great playing for York. The teams lined up as follows : GETTYSBURG. POSITIONS. YORK. McCartney, left end, Manifold. Byers, left tackle, Williams. Tholan, left guard, Polack. Rank, centre, Anderson. Becker, right guard, Randolph. Minges, right tackle, Crider. Earnest, right end. Diehl. Emmert, left half-back, Jessop. Mottern, right half-back, Crider. Nicklas, quarter-back, Keyworth (McEall) Apple, full-back, Van Baman. Score : Gettysburg, 24; Y. C. I., o. In this game only five of the regular players participated. The other positions were filled by those who had never played in a regular game. The score shows that they filled their places with credit. This season, which opened so creditably in a game with Cornell' University at Ithaca, N. Y., has proved to be probably the best in the history of foot-ball at this college. With unprecedented difficulties and obstacles in the way of success, the team has made a record that is a credit to themselves and the college. Several times the team played in a condition that hardly justified their playing, but a defeat was considered more honorable than the cancelling of a game. The team played eight games. Three of the opposing teams were university teams, and two of them rank among the best in the land. The games won were two from Dickinson, one from Washing-ton and Jefferson College, one from York Col-legiate Institute. One tie game was played with F. & M. Those lost were with University of Pennsylvania, Cornell University, and Buck-nell University. From the pecuniary standpoint, the season has not been so profitable. As matters now stand, we are considerably in debt. The cause has not been patronized as it should have been by the students. But the principal cause of our indebtedness is the lack of an athletic field. Money was lost on every home game, not be-cause we failed to draw large crowds, but because we could not get them to pay when they could see the game for nothing. This is our great drawback. It is necessary now to work earnestly. All subscriptions should be paid at once, as well as term dues. Our debts must be met, and the fact that not a cent has-been added to the Athletic Field Fund for an age shows us conclusively that no one takes enough interest in us or our noble cause to help us out of the difficulty. We must do it ourselves. It would be unfair to allow this number of THE MERCURY to go to press without saying a word about Manager Kloss. All who have watched our varying fortunes this season could not help seeing that a great part of our success was due to his indefatigable efforts and un-abating interest. He deserves the thanks of all for his labors. Twenty-six players participated in the differ-ent games of the season. To give an account of the playing of each one would require more space than can be allowed, and probably would not be interesting to the majority of the readers. On the other hand, to make mention of a few and leave unnoticed others who equally deserve praise for the faithfulness and zeal with which they performed their duties would be unfair. THE COLLEGE MERCURY. 153 In order to avoid this, only the touch-downs and the players who made them will be men-tioned. During the season 15 touch-downs were made, giving us 80 points : First game with Dickinson—Aukerman, 3 ; Keefer, 1. Bucknell—Aukerman, 1. Washington and Jefferson—Keefer, 3. Franklin and Marshall—Aukerman, 1. Second game with Dickinson—Keefer, 1. York Collegiate Institute—Mottern, 3 ; By-ers, 1 ; Emmert, 1. Total, 15—Aukerman, 5 ; Keefer, 5 ; Mot-tern, 3 ; Byers, 1 ; Emmert, 1. Gymnasium work has begun in earnest. All seem to be pleased with the work of Director Aukerman. It is to be hoped that this very important part of athletic training be not neglected, and that good and well-trained ma-terial may be developed for our coming seasons. At a recent meeting of the Athletic Associ-ation, the advisability .of chartering the body was referred to the Advisory Committee. There was a young man from Ky., Who at gambling thought he was a dy., But he altered his mind, After trying to find, The ace, with a monte-man ly. TOW/S 7VND SEMI/NTVRy. ROSCOE C. WRIGHT, Editor. TOWN. BY the will of the late Mrs. Sarah Eichel-berger, of Gettysburg, the college, with the " College " Church, is made residuary legatee. It is supposed that each of these will realize about $1,500. Her husband's will adds $2,000 to the funds of the college, and about $22,000 to the endowment of the seminary. These bequests from citizens of the town are very gratifying to the friends of the institution, and it is to be hoped that others will follow this good example, and so arrange their wills that these noble institutions will be helped to much needed equipment and teaching force. Postmaster Kitzmiller's commission expires on January 27th. Ex-County Treasurer Rufus E. Culp, R. M. Elliot, and ex-Prothon-otary George L. H. Grammer are the appli-cants for the position. Murderer Heist, who was to have been hanged here on December 14th, has made a statement in which he places the guilt on a man named Reese. His attorney has secured a reprieve from Governor Pattison un-til January 17th, during which time he will make an effort to secure a commutation of the sentence to life imprisonment. The Sunday-schools of the town held ap-propriate Christmas services. Those con-ducted by the students in the country held theirs before vacation. Dr. Breidenbaugh made an analysis of the stomach of Associate Judge Donohue, who died so mysteriously a short time ago, and found strychnia in sufficient quantity to cause death. The coroner's jury rendered a verdict that he had come to his death at the hands of an unknown person. The County Commis-sioners offer a reward for the arrest of the person. The schedule on the Phila. & Reading road is even more inconvenient than that of the old Gettysburg & Harrisburg railroad. The college musical clubs furnished the music for the evening sessions of the Institute. This was the most successful Institute ever held in Adams County. No services were held in the College Church on Sunday, December 17th, on account of diphtheria in the family of the sexton who occupies a portion of the building. Mr. Chas. Young, Gettysburg's talented young artist, has received liberal praise from the Art Editor of the Pldladelphia Inquirer. Mr. William B. Duncan, of Arkansas, has returned to his home after a pleasant visit to relatives and friends here. Miss Richards, daughter of Rev. Dr. Rich-ards, of Muhlenberg College, visited her aunts, the Misses McClean, the latter part of the term. Prof, and Mrs. Huber G. Buehler, of Lake-ville, Connecticut, are visiting Mrs. Buehler's parents, Dr. and Mrs. E. J. Wolf. Mr. Chas. Shapley, father of Mr. J. S. Shap-ley, of the Class of '90, died in Carlisle, De-cember 18th. 154 THE COLLEGE MERCURY. SEMINARY. The Seminary closed Monday, December 4th. Two cases of fever caused much anxiety among the Theologues. As a result the Faculty thought it best to close the term im-mediately. It is reported that a Harrisburg paper has published a letter from John C. Grimes, of the Junior Class, who disappeared so mysteriously last term. The letter is written to his father from Chicago. Rev. Dr. E. J. Wolf has an article on the " New Doctrine " in the New York Independent of December 14th. Mr. W. S. Oberholtzer and Mr. Edgar Suth-erland recovered from their sickness in time to spend Christmas at their homes. The work on the foundation of the new building progresses rapidly when the weather permits. Mr. E. E. Parsons, of the Junior Class, supplied the pulpit of Fourth Lutheran Church of Altoona during vacation. Rev. M. L. Tate, of the Senior Class, preached in the Lutheran Church of Bellwood during vacation. Mr. N. F. Bare, of the Junior Class, will preach in the Lutheran Church of Boiling Springs until a pastor has been secured. Bishop Daniel Payne, at one time a student in Seminary, and the oldest Methodist Bishop in the world, died at Wilberforce, Ohio, recently, aged 72 years. LITE-RTVRy SOCIETIES. WALDO D. MAYNARD, Editor. OF the many advangages which the literary societies afford to the students, those gained from the reading-rooms are of no little consideration. Here are to be found the leading newspapers, such as the Philadelphia Press, New York World, and many others of equal importance, together with the best magazines published. These rooms are main-tained for the convenience of the students at a considerable expense. Most of the students appreciate these privileges. There are, how-ever, some who are not only unappreciative of them, but even abuse them. It is next to an impossibility to keep Puck and Judge or the illustrated papers in the reading-rooms for any length of time. The Christmas number of Judge was not in Phrena. reading-rooms long enough to permit one-quarter of the members of that society to read it. Then, again, many men have an idea that this is a place for smok-ing and lounging. Men of this class make a nuisance of themselves, to the annoyance of those who wish to read. Isn't it about time that there is better decorum in the reading-room ? Many of us have only a few minutes to spend in reading the papers, and our time is too valuable to be wasted on account of the interruption of carelessness and indifference on the part of certain individuals. Again, it is unjust to expect the societies to furnish read-ing material for the monopoly of a few. We are now about to enter upon another term of work in the literary societies as well as in the other departments. The last term was considerably broken up, so that there were not many evenings for regular work. There-fore, we should tiy to make our work as interesting and profitable as possible. We hope to see some good men developed for the coming oratorial contest in June. Now is the time and the societies the place to train for the contest. There are still many men who have not as yet connected themselves with either of the societies. We would call attention to the fact that all non-society men are required to pay one dollar for the use of the reading-rooms after the first term, so from a financial stand-point it is about as cheap to be a member of a society as not to be. The two societies will continue the special meetings which have been found to be so profitable. Miss Lillie Tipton had charge of Philo. library during the holiday vacation. Messrs. Maynard, Barndt, Bell, Burger, and Clare are on the Committee to prepare special programmes for Phrena. Philo. has elected Mr. O. L. Sigafoos, '94, to fill the vacancy on Staff of THE MERCURY. ADVERTISEMENTS. Wanamaker's. What makes Wanamaker's so dis-tinctively Wanamaker's is the spirit that actuates the merchandising—all the time striving: to serve our customers better and better, shortening the road from producer to consumer and saving to patrons every possible penny of cost. How well we have done it is a matter of history, how well we shall do is what concerns us. The look is always ahead. Every part of the store shows points of unusual interest. Sporting Goods. Things for wear. Things for home helping. And there are lower-than-ever prices on many of them. JOHN WANAMAKER. SEND FOR CATALOGUE OF you^s L^D^S, NEAR. BALTIMORE, MD. This widely known, thoroughly equipped, and extensively patronized School will open its 41st Annual Session, Sept. 13th, 1893. All the Departments of a High Grade Seminary. Address, Rev. J. H. TURNER, A. M.,Principal, LUTHERVILLE, MD. PROFESSIONAL CARDS. CHJl^IiES S. DU^CA^i, '82, ATTORNEY AND COUNSELLOR-AT-LAW, Baltinxoi-e Street, GETTYSBURG, PA. CHAS. E. STffltfkE, '87, ATTORNEY-AT-LAW, Baltimore Street, GETTYSBURG, PA. DR. CHAS, B, STOUFFER, OFFICE, STAR AND SENTINEL BUILDING, GETTYSBURG. PA. fj tiber's Dr^2 Store, Baltimore Street, GETTYSBURG, PA. Prescriptions Carefully Compounded. atest Styles \r\ IS Hats, Shoes, AND Gents' Furnishings, R. M. ELLIOTT'S. N. B.—Stiff Hats made to Fit the Head in two minutes A. D. BUEHLER&CO., Headquarters for Stationery and Blank Books. LOWEST CASH PRICES. VI ADVERTISEMENTS. DECKER BROTHERS' PIANOS. Absolute Evenness of Touch, Richness and Brilliancy of Tone, Extraordinary Singing Quality, Unequaled Workmanship, Power of Standing in Tune longer than any other Piano made, are among the characteristic qualities of DECKER BROS. PIANOS, 33 Union Square, fieux Yot*k. Used in Philo. Hall at Gettysburg College. GO TO C.A.BLOCHER'S Jecxielfy Store for Souvenir * Spoons, i Sword Pins, &c. Post Office Corner, Centre Square. COLLEGE EMBLEMS EMIL ZOTHE, Engraver, Designer; and fllanafaetufing Jerjuelep, 19 SOUTH NINTH STREET, Opp. Post Office, PHILADELPHIA. Specialties: Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, and Stick Pins. Athletic Prizes. ALL GOODS ORDERED THROUGH G. Z. STUP. ADVERTISEMENTS. VI1 R. H. REININGER, fl]V[OS EC^EHT, Merchant * * *■■*'•■* Tailor. DEALER IN Hats, Shirts, Shoes, Ties, Umbrellas, Gloves, Satchels, Hose, THE BEST WORK AT THE LOWEST PRICES. Suits from $12.00 to $40.00. Pants from $4.00 to $12.00. Pocket Books, Trunks, Telescopes, Rubbers, NEXT DOOR TO POST OFFICE, Etc., Etc. UP-STAIRS. CENTRAL SQUARE. AMOS ECKERT. PETE THORNE, Shaving $ Hair Cutting SPECIAIi TO STUDENTS. pine Tailoring. Parlors JOSEPH JACOBS, 1 LXl l\J 1 0» Merchant Tailor, FmST CLASS 7VRT1STS. Chambersburg Street, (Below Eagle Hotel) CENTRAL SQUARE. GETTYSBURG, PA. FLEMMING & TROXEL, Red Front Cigar Store Billiard R. H. RUPP, Proprietor. fio. 8 Baltimore St., Gettysbufg. ANt> The place for a fine Cigar or a good Pool 'Rooms. chew. Solid Havana filler, 5 for 25c. An elegant article. BALTIMORE STREET. A FINE ASSORTMENT OF PIPES AND SMOKING MIXTURES. Vlll ADVERTISEMENTS. ESTABLISHED 1876. PE/NKOSE MgEKS, AY/dTcnndKER ™ JEWELER. Iiafge Stoek of LCiatehes, Clocks, Jexxielvy, etc., on Hand. GETTYSBURG SOUVENIR SPOONS. COLLEGE SOUVENIR SPOONS. 10 BALTIMORE STREET, GETTYSBURG, PA. Students' Headquarters IS AT J. R. STINE S. SON'S CLOTHING STORE The Cheapest Clothing and Gents' Furnishings in Gettysburg. MERCHANT TAILORING A SPECIALTY. COME AND SEE US. J. R. STINE & SON, THE LEADING CLOTHIERS, MAIN STREET, GETTYSBURG, RA. A. G. SPALDING & BROS. MANUFACTURERS OF .Athletic $> ^porting Goods OF EVERY DESCRIPTION THE NATIONAL LEAGUE BALL, BATS, CATCHERS' GLOVES AND MITTS. MASKS. BODY PROTECTORS, ETC. ETC THE SPALDING TOURNAMENT TENNIS BALL, THE SLOCUM RACKETS. RACKET COVERS, PRESSES AND NETS, COURT MEASURES, MARKERS, POLES. FORKS. ETC., ETC. Uniforms and Clothing for all Sports, Outing and Gymnasium use- The finest imported Serges and flannels. Newest Styles and Patterns. SEND FOR OUR NUW CATALOGUE'S CHICAt.O, NEW YORK. PHILADELPHIA, 10S Madison St. 243 Broadway, lojz Chestnut St. DMTLLTIELD LIVEKT. Rear of Washington House, Opposite W. M. R. R. Depot. GETTYSBURG, PA. ^W& All Kinds of Teams. Good Riding Horses. -:o:- The Battlefield a Specialty, With First-Class Guides. DAVID McCLEARY, Prop.