Suchergebnisse

[ES] El 11 de septiembre de 2001, no de los terroristas más buscados de entonces, Osama Bin Laden, sorprendía a los servicios de inteligencia americanos y de todo el mundo con la ejecución casi perfecta de un ataque planeado durante meses: las Torres gemelas de Nueva York, el centro económico del mundo, se derrumbaban una tras otras. El mundo contenía la respiración y la geopolítica mundial cambiaría para siempre. En solo tres semanas, el régimen talibán era derrocado; la posterior fase de estabilización de Afganistán pretendía ser "un desfile militar". Una vez la seguridad fuese implementada, la democracia vendría después. Un claro error. La seguridad nunca llegó, y Afganistán es hoy el país más azotado por el terrorismo del planeta. La aparición de nuevas formas de "hacer la guerra" ha experimentado una notable evolución. Si bien la guerra es una continuación de la política y este postulado, como argumenta Clausewitz, es invariable, la "manera" de hacer la guerra ha variado continuamente, especialmente en los últimos años. Afganistán, ciertamente, ha sido un escenario en el que las nuevas formas de hacer la guerra han sido una clave en el fracaso del proceso de estabilización. La pregunta que se hacen historiadores y expertos, después de tanto esfuerzo, es cual fue la causa de ese fracaso. La seguridad era un elemento importante en la estabilización, pero tanto o más era las distintas identidades tanto étnicas como políticas de Afganistán. Las influencias de las civilizaciones son claves para entender las identidades de las distintas zonas del mundo; entre ellas Afganistán. El contacto del ciudadano de Afganistán con los distintos "imperios" invasores ha moldeado la identidad política de la mayoría de sus ciudadanos y, paradójicamente, ha supuesto que exista una falta evidente de identidad nacional común. La diversidad de Afganistán en cuanto a etnias supone que sea un país muy heterogéneo en ese sentido. La etnia, la lengua, la religión y la cultura son elementos definidores del nebuloso concepto de nación; si existe mucha diversidad, como es el caso afgano, también existe una cuantiosa pluralidad en la identidad política. Así, es más complejo implementar una estrategia pos conflicto en aquellos lugares como Afganistán en el que existen enfrentamientos históricos entre las distintas identidades políticas. La política de identidad empezó a tomar relevancia durante la segunda mitad del siglo XIX y tiene un gran protagonismo en esta tesis. La política de identidad se basa en búsqueda de reconocimiento de un determinado grupo como una comunidad significativa que influye en la política de una comunidad e incluso de un Estado. En Afganistán, las identidades políticas entran en conflicto con los valores occidentales que se basan en el imperio de la ley, los derechos humanos, el rendimiento de cuentas de los políticos y la participación política de sus ciudadanos. Esta forma de entender el funcionamiento de un Estado y la relación con sus ciudadanos se intentó exportar a Afganistán después de los Acuerdos de Bonn en el año 2004. Sin embargo, la mayoría de los ciudadanos afganos compartían como identidad política el derecho de la costumbre, representado por la ley Sharia y, en ocasiones, por una interpretación radical del Corán. Las Jirgas y las Shuras eran la referencia del ciudadano y no el parlamento o la Constitución. Así, ambas interpretaciones casi antagónicas de entender la vida política no tardarían entrar en conflicto. En el fondo, la tensión entre la identidad y democracia supuso que fueran dos conceptos irreconciliables en Afganistán. Afganistán, después de veinte años de guerra, vuelve a estar en el foco de la actualidad mundial. El posible acuerdo de paz con los talibanes supondría un claro triunfo de estos últimos; la comunidad internacional sellaría la consecución de sus objetivos políticos por medio de años de guerra asimétrica en el que miles de afganos, civiles y militares, han sido víctimas de ataques terroristas, violaciones de los derechos humanos fundamentales, etc. Si los talibanes vuelven o no al poder lo sabremos muy pronto, lamentablemente. [EN] On September 11th, 2001, one of the most wanted terrorists, Osama Bin Laden, surprised the American and worldwide intelligence services with the execution of an attack planned during months: the Twin Towers of New York, the economic center of the world, collapsed one after another. The world held its breath and world geopolitics would change forever. In just three weeks, the Taliban regime was overthrown; Afghanistan's subsequent stabilization phase was intended to be "a military parade." Once security was implemented, democracy would come later. A big mistake. Security never came, and Afghanistan is today the most terror-stricken country on the planet. The emergence of new ways of "making war" (warfare) has experienced a remarkable evolution. While war is a continuation of politics and this postulate, as Clausewitz argues, is invariable, the "way" of waging war has continually evolved, especially in recent years. Afghanistan has certainly been a scenario in which new ways of waging war have been a key to the failure of the stabilization process. The question that historians and experts ask themselves, after so much effort, what was the cause of that failure. Security was an important element in stabilization, but as much was the different ethnic and political identities of Afghanistan. The influence of civilizations is key to understanding the identities of the different areas of the world; including Afghanistan. The contact of the Afghan citizen with the various invading "empires" has shaped the political identity of the majority of its citizens and, paradoxically, has led to an evident lack of common national identity. The diversity of Afghanistan in terms of ethnicity means that it is a very heterogeneous country in that sense. Ethnicity, language, religion and culture are defining elements of the nebulous concept of nation; if there is a lot of diversity, as in the Afghan scenario, there is also a considerable plurality in political identity. Thus, it is more complex to implement a post-conflict strategy in which there are historical confrontations between the different political identities. Identity politics began to gain relevance during the second half of the 19th century and has a great role in this thesis. Identity politics is based on the search for recognition of a certain group as a significant community that influences the politics of a community and even a State. In Afghanistan, political identities conflict with Western values based on the rule of law, human rights, and the accountability of politicians and the political participation of its citizens. This way of understanding a State and the relationship with its citizens was attempted to export to Afghanistan after the Bonn Accords in 2004. However, the majority of Afghan citizens shared the value of custom as a political identity, represented by Sharia law and sometimes by a radical interpretation of the Koran. The Jirgas and Shuras were the reference of the citizen and not the Parliament or the Constitution. Thus, both almost antagonistic interpretations of understanding political life would soon come into conflict. Ultimately, the tension between identity or democracy supposed that both were irreconcilable concepts in Afghanistan. Afghanistan, after twenty years of war, is once again in the focus of world news. The possible peace agreement with the Taliban would be a clear victory for the latter; the international community would seal the achievement of its political goals through years of asymmetric warfare in which thousands of Afghans, civilians and military, have been victims of terrorist attacks, violations of fundamental human rights, etc. Whether or not the Taliban come back to power we will know very soon, unfortunately.

In the present essay, I will examine the traces of coexistence between the Muslim and Christian world in architecture and literature, using the examples of the mezquita, or 'mosque', and the most important novel of Spain, Don Quixote of la Mancha (1605;1615) by Miguel de Cervantes Saavedra. This study incorporates an interdisciplinary approach that utilizes historical, literary, and architectural methods to explain the dual function of the margin— its architectural function in the Mosque and its narrative function as used in specific chapters from Cervantes's novel. Furthermore, I will show how the architectural margin of the wall of the mosque was familiar to Cervantes's readers who lived in Spain and this familiarity allows Cervantes to exploit the metaphorical meaning of the literary margin as architectural margin. A metaphor establishes an equivalency between a pair of images; the best-known example of which belongs to Ezra Pound, the founding leader of Imagism (1912-1923). This is a school of poetry that endorsed clarity of expression and simplicity through the use of precise visual imagery. The best known metaphor is Pound's own, in which faces are compared with petals in the poem, "In a Station of the Metro": The apparition of these faces in the crowd: Petals on a wet, black bough. Through his architectural and literary metaphor, Cervantes covertly expresses his personal beliefs about multiculturalism that could not be directly expressed for fear of censorship by the Inquisition. ; Winner of the 2020 Friends of the Kreitzberg Library Award for Outstanding Research in the Senior Arts/Humanities category. ; In the Margins of Literary and Architectural Discourse: A Comparison of Arabic Commentary in Cervantes's Don Quixote and Moorish Architectural Inscription Pablo Picasso: Don Quixote, August 10, 1955. Internet: Public Domain Alexandra Parent SP 415: Seminar on Don Quixote Professor Stallings-Ward 28 February 2020 1 Introduction The history of the Iberian Peninsula is a rich one, filled with influences from the entire European and Asian continents over time. When we think about Spain, there is one defining factor that distinguishes her from the rest of Europe: the presence of racial, ethnic and religious influence from Africa, and, resulting therefrom, a unique moment in world history: the confluence of three major world religions in one geographical place. Christianity, Judaism, and Islam once flourished side by side in mutual tolerance and economic interdependence in the Andalusian region of southern Spain, known as 'Al-Andalus,' in the High Middle Ages. Tolerance of others who are different, as Maria Rosa Menocal points out, is the underpinning of this unique historical coincidence and the essential component for the development of science, philosophy, medicine, urbanization, and hence trade and commercial prosperity.1 The Jews and Christians of Muslim Andalusia flourished economically and culturally under the Umayyad, whose dynasty (661-750) was transplanted from Damascus to Cordoba by Abd al-Rahman (756- 1031) after a civil war between two rival Caliphates. These three religions borrowed language and architecture from one another leaving traces of their coexistence, not surprisingly, within the architecture and literature of Spain. In the present essay, I will examine the traces of coexistence between the Muslim and Christian world in architecture and literature, using the examples of the mezquita, or 'mosque', and the most important novel of Spain, Don Quixote of la Mancha (1605;1615) by Miguel de Cervantes Saavedra. This study incorporates an interdisciplinary approach that utilizes historical, literary, and architectural methods to explain the dual function of the margin— its architectural function in the Mosque and its narrative function as used in specific chapters from Cervantes's 1 Menocal, The Ornament of the World. 2 novel. Furthermore, I will show how the architectural margin of the wall of the mosque was familiar to Cervantes's readers who lived in Spain and this familiarity allows Cervantes to exploit the metaphorical meaning of the literary margin as architectural margin. A metaphor establishes an equivalency between a pair of images; the best-known example of which belongs to Ezra Pound, the founding leader of Imagism (1912-1923). This is a school of poetry that endorsed clarity of expression and simplicity through the use of precise visual imagery. The best- known metaphor is Pound's own, in which faces are compared with petals in the poem, "In a Station of the Metro": The apparition of these faces in the crowd: Petals on a wet, black bough.2 Through his architectural and literary metaphor, Cervantes covertly expresses his personal beliefs about multiculturalism that could not be directly expressed for fear of censorship by the Inquisition. My essay is divided in three sections. In the first section, I will present a historical overview of Muslim presence in the Iberian Peninsula. In the second section, I present a survey of Muslim Architecture in Andalusia based on the results of a photographic study of architecture I did while visiting Spain during study abroad. I survey the presence of Muslim architecture found throughout Andalusia, placing particular emphasis on the function of the margin in the design of the walls of the mosque reserved for the calligraphy that features citations of scripture from the Holy Koran. The margin, although small in size compared to the rest of the entire structure of the mosque, is as I will show, actually the most important part of the mosque. In the third section of my essay, I analyze the literary margin treated in the episode of the lost manuscript in Volume I: Chapters Eight and Nine of Cervantes's Don Quixote. I will look at 2 Judith Stallings-Ward, Gerardo Diego´s Creation Myth of Music: Fábula de Equis y Zeda. London: Routledge, 2020, 175. 3 the coexistence of the Christian and Arab writers in Cervantes's Don Quixote. The collaboration between Cervantes and Cide Hamete Benengeli allows Cervantes to establish a metaphor between the architectural margin of the mosque and the literary margin of the manuscript as the place for covertly expressing his esteem for multiculturalism and his condemnation of the expulsion of the Moors by national decree; a ploy he uses to escape censorship by the Inquisition. The play with spatial perspective (margin vs center) and the severance of the manuscript (with the lost section recovered in the market of Toledo) establishes the architectural and narrative metaphor that recalls the physical and cultural coexistence between Muslims and Christians valued by Cervantes. In addition, I examine how Cervantes extends this metaphor to also evoke the rupture of that coexistence through expulsion of the Moors, which Cervantes believed broke the backbone of the country. Part I: Historical Overview of Muslim Presence in the Iberian Peninsula The invasion of the Iberian Peninsula began with one young man named Abd Al- Rahman, the son of the Arab family ruling Damascus in the east—the Umayyads. However, during a civil war, his family was massacred, and his escape left him the sole survivor. He fled through North Africa into Cordoba where he began to establish himself as the Caliph, or ruler.3 After the Visigoth monarchy fell, Muslim control dominated the Iberian Peninsula. From 711 through 1492, Islamic society had a long and profound presence on shaping Spanish culture until the Christian kings unified the country. By 716, almost all of Iberia, with the exception of the far northwest and mountainous regions, was under Muslim control and the province was name 'Al- Andalus'. By naming the country in this manner, it directly opposes the 'Hispania' title that the 3 BBC Worldwide Learning, The Moorish South: Art in Muslim and Christian Spain from 711-1492. 4 Romans gave the peninsula, foreshadowing the enmity between the religions of Islam and Christianity.4 Abd Al-Rahman sought to recreate his cultural roots here in Iberia. The peninsula was dominated by the Umayyad dynasty, who had no affiliation to the eastern Muslim dynasties at the time, and were met with little to no resistance from the small groups of Christians still living in the peninsula. As demonstrated in Figure 1, the conquering forces came through Northern Africa and thus were also comprised of Berber forces from that region. By 741, there were approximately 12,000 Berber forces, 18,000 Arabs, and 7,000 Syrians entering through the Southern tip of the peninsula. This totaled anywhere from 4,000,000 to 8,000,000 living in the Iberian Peninsula at the time.5 6 Islam and Christianity under Islamic Rule By the mid eighth century, the population of Iberia had grown exponentially and became more diverse both racially and religiously. Although Muslim forces had conquered what remained of the Visigoth territories and established themselves as the dominant, ruling power, a 4 O'Callaghan, A History of Medieval Spain, 91. 5 Phillips and Phillips, A Concise History of Spain. 6 Alchetron.com. "Umayyad Conquest of Hispania - Alchetron, the Free Social Encyclopedia," August 18, 2017. https://alchetron.com/Umayyad-conquest-of-Hispania. Figure 1: Depiction of the route of Abd-Al Rahman and the subsequent conquests of the Muslim Empire. From Internet: public domain.6 5 majority of the population living in Iberia was still Christian. This undoubtedly posed issues for the Moorish rulers who practiced Islam. As a result, conversion became a necessity for Christians. It is important to distinguish between the upper and lower class when discussing the notion of conversion. Many Visigoth royalty, nobles, and influential families saw it in their best interest to convert and to do what they could to join the new rulers in an effort to pursue political advantages.7 Yet, the majority of Iberia was home to lower class Hispano-Roman Christians who converted out of survival. Despite this, many of the people in this situation retained their Christian faith while adopting Muslim customs like learning Arabic so as to appease the rulers. The name given to these people are mozárabes, or 'Mozarabs', meaning 'Muslim-like'.8 A Christian writer noted the following about Christians living under Islamic rule in 854: Our Christian young men, with their elegant airs and fluent speech, are showy in their dress and carriage, and are famed for the learning of the gentiles; intoxicated with Arab eloquence they greedily handle, eagerly devour, and zealously discuss the books of the Chaldeans (i.e. Muhammadans), and make them known by praising them with every flourish of rhetoric, knowing nothing of the beauty of the Church's literature, and looking down with contempt on the streams of the Church that flow forth from Paradise ; alas ! The Christians are so ignorant of their own law, the Latins pay so little attention to their own language, that in the whole Christian flock there is hardly one man in a thousand who can write a letter to inquire after a friend's health intelligibly, while you may find a countless rabble of kinds of them who can learnedly roll out the grandiloquent periods of the Chaldean tongue. They can even make poems, every line ending with the same letter, which displays high flights of beauty and more skill in handling metre than the gentiles themselves possess.9 It is evident from this passage that the Christians admired the Arabs for the type of civilization they created. The Mozarabs recognized that the Arabs had something to offer them in terms of literature, character, and even language. This demonstrates that on some level, there was an 7 Phillips and Phillips, A Concise History of Spain. 8 Phillips and Phillips. 9 Alvar, Indiculus luminosus; quoted from Arnold, The Preaching of Islam; A History of the Propagation of the Muslim Faith, 137-138. 6 acceptance of Muslim culture and practices which set the foundation for the incorporation of Islamic architectural styles and writing styles to be continued after the Christians' reconquering of Iberia. Christian Kingdoms and "La Reconquista" When the Muslim forces conquered Iberia, they were not able to infiltrate the regions in the north. These regions were not seen as an apparent threat because they were isolated, poor, and not heavily populated, so the Moors did not make a vigilant effort to convert or control these Christians.10 However, the Christian states organized themselves into kingdoms and solidified their control in northern Spain by the mid-twelfth century before moving into Southern Spain during the fourteenth and fifteenth centuries. The progression of the Christian kingdoms' conquests can be seen in Figure 2. 11 At the height of the reconquest, there were seven individual Christian kingdoms within the peninsula: Asturias, Galicia, Aragon, Navarre, Leon, Castile, and Valencia. Each of these kingdoms had their own struggles trying to gain territory, power, and recognition. The Kingdom 10 Phillips and Phillips, A Concise History of Spain, 55. 11 "Reconquista+General.Jpg (1600×914)." Accessed February 19, 2020. http://4.bp.blogspot.com/- ofiGywz891k/TzynBPnsc7I/AAAAAAAAAok/ECNzH3rSp3E/s1600/Reconquista+General.jpg. Figure 2: Timeline of the Christian King's Reconquest of the Iberian Peninsula. Internet: public domain.11 7 of Navarre was largely under the control of the French to the north and did not have much to do with the conquering of other Spanish Christian kingdoms, let alone taking a stance on combating the Arab south. However, not only were the Christian kings working to overthrow the Islamic caliphate and reconquer Iberia from the Muslims, they were all vying for control amongst themselves. In the tenth century, Alfonso III expanded into the regions of Galicia and Leon slowly gaining more territory and strengthening his Christian kingdom to combat the Moors. The kingdoms of Castile and Leon unified in 1085 and then under the kingship of Alfonso VI, they conquered Toledo.12 Toledo is situated where the Moorish Al-Andalus and the Christian kingdoms of Castile and Leon border each other, so the conquering of Toledo was a push in the right direction for the Christian kings' ultimate goal of expelling the Moors from Spain. In the northeast, Alfonso I of Aragon began consolidating his power and conquered Zaragoza by 1134, and joined with Barcelona in 1137 to form the Kingdom of Aragon. By this point, the Muslim empire was facing many issues in trying to run their territories and were slowly losing their sphere of power in the south. King Fernando III of Castile was able to penetrate Al-Andalus and conquer the Andalusian cities of Cordoba and Seville in the mid-thirteenth century. So, when the two kingdoms of Aragon and Castile prevailed over their Christian counterparts, they were left with only the Emirate of Granada as their last steppingstone to banish Muslim rule from the peninsula. King Fernando II of Aragon and Queen Isabella of Castile married in 1469 and this consolidated the royal authority of Spain.13 In January of 1492, the city of Granada fell to the Spanish forces and this ended the 780 years of Muslim control in the Iberian Peninsula. This was the final act of La Reconquista and the beginning of the age of Los Reyes Católicos or 'The Catholic Kings.' King Ferdinand and Queen 12 Phillips and Phillips, 306. 13 Phillips and Phillips, 116. 8 Isabela ruled into the first few years of the sixteenth century, which is marked as the beginning of the Spanish Inquisition—a judicial institution that was used to combat heresy in Spain. Islam and Christianity under Christian Rule Islam first began to submit to Christian rule during the period when the Christian kingdoms were all building up their states and conquering each other in the eleventh century. When Toledo was captured in 1085, allowing the Muslims to stay was crucial to the economic stability and the intellectual advancement of Christian society.14 With the expulsion of the Moors came the expulsion of their religion and began the institution of Christianity, more specifically Catholicism. The immediate issue that the church saw after the reconquest of Spanish cities was the need to introduce their ecclesiastical structure, so they began to assign bishops to these major cities in addition to creating two new ecclesiastical provinces.15 This rapid organization and dispersion of the Catholic religion in previously Islamic territories was not good news for those Muslims still living in Spain after the reconquest. The Christians could not simply expel the Muslims because in some places they made up the majority of the population and were an integral part of the economy for the country.16 Muslims who continued to live under Christian ruler adopted the name mudéjares or 'mudejars' in English. This name is derived from the Arabic word mudajan meaning 'permitted to remain' with a colloquial implication of 'tamed or domesticated.'17 Ironically, the same way the minorities were treated under Islamic rule, to include Christians, was now how the Muslims were treated under Christian rule. The Mudejars would practice their religion, law, and customs in addition to being permitted to continue their 14 Watt, A History of Islamic Spain, 150. 15 O'Callaghan, A History of Medieval Spain, 488. 16 Watt, A History of Islamic Spain, 151. 17 Watt, 151. 9 craft so long as they paid a tax. It was not uncommon for these minority groups to distinguish themselves by dressing differently and even inhabiting different quarters of town. During the thirteenth and fourteenth centuries, a period known as the Mudejar age, it is evident that there is a culture common to both Christians and Muslims, and that coexistence, to the point of assimilation, was possible. However, it is important to note that the Christians, being the dominant power, were selective in what they chose to assimilate. The most evident piece demonstrating assimilation is the artistic productions, both architecturally and literarily. It was obvious that incorporating the Muslims into society was necessary and beneficial, but towards the end of the fifteenth century, economic disparages were becoming obvious and the Mudejars were the wealthier of the two groups. This jealousy and animosity led to a growing prejudice of Mudejars and once Ferdinand and Isabella unified the peninsula, they turned this prejudice into policy. The previous flirtation of religious tolerance was coming to an end, but due to the policy written for the surrender of Granada, many people of Islamic faith were briefly safe in 1492, so these religiously intolerant policies attacked other groups, namely the Jewish factions of the country. This period of brutal intolerance is known as the Inquisition, and it drastically influenced Spanish society for the years to follow, to include Miguel de Cervantes's Don Quixote of La Mancha. Part II: Survey of Muslim Architecture in Andalusia Moorish architecture is something that when one sees it, they know it. It is a mixture of oriental and occidental to create a recognizable and unique form of architecture. There are certain staple architectural features that help make this style so well-known and are also the features that other cultures adopt simply because of their beauty. Some of these features include 10 stone parapets with Islamic crenellations, horseshoe windows and doors, towers sometimes evoking a minaret, domes, arches, slender pillars, and many of these features were typically constructed with alternating colors of yellow and red brick and stone.18 The following figures demonstrate these architectural features. 18 Kalmar, "Moorish Style: Orientalism, the Jews, and Synagogue Architecture," 73. Figure 4 (above): The series of arches and horshoe shaped doors. Taken by Alexandra Parent in the Royal Alcazar in Seville, Spain. January 31, 2018. Figure 5 (below): The classic Islamic crennelations and attention to detail that characterizes all of Islamic architecture. This is also exemplatory of the domes that were utilized in Moorish architecture. Taken by Alexandra Parent at the Royal Alcazar in Seville, Spain. January 31, 2018. Figure 3: The slender pillars and open courtyards. Taken by Alexandra Parent at the Alhambra in Granada, Spain. February 23, 2018. Figure 6: The Torre del Oro or Tower of Gold located in Seville, Spain. Exemplifies the use of towers and minarets in Islamic architecture. Taken by Alexandra Parent in Seville, Spain. April 12, 2018. 11 19 These features are apparent throughout all the everyday buildings within the cities of Al- Andalus, but they also came together to make great, exceptional buildings. One in particular is the Great Mosque in Cordoba. This was built when the religion of Islam was only a century old, so it is renowned as one of the first mosques ever built. This mosque is truly grandeur in architectural style in addition to sheer size. In Islamic faith, it is forbidden to depict Allah, or any religious figure, so the traditional methods of using a painting to inspire religious awe was not possible, thus allowing for architecture to take its place. As seen in Figure 7, the rows of archways are seemingly never ending and absolutely uniform. 20 The architectural margin of the mosque (Fig 8 and Fig 10.D), which Cervantes metaphorizes with the annotation of Dulcinea written on the margin in Don Quixote, refers to the most important part of the mosque: the inscriptions. In the Islamic religion, as aforementioned, worshipping any idols or to depict Allah, Muhammad, or any other important religious figures 20 "The Mosque-Cathedral of Cordoba (Spain)." Accessed February 19, 2020. https://www.turismodecordoba.org/the-mosque-cathedral-of-cordoba-spain. Figure 7: The Great Mosque located in Cordoba, Spain. Known for the uniformity and neverending archways and pillars. From Internet: public domain.20 12 through paintings are prohibited. So, the role of the inscriptions becomes the most important and revered part of the mosque much like the depiction of Jesus on the cross is worshipped by Christians. This is because the inscriptions are the holy words of the Koran. The phrase most 21commonly inscribed in these architectural margins are 'only Allah is victorious.' The metaphor Cervantes makes between the architectural and literary margin is developed to a second degree with the handwriting in the margin of the manuscript being Arabic calligraphy. This can be compared to the inscriptions in the architectural margin of the mosques, which are also written in Arabic calligraphy. This type of writing is very distinct from Western modes of writing because the purpose of Arabic calligraphy is "no como un medio utilitario de 21 Fernando Aznar, La Alhambra y el Generalife de Granada. Monumentos, 12. Figure 10: Architecture of the Mosque21 (from left to right and top to bottom): A) ataurique B) interlacing decoration C) calligraphy in the margin of the wall with scripture "Only Allah is Victorious". Also shown in Fig 11. D) horseshoe arc E) muqarnas F) half horseshoe arcs G) arc with muqarnas H) column with crowned capital Figure 8 (above): The horsehoe shaped windows and use of alternating colors and very detailed crennelations. The Arabic calligraphy can be seen above the windows. Taken by Alexandra Parent at the Alhambra in Granada, Spain. February 23, 2018. Figure 9 (above): Fig 8 on a closer scale to better see the calligraphy 13 comunicación entre los hombres sino como un medio sagrado de comunicación entre Dios y los hombres," meaning, it is not like a utilitarian means of communication between humans, but rather a sacred means of communication between God and men.22 This type of calligraphy that Arabs place in the margins of their mosques obviously have religious value and is called caligrafía cúfica or 'Kufic calligraphy' as is shown in Figure 11. 23 The text written in Arabic calligraphy in the margin of the wall of the mosque is epigrafía. It is present in all mosques and throughout the royal palace known as La Alhambra in Granada. As Fernando Aznar explains, "El texto tiene gran importancia en la decoración. Frases que ensalzan a Alá, o que hace referencia a las bellezas del lugar donde se encuentra, ditando a veces a los constructores de cada zona, se reparten por todos los muros de la residencia real."24This quote says that text has great importance in the decoration of the buildings, and that the phrases that praise Allah, or that refers to the beauties of the place where Allah is located, are all throughout the royal palace. It amplifies the important role that language has in religious symbols. 22 "La Caligrafía Árabe." 23 "Arabic Inscription." Alamy. Accessed February 24, 2020. https://www.alamy.com/stock-photo-arabic-inscription- carved-in-a-palace-wall-of-the-alhambra-in-granada-17181753.html. 24 Fernando Aznar, La Alhambra y el Generalife de Granada. Monumentos, 12. Figure 11: An example of Kufic calligraphy. The style of the Arabic writing in this image is classically used in Islamic mosques to state the word of Allah from the Holy Koran. This is the architectural margin. From Internet: public domain.23 14 Moorish Architectural Influence Under Christian Rule As the Christians slowly began organizing themselves into kingdoms and conquering Moorish cities in Al-Andalus, two incredibly different cultures met each other. As previously stated, an assimilation of sorts was taking place by the Christians who were adopting Islamic practices and other elements of their culture. Architecture was one of these elements that Christian rulers not only preserved, but in some cases built from bottom up utilizing these inherently Moorish styles. Using the example of the Mosque of Cordoba, it is important to note that in the middle of this Islamic prayer hall, there is something unknown to Islam; a Catholic Cathedral (Fig. 12, 13, and 14). This addition was made in the sixteenth century after the Moors were abolished from Iberia. The rulers who erected this cathedral demolished the central columns in order to make room for the Christian edifices, however, Charles V recognized the gravity of this action and how it drastically changed the ambiance and historical significance of this architectural feat. This cultural vandalism by the Christians is symbolic of the enforcement and imposition of their religion onto a different group of people. This theme is also apparent in the literary works of the sixteenth and seventeenth centuries to include Don Quixote of La Mancha by Miguel de Cervantes. Figure 12: Located in the middle of the Great Mosque of Cordoba. Christian, gothic architecture meeting with Islamic architectural styles. Taken by Alexandra Parent. January 31, 2018. 15 An example of Mudejar work is the Cathedral of Seville, built after the demolition of a mosque, in order to increase the power of the Christian rulers. The architectural style of the building is very European and gothic with high vaulted ceilings and stained glass.25 As a statement piece for Christianity in former Islamic Spain, it is not expected for one to find traces of Moorish architectural influence, but there is. The Cathedral was built by Christian architects, so there was no lack of qualified Christian craftsmen, however there are qualities inherently Moorish that make its way into this grand architectural achievement. As depicted in Figure 15, the high altar in the Cathedral is adorned in so much detail that it mimics the Moorish tendency to not leave any blank space. The incessant ornamental decoration style that was a part of Islamic Spain bled into and permeated traditional Christian and European styles of architecture making its way into the very soul of Christian craftsmanship. Although the Christian Spanish rulers 25 BBC Worldwide Learning, The Moorish South: Art in Muslim and Christian Spain from 711-1492. Figure 13 (right): Christian altar located in the middle of the Great Mosque of Cordoba in Spain. Taken by Alexandra Parent. January 31, 2018. Figure 14 (left): Example of Christianity inserting itself into Muslim architecture. Taken by Alexandra Parent. January 31, 2018. 16 erected this cathedral as a statement to assert their religious dominance, the Moorish aesthetic had already made its way into the minds of the architects of that era. In addition to this, the minaret attached to the Cathedral of Seville, La Giralda (Figure 16), is evidence of this as well. The construction of this minaret concluded in 1568 and is the twin tower to the city of Marrakech. Having begun construction in 1184, La Giralda is host to the visible mixing of Moorish and Christian culture. Through the stonework, inscriptions, and different styles used, La Giralda is evidence of this assimilation of cultural and architectural practices. 26 Perhaps the most notable architectural feat in regard to Moorish influence on Christianity is seen in the Real Alcázar, or Royal Alcazar. At first glance, it is a very distinct Moorish-looking building in terms of architecture; it contains the classic Moorish archways, courtyards, crenellations and pillars (Fig 17 and 18), so it would be reasonable to conclude that it was 26 "Cathedral of Seville. Aerial View." Accessed February 24, 2020. https://seebybike.com/blog/must-see-cathedral-and- alcazar-of-seville/cathedral-of-seville-aerial-view/. Figure 15 (right): The altar located inside the Cathedral of Seville. Known for it's incredulous detail and extravagant style that is suspected to be a result of lingering Moorish influences. Taken by Alexandra Parent. January 31, 2018. Figure 16 (left): An aerial view of the Cathedral of Seville. It includes many influences of Morrish architecture to include the large tower known as La Giralda, the minarets all over the building, and the many domes that make up the cathedral. From Internet: public domain.26 17 constructed under Islamic rule. However, Christian king Peter of Castile, also known as Peter the Cruel, commissioned the Alcazar as his royal palace in the fourteenth century. He made the Alcazar identical to the architectural stylings of the Spanish Middle Ages. So, the question arises as to why a Christian ruler would deliberately choose Islamic decoration? The answer is that it comes down to power. By appropriating the Islamic art and traditional expressions, the Christian ruler projects a sort of authority over the minority subjects.27 The Moorish expressions of wealth and power are understood differently than traditional Europeans, so by creating something that the Muslim population would recognize as powerful, Peter the Cruel wielded a sort of power over the Mudejars. 27 Fernández, "Second Flowering: Art of the Mudejars." Figure 17 (left): The courtyard of the Royal Alcazar. Despite being built by a Christian king, it has many, if not completely full of, influences from Islamic architecture. Note, the pillars, the archways, the courtyard, the crennelations. Taken by Alexandra Parent. January 31, 2018. Figure 18 (right): The Royal Alcazar in Seville, Spain. This wall has both Christian and Islamic influences. Note the differences between the lower floor and the second floor of the archways. The bottom is much more functional and plainer, like traditional Christian architecture whereas the top portions are much more detailed and colorful such as depicted by Islamic architecture. Taken by Alexandra Parent. January 31, 2018. 18 Part III: The Literary Margin Treated in the Episode of the Lost Manuscript in Volume I: Chapters Eight and Nine of Cervantes's Don Quixote When reading Don Quixote, the reader is frequently taken off the main narrative path involving the adventures of the main characters, the knight and his squire Sancho Panza, and led down secondary narratives involving encounters with characters who interrupt the main narration with tales of their own stories of love, captivity, and triumph. The complexity of the narrative shows the novel to be an amalgam of many different short novels, much like the way of the river Amazon, which is fed by many smaller rivers, at the heart of which is Cervantes's parody of books of chivalry. Nevertheless, the one unchanging constant is the way the novel opens a window onto the life and times of the man who wrote it. Cervantes's novel reflects his lived experience rooted in multicultural society whose heterogeneity was the source of Spain's economic and agricultural well-being. Cervantes saw the well-being of his country destroyed by the Hapsburg dynasty's religious intolerance and persecution of minorities who did not convert from their Jewish or Muslim faith. Cervantes himself was of Jewish ancestry. His father was a surgeon, a vocation known to be practiced by Jews. Cryptic references to his Jewish ancestry appear in the portada, or cover page of this novel. For example, the phrase from the book of Job—after darkness light is hoped for—and references to their inability to worship on the Sabbath appear in the first chapter of the novel; a day when the Jewish population must be in duelos and quebrantos, or 'pain and suffering'. While a student, Cervantes was arrested and ordered to have his right hand cut off for allegedly shooting a man who had insulted his sisters. Cervantes escaped punishment by fleeing to Italy from where he joined the Holy League (an alliance among the Vatican, France, and Spain) in the Battle of Lepanto, a major battle against the Turks in the waters of the 19 Mediterranean, during which Cervantes lost the use of his left hand. After his distinguished military service in this major victory against the Turks, Cervantes was taken captive and held prisoner for five years in Algeria. His profound understanding of the Islamic world of the Maghreb, as the northern region of Africa is known, is reflected throughout Don Quixote. Upon return to Spain, he obtained work as a tax collector tasked with gathering funds throughout Andalusia for the construction of the Spanish Armada. His detailed knowledge of the geography and customs of Southern Spain is reflected throughout the novel as well. Cervantes's experiences from his military expedition against the Turks, his years in captivity in northern Africa, his travels through Andalusia, and his Jewish ancestry can be added as another factor that forged the broad multicultural perspectivism formed in his novel. As a student, Cervantes was taught by Lope de Hoyos, a known follower of the Dutch humanist philosopher Erasmus of Rotterdam. Erasmus criticized the empty ritual of the Catholic Church as well as its intolerance for Christians, especially followers of Martin Luther, who sought an unmediated religious relationship with God; one that did not require mediation by a Catholic priest. The teachings of Erasmus, an intellect who denounced the hypocrisy of the Catholic Church and its persecution of minorities and different versions of Christianity, are embraced by Cervantes and find expression in a covert manner in Don Quixote (II: 22-23).28 The episode of the lost manuscript (Volume I:8-9) reflects the perspective of multiculturalism and diversity Cervantes gained from the life experiences outlined above. Chapter eight is first and foremost about Don Quixotes's iconic battle with the windmills, the most well-known episode of the novel. Don Quixote's illusion leads him to believe that the windmills were originally giants that have been transformed into windmills by his enemy, the 28 Judith Stallings-Ward, "Tiny (Erasmian) Dagger or Large Poniard? Metonymy vs. Metaphor in the Cave of Montesinos Episode in Don Quixote." 20 wizard Freston, to cheat Don Quixote from a victory in battle against them. The deception of the knight conveys Cervantes's use of humorous parody to denounce the books of chivalry whose fantasy version of reality has brainwashed Don Quixote. A subsequent adventure in this chapter reveals Don Quixote has another lapse of reason. He believes that a Basque woman travelling to Seville, preceded by two Benedictine friars who are not in her party, and surrounded by her own men on horseback, is a princess being kidnapped. Upon observing once again his master's mind in the grip of delusion, Don Quixote's squire Sancho Panza replies, "This will be worse than the windmills."29 This foreshadows the battle that Don Quixote will ultimately have with the Basque. At the end of Chapter eight, we are left with both men having their swords unsheathed and raised at each other, but then the narration of the story abruptly stops. The narrator, a literary form of Cervantes inserted into the story by the real historical Cervantes, begins to speak directly to the reader as if in an informal conversation with them to convey that the end of the scene and the rest of the history are missing.30 This narrative style continues into Part II, chapter nine when the narrator begins a search for the missing manuscript. In this chapter we are brought to Toledo and the narrator brings the reader through the Alcaná market. The narrator Cervantes tells the story of his journey to find the manuscript in the market and how he comes across a young boy trying to sell him some notebooks, old torn papers, and other small commodities. Cervantes is inclined to pick up a certain book that the boy has and realizes the script on the front is in Arabic. Since he could not read Arabic, he finds a Morisco aljamiado, so called for their ability to speak both Arabic and Spanish, who can help translate the manuscript. It was not difficult to find this person and soon Cervantes flipped to the middle of the book and asked the Morisco to translate. Cervantes points out the availability of translators of 29 Cervantes, Don Quixote, 62. 30 Cervantes, 65. 21 all classic languages in the market, thus underscoring the advantage of multicultural spaces such as the markets of Spain. As the translator--the Morisco aljamiado--began to read the page, he laughed at something written in the margin: it stated, "'This Dulcinea of Toboso, referred to so often in this history, they say had the best hand for salting pork of any woman in La Mancha.'"31 The narrator immediately knew that this was the missing manuscript he was looking for, so he had the Morisco read even more. It is then that the reader learns the novel was originally written in Arabic by the Arab historian Cide Hamete Benengeli. Narrator Cervantes commissions the Morisco to translate the entire novel, paying him in "two arrobas of raisins, and two fanegas of wheat," so that the story of Don Quixote and Sancho Panza can be continued.32 This process of translation of the original manuscript from Arabic to Spanish is now the source of the narrator Cervantes's history of Don Quixote, and it is a collaboration between the literary Christian "Cervantes" and the original Arabic author Cide Hamete Benengeli, delivered through the translator. The reader is now being told the story through someone else's eyes and mind. The novel descends into a rabbit hole of authorship in which, ironically, the new lens is a Morisco translator. This metaphor demonstrates that true Spanish history is written as a compilation between Christianity and Islam, not one or the other, thus demonstrating historical Cervantes's disdain and disapproval of the expulsion of the Moors. Rather, Cervantes displays the importance and necessity of diversity and multiculturalism. The true author, historical Cervantes, also establishes a metaphor between the literary margin, in which the literary Cervantes discovered the novel was indeed Don Quixote, and the architectural margins of the mosque. Cervantes does this in a very clever and implicit manner, 31 Cervantes, 67. 32 Cervantes, 68. 22 otherwise he would be severely censored. Through this implied metaphor of architectural and literary margins, Cervantes is able to write a novel that has commentary to covertly express his condemnation of the Moors and announce his glorification of multiculturalism. The focus of attention placed on the margin of the manuscript wherein Arabic commentary is written calls to mind the architectural margin of the mezquita, or 'mosque', in which the Arabic calligraphy is written. The comparison between the textual margin of Cervantes's manuscript and architectural margin of the walls of the mosque would be easy for the readers of Cervantes's day to recognize given the prevalence of Muslim architecture throughout Spain, as my survey in the first part of this essay shows. Furthermore, the handwriting in Arabic by the Arab historian easily calls to mind the calligraphy used for citations from the Koran. The Arabic commentary—associated with the authoritative word of the Koran placed in the margin of the walls of the mosque—second guesses the religious purity of Dulcinea, the object of courtly worship by the Christian knight. When the translator points out the Arab historian's commentary in the margin of the manuscript, that 'the Lady Dulcinea has the best hand at salting pork,' he taints her purity by placing her in contact with a food source that is considered polluted for Muslims. The comment casts Dulcinea in tainted light. The Arab historian's questioning of religious purity occurs in tandem with the questioning of the authority or authorship of the history of Don Quixote. The literary Cervantes is a Christian writer, but he is not the true author of the original manuscript; the Arab historian Cide Hamete claims true authorship; and Dulcinea is not the pillar of religious purity she is perceived to be. The play with the double meaning of the margin (textual vs architectural) occurs with the play of spatial perspective between margin vs center. The reader sees through Cervantes's use of the metaphor as a multicultural perspective that questions the absolute status of Christian 23 authority and Christian purity. The play with meaning and perspective in Cervantes's treatment of the margin in chapters eight and nine may be taken to one final and third level of development. The margin, shown to be central in connection with the ruptured or severed manuscript, is a covert expression for Cervantes's esteem for the contributions to Spanish society by the Muslim population of his country and his condemnation for their expulsion by governmental degree from Spain. In the eyes of Cervantes, this broke of the backbone of Spain's culture and economy since the Arab population made up an incredibly large portion of the Iberian Peninsula. Cervantes accomplishes this by, not only changing chapters, but beginning a whole new section of the novel. Part I concludes with chapter eight and the pending battle between Don Quixote and the Basque, then Part II begins with the narrator Cervantes informing the reader of his journey to find the rest of the novel. Being wary of the censorship that plagued others during the Inquisition, Cervantes chose this metaphorical approach to convey his true sentiments about the situation of Spain at this moment in history. This rupture in Don Quixote's history is reflective of the moment in Spain's history where law has been decreed to banish something so inherent to the nation itself: the Moorish people. By placing these episodes side by side, Cervantes invites the reader to compare the delusion of the Hapsburg imperial vision and its expulsion of the Moors with the episode of the windmills. The blindness of Spain's government seems even more laughable than Don Quixote's own misguided attack on the windmills. Cervantes's play with the margin allows him to express his views on multiculturalism in an indirect manner that allowed him to escape censorship by the Inquisition. The Inquisition was not savvy enough to realize that this profound division between Part I and II is symbolic of the division of tolerant Spain into an intolerant Spain. After Cervantes 24 died, the Inquisition did censor and expurgate a passage that was considered too directly stated. In chapter thirteen, Don Quixote is once again declaring his servitude and attesting to the beauty of his beloved Dulcinea of Toboso. In his description to Vivaldo, he uses a Petrarchan metaphor, a very classical and renaissance style of poetry, to describe Dulcinea. Don Quixote states (Volume I:13): "Her tresses are gold, her forehead Elysian fields, her eyebrows the arches of heaven, her eyes suns, her cheeks roses, her lips coral, her teeth pearls, her necklace alabaster, her bosom marble, her hands ivory, her skin white as snow, and the parts that modesty hides from human eyes are such, or so I believed and understand, that the most discerning consideration can only praise them but not compare them."33 While eloquently put, Cervantes is nonetheless making references to the private areas of Dulcinea's body and thus was censored by the Catholic Church in 1624 after his death; they dared not censor him before since his novel made him so beloved by the people. Cervantes was too clever to have to follow the rules. His questioning of authority was apparent from the very opening words of the novel when he writes, "[s]omewhere in La Mancha, in a place whose name I do not care to remember…"34 Cervantes conveys how exact places and names are all arbitrary and are not relevant to the novel. This echoes Cervantes own questioning of authority and Spain's religious Inquisition going on that persecuted the Moors and other minorities alike. 33 Cervantes, Don Quixote, 91. 34 Cervantes, 19. 25 Conclusion The religious tolerance and interdependence between minorities of Al-Andalus, which are reflected through the architecture of Andalusia and also underscored in Cervantes's Don Quixote through the metaphorical treatment of the literary margin in the episode of the lost manuscript, seems evermore elusive today. In light of the divisiveness and racism rampant in our society that mars efforts toward multiculturalism and diversity, such as those undertaken at universities like Norwich, tolerance seems like the impossible dream that is the object of the quest of the chivalrous knight Don Quixote. 26 Bibliography Arnold, Thomas Walker. The Preaching of Islam; A History of the Propagation of the Muslim Faith. New York: C. Scribner's sons, 1913. http://archive.org/details/preachingofisla00arno. Aznar, Fernando. La Alhambra y el Generalife de Granada. Monumentos Declared of World Interest by Unescco. Mariarsa:1985. BBC Worldwide Learning. The Moorish South: Art in Muslim and Christian Spain from 711- 1492. Documentary Film. The Art of Spain: From the Moors to Modernism, 2009. https://fod.infobase.com/p_ViewVideo.aspx?xtid=39408. Cervantes, Miguel. Don Quixote. Translated by Edith Grossman. 5 edition. New York: Harper Collins, 2003. Fernández, Luis. La Historia de España en 100 preguntas. Madrid, Spain: Ediciones Nowtilus, 2019. https://ebookcentral.proquest.com/lib/norwich/reader.action?docID=5703133&ppg=1. Fernández, María Luisa. "Second Flowering: Art of the Mudejars." Saudi Aramco World, The Legacy of Al-Andalus, 44, no. 1 (February 1993): 36–41. Harsolia, Khadija Mohiuddin. "Captivity, Confinement and Resistance in Mudejar and Morisco Literature." University of California, Riverside, 2016. WorldCat.org. https://search.proquest.com/docview/1849025713?accountid=14521. Kalmar, Ivan Davidson. "Moorish Style: Orientalism, the Jews, and Synagogue Architecture." Jewish Social Studies 7, no. 3 (2001): 68–100. "La Caligrafía Árabe." Accessed February 21, 2020. http://www.arabespanol.org/cultura/caligrafia.htm. Maíz Chacón, Jorge. Breve historia de los reinos ibéricos. 1a. edición. Quintaesencia ; 6. Barcelona: Ariel, 2013. http://catdir.loc.gov/catdir/enhancements/fy1313/2013369841- b.html. Menocal, Maria Rosa. The Ornament of the World: How Muslims, Jews and Christians Created a Culture of Tolerance in Medieval Spain. Reprint edition. Boston: Back Bay Books, 2003. O'Callaghan, Joseph. A History of Medieval Spain. 1st ed. Ithaca, New York: Cornell University Press, 1975. https://ebookcentral.proquest.com/lib/norwich/detail.action?docID=3138541. 27 Phillips, William D., and Carla Rahn Phillips. A Concise History of Spain. Cambridge Concise Histories. Cambridge: Cambridge University Press, 2010. https://library.norwich.edu/login?url=https://search.ebscohost.com/login.aspx?direct=true &db=e000xna&AN=490553&scope=site. Raquejo, Tonia. "The 'Arab Cathedrals': Moorish Architecture as Seen by British Travellers." The Burlington Magazine 128, no. 1001 (1986): 555–63. Sheren, Ila Nicole. "Transcultured Architecture: Mudéjar's Epic Journey Reinterpreted." Contemporaneity: Historical Presence in Visual Culture 1 (June 1, 2011): 137–51. https://doi.org/10.5195/contemp.2011.5. Stallings-Ward, Judith. "Tiny (Erasmian) Dagger or Large Poniard? Metonymy vs. Metaphor in the Cave of Montesinos Episode in Don Quixote." Comparative Literature Studies. 43.4 (2006) special issue: Don Quixote and 400 Years of World Literature. 441-65. Stallings-Ward, Judith. Gerardo Diego´s Creation Myth of Music: Fábula de Equis y Zeda. London: Routledge, 2020. Urquízar-Herrera, Antonio. Admiration and Awe: Morisco Buildings and Identity Negotiations in Early Modern Spanish Historiography. 1 online resource (289 pages) vols. Oxford: OUP Oxford, 2017. http://public.ebookcentral.proquest.com/choice/publicfullrecord.aspx?p=4850548. Watt, W. Montgomery. A History of Islamic Spain. Islamic Surveys; 4. Edinburgh: Edinburgh University Press, 1977.

' % JUNE, 1900 ooThe0o Qettysbiir Mercury CONTENTS The Evolution of the Thinker, 103 In the Storm, . 110 The Dawn of Idealism, . . Ill The Voice of the Sea, . . 117 A Critique of the Doctrines of Heraclitus, . . . 118 The Noble Hero, . Women as Teachers, Spring, . Editor's Desk Otsego Lake, The Turk in Religion, 121 124 126 127 129 133 \sW-G'BURG C. US, DUPLICATE FAVOR THOSE WHO FAVOR US. For Fine. Printing go to Tk Jo Co Wile Frigiiii Howe CARLISLE ST. GETTYSBURG, PA. C. B. KitzmMer Dealer in Hats, Caps, Boots and . Douglas Shoes GETTYSBURG, PA. B. Dealer in Hats, Caps, Shoes and. Gents' Furnishing Goods Corner Center Square and Carlisle Street GETTYSBURG, PA. EDGAR S. MARTIN, ^CIGARS AND SMOKERS' ARTICLES. Q£T" t^T* t^* Chambersburg St., Gettysburg. Like to learn Spanish? An easy Jan guage to learn. A JlimfuhVs Spanish Method. Self-teaching. SiianUh-ICiKiHx^Engllsh-SpanUh Diction'y, Hossfeld's Italian Method. Self-teaching. I/nlian-ICinjlixh, English-Italian Dictionary, Hossfeld's German Method. SelJ'-teaehlng. . Qerman-English,Engli8h-German Dictionary, $2.00 lloxsfeld's French Method. Sell-teaching. $1.00 French-Fnr/iish, Enalish-Frenck Dictionary. $2.00 lirooks" 1st Latin Jiook. 50 eta. Latin-English, English-Latin Dictionary. $2.00 Jlrooks' \st Greek Lessons. 50 ct3. Greek-English, English-Greek Dictionary. $2.00 Literal Translations of the Classics—Latin, Greek, Germun, French. Eighty-flvc volumes, sold separately, 50 eta. each. Sendfor list. HINDS & HOBLE, Publishers 4-5-1S-14 Cooper Institute N. Y. City Schoolbooks ofall pub-lishers at one store. orsome other v////////// language? .THE. GETTYSBURG MERCURY. VOL. IX. GETTYSBURG, PA., JUNE, 1900. No. 4 THE EVOLUTION OP THE THINKER. PROF. OSCAR G. KLINGEK. (Address on Education before the Susciuehanna Synod, May 9,1900.) TT is my privilege to engage your attention for a little while in A some phase of the general subject of education. It is a sub-ject in which you are profoundly interested, and of the import-ance of which you have a keen appreciation. I take it for granted that you are accustomed to give this hour, not that you may be entertained by an elaborate discourse filled with educa-tional truisms and platitudes, but to hear from some member of your body the newest and best thought of which he is capable. I conceive, therefore, that from me you desire to hear this even-ing what ideal I have of education—what, in my judgment, should be the aim of every system of intellectual discipline. Without hesitation, and asking no favors of adverse criticism, I present for your consideration " The Evolution of the Thinker." Whatever is true in my presentation, I ask you to accept ; what-ever does not appeal to your judgment, I ask you to believe to be the honest expression of a growing conviction. The first voice of the Aryan race to utter its thought was the poet of the Vedic Hymns. In that remote past, when the migra-tion of nations from the old Iudo-Germanic home was peopling Europe and the western part of Asia, the Aryans that settled In-dia were resting for a brief spell in the mountains which form the northwestern boundary of that country. Their eye swept the valley of the Ganges and the valley of the Indus, and as that magnificent landscape lay before them like another Promised L,and, their bards sang of the future. I mention this because in this first voice there is the recognition of the three-fold mystery of existence which is yet but partly solved—the mystery of self, the mystery of the universe, and the mystery of God. It has been 104 THE GETTYSBURG MERCURY. peculiarly the problem of the Indo-Germanic peoples. They only, believing in the authority of the Reason, and being free from the paralysis of fatalism, have dared to pry into things to get, if possible, their inmost secrets. The effort to explain the mystery of self has resulted in all that is known as logic, psychology and ethics; the effort to solve the mystery of the universe has resulted in all that is known as science; and the effort to solve the mys-tery of God has resulted in metaphysics. I have said that the mystery of existence is peculiarly the problem of the Aryan mind, and this finds its proof in the fact that in all other races mythology takes the place of thinking. The nations listen to the voice of fancy, and accept her dreams as the explanation of reality. Hence the lack of progress in the non-Aryan races. One glance at the history of thought among Aryan peoples reveals the business of the thinker. It is to explain the universe as he experiences it. It is to construe in thought the facts as they are presented to his consciousness. In doing this he must be alive to the authority of the Reason; he must inexorably follow her leadings; he must accept her conclusions. Not only this, but his thinking must bear the marks of his own individuality. In process and conclusion it must be distinctly his own. To master another man's thought, to adopt it as his own, is a valuable ex-ercise; but at best it can be only a propaedeutic to his own think-ing. What I wish to emphasize is this, that a man's thought is always an abstract of his own psychic being. A brief survey of the philosophy of knowledge will show the truth of this assertion. Objective cognition involves, first, a world of reality, which can act upon the sensory nerves and furnish the materials of knowledge; secondly, a human mind which is capable of reacting upon the stimulus, and interpreting the presentation; thirdly, the postulate that the principles which are constitutive of intelligence shall at the same time be the principles of cosmic being. i. B3' sense-perception we recognize reality as actually exist-ing and objective, not on the testimony of one sense alone but of all the senses. Even if we mistrust the report of the senses, we still have an invincible proof of the reality of a thing in its power to resist our will. Our whole conscious life, too, is the proof that this world of reality does act continuously upon all the senses, whether we attend to all of them at the same time or not; THE GETTYSBURG MERCURY. 105 and a single moment of reflection will discover to us that all the data of objective knowledge come in through the sensory nerves. Whatever truth there may be in idealism of the type of Berkeley, we are nevertheless certain that an external world does exist, and does act upon the nerves of sense. The first condition of ob-jective cognition, therefore, is met. 2. Again, self-consciousness reveals the existence of a human mind, which is our own true being. This mind exists as states of consciousness, each of which is a complex, and linked by laws of association with what goes before and what follows after. Every moment of our lives is a conscious reaction of this mind against the stimuli which reach it through the nerves of sense. In this reaction the presentation is interpreted by means of the principles which are constitutive of intelligence. Phenomena are brought under the category of substance; uniformities under that of law; persistence amid variety under that of identity; so in the interpretation of every single, definite presentation are used all the categories or ideas of the Reason, and used in the same way by every human intelligence the world over. For the Reason is not individualized but universal, the same for all intelligence. So far, then, all men must think alike. But the ideas of the Reason do not fill up the measure of the reacting mind. Beyond these primary elements which are univer-sal, the objective universe is a variable quantity, being for each mind the creation of its own endowment. As the endowment differs with the individual, it follows that no two persons can have precisely the same universe. Now, since all thinking is the explanation of experience, and as all experience is particularized, it follows that all thinking must be the abstract of the psychic being of the thinker. To this point we shall return a little later. 3. Our warrant for accepting the postulate that the principles constitutive of intelligence itself are also the principles of cosmic being, may find its illustration in the mathematical theory of the universe. Pure mathematics is a deduction from the Reason it-self, and wholly subjective. Its principles belong to the essence of spirit. And yet these mathematical principles are used in the interpretation of phenomena, and so precisely do they fit the sys-tem of things that prediction based upon calculation has become the mark of science. Knowledge is never scientific until it be-comes mathematical. io6 THE GETTYSBURG MERCURY. It was said above that a man's thought must be an abstract of his psychic being. This psychic being must be studied in order that all the elements which it supplies in the act of cognition may be definitely understood. It is never a chance product. What any man is at any moment is always the resultant of his reaction upon external stimulus under the bias of his inheritance and en-vironment. This statement recognizes three facts of human life —the fact of heredity, the fact of environment, and the fact of personality. Let us study their meaning as it relates to the thinker. i. By the term heredity we name that law according to which an organism tends to reproduce its kind. Its action in the biology of plants and animals is an every day fact, and needs no illustra-tion. Its action, too, in the human physical organism is well un-derstood. In the realm of psychology and ethics its meaning is only beginning to dawn even upon scholarship. There its sig-nificance is truly startling. For in human life it means that all life is an unbroken continuity; that each new life is but the last edition of a long line; that the babe which comes to you with all the appearance of sweet innocence—" fresh from the hand of God," as we are fond of saying—that your babe is but you and your ancestors making a new start in the old life—you and your ancestors, With sufficient marks of difference to constitute a distinct individuality." "He is a new product just because he represents a new combination of ancestral influences." Perhaps you are ready to doubt this teaching, and call for some higher authority than your speaker's. Listen, then, to Prof. Sully, one of England's most conservative and most prominent psycholo-gists : "The normal human brain, with its correlated psychical capacities, is, like the human organism as a whole, the result of the hereditary transmission of specific or typical characters from progenitor to offspring." "The child brings with it into the world an outfit of instinctive tendencies or dispositions constituting the natural basis of the civilized or uncivilized man." "In this way we all bring into the world, wrought into the very texture of our brain-centers, the physical basis ot our future individual charac-ter, mental and moral." " The child inherits from its series of ancestors, woven into the texture of its nervous system, a number of dispositions representing ages of ancestral experience." And Dr. G. Stanley Hall: " Heredity has freighted it (the THE GETTYSBURG MERCURY. 107 body) with all the results of parental well and ill-doing, and filled it with reverberations from the past more vast than science can explore." You cannot fail to see the truly awful significance of this un-doubted law. It means that the whole life of the offspring is largely, though, thank God, not wholly, conditioned by the men-tal and moral character of its progenitors. The thoughts which the child thinks, the feelings which it loves best to entertain, the bias and disposition which manifest themselves at such a tender age, and generally continue throughout life, are not original with it, but have their roots back in the lives from which its life sprang. It is not what it would be, and for what it is it is not responsible. Its bias and tendencies, its instincts and impulses, are such as its ancestors have transmitted to it in brain and nerve substance. 2. "Men start out, then, in existence with a vital capital sup-plied by their ancestry, which is modified more or less by the law of diversity." But from the very moment when that individual life begins, another fact becomes of supreme importance—the fact of environment. By this term we designate "the sum of the influences and agencies which affect an organism from with-out." Soil and climate, food and work, and, above all, hu-man comradeship, constitute a man's environment. And all of this is individualized. A babe opens its eyes upon a specific set of visual phenomena; its ears are responsive to a particular set of sounds; its other senses are in due time recipient of definite sets of appropriate impressions. Its mind at first is but potential; but at once it reacts upon the incoming currents, at first feebly, but then with growing strength. Its only content at first is the bundle of dispositions and biases, mainly neural, which are ances-tral in their origin ; and the entire furnishing of its mind is that which comes to it through sense-perception. In other words, each individual mind depends for the character of its ideas upon the environment in which it lives. But the mere physical facts that lie about do not constitute its true environment. A selective process is carried on. Out of the whole number of actual pre-sentations to consciousness, it selects such only as are most con-genial to its native disposition. This process continues with the development of the psychic being of every man, his objects of io8 THE GETTYSBURG MERCURY. knowledge being mainly those phenomena which are most to his taste. 3. Heredity and environment form a large part of every human life, but they do not constitute the whole of it. Their binding power is great, but not entirely irresistible. Men do make choices which are in direct antagonism to both. Many a man whose heredity was all evil has conquered his bias, and lived a true life. This power to choose in opposition to all pre-natal and post-natal influences we call the Will. It is the essence of personality. It is not wholly free, can hardly be said to be free at all at the start; but it is every man's privilege to grow into freedom, and this, in the last analysis, is his chief business in the world. To grow into freedom, to develop into a perfect ethical being, this is his birthright from God—it is the mark of God upon his forehead. The psychic being of every man, then, contains elements which are ancestral in their origin, elements which belong to his early environment, and elements which belong to the constitu-tion of the mind itself. And this is the problem of the educator: Given a human mind, which must react upon and explain the external world, but is itself under the biasing power of ancestral and environmental influences, how shall it construe facts in har-mony with their actual nature ? how shall its thought be a true transcript of reality ? If I have made clear what has been said, then one great prin-ciple has become patent, viz.: Every system of intellectual discipline must have as its supreme aim the mental emancipation of the studejit. All other objects must be subordinated to this. The mind must be so developed that it can cognize a fact in its bleak objectivity. Every prejudice must be laid aside and set at naught. The power of opinion must be broken. The colored lights must be dissipated by the white light of reason. For the true thinker can state his problem only thus : Given the fact, how am I to con-strue it in strict accord with its occurrence ? Now, this freedom of mind is a possible achievement. On its physical side, education is a process of brain-building. It is the creation of new brain-cells. It is a deepening of the convolu-tions . It is no longer doubted by psychologists that thought power depends upon the number and integrity of the brain-cells. Mind and brain are exactly correlated, and every psychic function is accompanied by a corresponding neural process. Since education THE GETTYSBURG MERCURY. 109 is thus on its one side the creation of new cells, may we not sup-pose that such cells lack, in large measure, at least, the bias which dominates the brain of the undisciplined man ? They will, I am sure, if the master-hand who guides the process be a true educator. But on its psychical side, too, education may lead to freedom. Whatever may be the elements of determinism, the will is yet free in the most of its choices. L,et a youth, dominated by the passion for pure thought, determine to conquer all the bias of his nature —determine to think the universe of his experience for himself— determine that facts shall be construed in harmony with their oc-currence, and then let him persevere in this determination, and the day will dawn which will mark his victory. The universe he thinks must still be his universe ; the facts he seeks to construe must be the facts which he experiences and as he experiences them. His thought, therefore, even when uncolored by sub-jective lights and shadows, must still be his own—must bear the marks of his own individuality. This, then, is the first step in the development of the thinker. The discipline through which he passes must have as its supreme aim his emancipation from every form of bias, gift or prejudice under which at the start he lies bound. This is the first step ; but there is a second of equal import-ance. If a man is to think truly he must have the privilege of thinking freely. His environment must be conducive to freedom of thought. I know of nothing which so paralyzes effort as the expectation of being misunderstood and persecuted. No scholar can object to his thought being brought to the test of reality. That is what he craves. Theories are worthless unless they ex-plain facts. All thinking, therefore, must at every point be brought to the test of things. And no true thinker ever shrinks from this test. What he must fear is that his thought will be brought to the test of opinion. Appeal in philosophy is so often an appeal to authority. Now, in some spheres of human interests authority may have its place, but the sphere of thought is not one of them. Each man's thought is valuable in the degree in which it is a true transcript of the cosmic processes, but upon you and me it can have no possible binding power whatever. From the beginnings of European thought to the present time the objective facts have been pretty much the same. Theories iib THE GETTYSBURG MERCURY have been offered for their explanation. The finest minds of each generation have grappled anew with the problem. Much has been achieved, but more still remains to be made rational. Never in its history has the world needed thinkers as in these days of ours. The world's necessity is the educator's opportunity, and more is being done than ever before to enable the student to de-velop into the thinker. But when his thought is laid before the world, and she sees upon it the stamp of his own personality, let her not scream "sceptic," and " infidel" and " atheist;" but let her humbly and gratefully sift his thought, and save the wheat for her granary. For the time has come when of the thinker we may demand that he accept facts as facts, and that he construe them in thought in harmony with the mind's own laws ; but not that he conform his thought to authority, either ancient or mod-ern. Opinion has no place in the test of thought. IN THE STO'RM. I Fast to the anchor on the shore The boat was rocking upon the deep, A cradle for the sleeping' child. The quick storm rose ; the old sea roar Riyalled the thunder ; jerk and sweep Of wave broke loose the boat, ere, wild, The father came. Though all was black, By the trembling- flash that split the east, He saw the child. Mad with alarms He neared the shore. The sea fell back To its vast heap—then rushing fast Swept safe his child into his arms. II Oh, Father, if the storms of sin Break my hold on the anchor of hope And cast me on the wild life sea, When on that shore the waves roll in, Thy everlasting arms then ope And save and clasp and pity me. I THE GETTYSBURG MERCURY. til THE DAWN OF IDEALISM. LDIHES A. WEIGLE, '00. A STUDY in the earlier history of our race, or of some phase **■ of its multiform life and belief, is a task of great difficulty, but which possesses, at the same time, a singular charm. For though that distant world of beginnings is but imperfectly recorded in those of its products which have reached succeeding genera-tions ; though it costs the greatest effort to make real for us the conditions of life and modes of thought of its remote people; thoughstep afterstep in their development can be but conjectured— in these very facts, it seems, there lies a delight which the student alone can attain. There is something intensely attractive about his work as he gropes among the dim shadows of the past, catching here a gleam and here a glimpse of light, which become, to his sensitive soul, a realization, however imperfect, of the dawn of society, of religion, of reason. Among these beginnings, then, that which perhaps appeals most strongly to the mind of the scholar is the dawn of reason, the genesis of real thought. Not without justice, too, for the pre-eminence of humanity lies in the reason, and so may the first steps in the true development of its nascent capabilities be most fit objects of study. There is a peculiar fitness as well as a delight iu looking back at the pioneers of thought approaching the problems with which their successors have grappled likewise; in watching the unfolding of intellect as their conceptions ad-vanced. The proper study of mankind is man ; may we not say with equal truth that the proper study of a rational being is reason. It is significant that this awaking of thought did not take place till so late a date in history as 600 B. C.—the time that men have thought of the great problems of the universe has been centuries less than the former period of mental apathy. But perhaps we should not term it so; it was the period of prepara-tion. The time was ripe for thought; the intellect was keyed to the strain that was to be put upon it; for from Thales, with his turning from mythology to philosophy, but with his poor princi-ple of moisture as the ultimate cause, to Plato, with his turning philosophy into the direction it has since kept, with his doctrines almost Christ-like, and with his idealistic philosophy which has 112 THE GETTYSBURG MERCURY. only lately reached its fullest development, was a period of only two hundred years—absurdly small as compared with the centuries that had gone before and those that have followed. A study of any period of those two hundred years, in many respects the most fruitful in the history of thought, must necessarily be of the richest character. Our subject is concerned with the close of this period, with the laying down, by one man, of the foundation of true philosophy. For Plato, with his idealism, however imperfect, turned thought in the direction it has since followed, and to him must be ascribed our gratitude for the first overthrowal of sensationalism. True, Socrates was the master, the real pioneer ; but all the best that we have of Socrates is through Plato; and he went far beyond Socrates. He caught up the scattered threads of his master's thought; he carried each precious suggestion to its logical end, and added his own crystalline reasoning; and then he wove it all together into a clear system of philosophy which must yet command our respect. Not to say that Plato embodied his thought formally and logically as a system, for it is widely scattered throughout his dialogues, and nowhere arranged with that intent; but it stands clearly and boldly distinct amid the multitude of chaff, so that a student of his writings gains a definite understanding of his thought-concep-tion of the universe. Most of his teaching is put in the mouth of Socrates, a fact which leaves open much for discussion. Many have conceived this Platonic Socrates as a purely dramatic invention. "Plato himself," says Walter Pater, "but presented, with the reserve appropriate to his fastidious genius, in a kind of stage disguise." Just how far this is true, or, on the other hand, how far Plato recorded dialogues that really took place, and the true utterances of his master, we shall possibly never know. But there is no doubt that Plato was an independent thinker, and not a mere scribe, a Boswell before his time. Socrates prepared and suggested; Plato finished that work, and the" enlarged suggestion from its logical completion made it possible for him to transcend the task his master had set him. And Plato's task was by no means easy. From the time of his entering the field of philosophy he was plunged into a combat with the Sophists, who had firm possession of the public mind. Their brilliant show of rhetoric and self-satisfied claim of wisdom THE GETTYSBURG MERCURY. 113 and ability to educate appealed to the minds of the Athenians, just awaking to their intellectual capabilities, far more trrau the modest claims of Socrates and his pupils, and their confessed search after truth. What the Athenian wanted was ability to help himself in the life of his day, and to defend himself before his numerous courts; and the quickest way to such an education was what he sought. There was a strong basis of fact in the Sophists' claim of superiority to Socrates and Plato—in point of popularity at least. There was no such glamour in the sincere quest of reality as in the Sophists7 wisdom—pyrites is sometimes more beautiful than gold. And it was not only in the common mind of the people that Plato had to overcome a presumption in favor of the Sophists. Their doctrines were dominant among the thinkers of the day, among those few pioneer minds who busied themselves with matters deeper than those called for by the exigencies of every day life. They taught what has been revived again and again by men after them, the doctrine of sensationalism ; and it is a mode of thought which appeals most strongly to our first reflection, an error into which it is the easiest thing in the world to fall. "Sensationalism," says Prof. Ferrier, "is supported by the natural sentiments of mankind; it is the scheme which suggests itself most readily to the untutored understanding; it is a product of ordinary thinking. When left to ourselves we are naturally of opinion that all our knowledge comes to us through the senses; that the senses are the main, indeed, the sole means and instru-ments ot cognition, and this opinion is nothing but the doctrine of sensationalism." When we remember, then, that this vulgar, natural error of common thought was supported and systematized by the Sophists, and upheld by their brilliant logic and showy pretensions, which appealed so strongly to the Athenian mind, we can understand in some degree what a force Plato was com-bating— the picture of Socrates drinking the hemlock "for cor-rupting the youth" is perhaps not so inexplicable. "Man is the measure of all things," said the Sophists, This reference of the universe to the individual not only relegated all knowledge to the realm of sense-perception, neglecting wholly the higher processes of thought, but wrought far greater mischief in the realm of ethics. Individual responsibility and individual judgment of the good without any abiding principle is nothing ii4 THE GETTYSBURG MERCURY. but moral chaos. Socrates saw this, and he brought all his magnificent powers of thought and speech to bear against it. He called vice, ignorance, and virtue, knowledge; the true life, to his mind, was the rational life. He taught the independent objective existence of the eternal principles, and that morality lay in the more or less perfect knowledge of these fundamentals. His first endeavor, therefore, was to find a correct theory of knowledge; his most particular aim was a logical definition of the concept. "At the basis of all thought, as Kant has clearly demonstrated, must be a critique of the mind's power to know." Such was the task, then, that Socrates gave over to Plato, and we can only understand Plato's work if we remember this as his aim. "His inquiry was—How to think the universe as given in experience." Plato did not undertake his work blindly, but with a full con-ception of all that it demanded of him. He has been called the creator of philosophy, and, indeed, his thought marks more than a mere step in the line of progress; but he did not make the mistake of attempting total originality. His thought bears the unmistakable marks of careful and thorough study in all that had gone before. Plato was a master of Pre-Platonism. His work was the outcome of a consideration of prior thought; he carefully weighed the previous systems, and took from each its principle of truth. From Heracleitus he derived the doctrine of the perpetual flux—itavra /kc ; from the Eleatics, the permanence of Being; from Pythagoras, the principle of number. For the realm of sense-perception the view of Heracleitus is correct. The senses present a succession of ever-changing phenomena. But Plato saw where Heracleitus failed—in affirming that there is no Being, but Becoming; that "the one thing permanent in a world of change is the law which governs the change." If this were true, knowledge would be impossible-—man would be no better than the brute. Consciousness recognizes-something other than this, for it reacts upon and interprets the phenomena of presenta-tion— there is interaction. And therefore, Plato rejected Becom-ing as the absolute principle of the universe, and adopted the Elea-tic notion of Being. There is Reality, he affirmed; but here again he modified the older doctrine, for the changing phenomena of the universe demand something other than the Eleatic Being, changeless, fixed, " a stony stare." And here came the last of the three prior systems to his help—the Pythagorean number; tafe THE GETTYSBURG MERCURY. "5 mathematical relation mediates between pure being and the changing world. "Pythagoras brought back to Plato's recog-nition," says Walter Pater, "all that multiplicity in men's experience to which Heracleitus had borne such emphatic witness; but as rhythm and melody now, in movement truly, but moving as disciplined sound and with the reasonable soul of music in it." Thus was posited the foundation, not only of Platonic philosophy, but of future thought, in a blending of the guesses of those gropers in the shadows who had gone before. There is change, but not change alone; there is Being, but not changeless Being; there is the union of the two in an interaction of harmony and design. Why that, we say, is modern! Plato is not an ancient philosopher! But Plato's philosophy did not stop here; the most distinctive doctrine of his thought was yet to be developed from this. Socrates had recognized the reaction of the soul in interpreting the phe-nomena of sense; he had seen how the mind abstracts the resem-blances and recombines them in a class-notion, a concept, and, as has been said, one of his most particular aims was the logical definition of this universal. This general concept Plato received from Socrates, and from it he reached his doctrine of ideas, which, more than any other, gives distinction to his thought. In some points almost fantastic, as we now see it, it was a tremendous stride toward the apprehension of reality, and was the starting point of idealistic philosophy. Every human being in the simplest act of knowledge makes use of these concepts or ideas, but he is unconscious of their nature, even of their presence as such; he does not apprehend them as the necessary and essential instruments of thought. Plato saw this, and his conception of ideas became far different from that of Socrates. For Socrates they had been serviceable creations of the reason, essentially subjective in their existence. But Plato detached them from concrete things and gave them objective existence by themselves as real things, independent of the individual mind. Knowledge, he said, is in some sense not active, but passive; these ideas are not the instruments by which we think our experience, but the cause of our thought. Walter Pater puts it clearly : '' They are themselves rather the proper objects of all true knowledge, and a passage from all merely relative experience to the 'absolute.' In proportion as they blend n6 THE GETTYSBURG MERCURY. themselves to the individual, in his effort to think, they create reason in him; they reproduce the eternal reason for him." These ideas are necessary, then; and hence it easily follows that they are universal and co-extensive with reality. Plato also conceived them as innate, not conflicting in this sense with their objectivity and reality; but innate in that they are not the products of experience, but lend themselves to the mind, ready to be called forth by the sense-impressions of experience. In this lay the principle that the seeds of knowledge have a pre-existence in the mind and may be brought forth by growth and development from within, but not imparted to the mind from without. And herein was another point of difference from the Sophists, for they looked on the mind as a waxen tablet on which nothing was originally inscribed, and boasted that'they could impart any knowledge to the pupil; whereas Plato judged with Socrates that true educa-tion lay in drawing from the child's own mind the principles there innate by stimulating the reflective powers. These ideas were conceived also, not as the creative agency, but as prototypes for its use and patterns for reality as we gain it in experience. There is a world of ideas immeasurably higher and purer than this world of sense—our earth compares with it as the shadow with the substance. Plato himself draws this analogy in the "Republic." He supposes a cavern which opens to the day by a long passage before whose mouth is a great fire. Within the cavern are men bound in such manner that they can look only toward the inner wall of the cave, on which are the shadows of the men and animals passing in the outer world between the fire and the mouth of the cave. "These captives exactly represent the condition of us men who see nothing but the shadows of realities. And these captives in talking with one another would give names to the shadows as if they were realities. And if, further, this prison-house had an echo opposite to it, so that when the passers-by spoke the sound was reflected (from the same wall on which the shadows were seen) they would, of course, think that the shadows spoke. And, in short, in every way they would be led to think there were no realities except these shadows." He then imagines that one of these captives is loosed and dragged up into the outer world, and pictures first his pain and blindness in the presence of the true light and his disbelief in the reality of his impressions ; then how he is gradually enabled to see and to THE GETTYSBURG MERCURY. 117 know the truth, and his unwillingness to take up again his former condition. "We must liken the visible world to the dark cavern and the fire which makes objects visible to the sun. The ascent upwards and the vision of the objects there is the advance of the mind into the intelligible world; at least such is my faith and hope. . . . God knows if my faith is well-founded. And, ac-cording to my view, the idea of the Supreme Good is seen last of all and with the greatest difficulty, and when seen is apprehended as the cause of all that is right and excellent. This idea produces in the visible world light and the sun the cause of light; in the intellectual world it is the cause of truth and the intuition of truth." And so these ideas are not co-ordinate, but at the head of all is the notion of the Good. Plato's philosophy has led us to the conception of the Infinite, as must every rational system. And so dawned idealistic philosophy, with its roots far back in the very first of the thinkers, and its plain development in the thought of one man. There is much that is chaff in the pages of Plato, but there is more that is truth. Scribens est mortuus, says Cicero—"he died pen in hand ;" and his work has lived ever after him. For we cannot get away from Plato; his thought is an anticipation of all that has followed. He is ever new and fresh ; his thought is always modern. THE VOICE OF THE SEA. C. M. A. STINE, '01. I sat by the shore of the heaving- sea As the darkness of night grew deeper, And the limitless ocean seemed to me Ivike the lace of a dreaming sleeper. So I listened to the deep-toned murmur, ' Watching the fog wreaths creep Slowly, treacherously nearer To the pallid sands at my feet. I questioned the gray old ocean Who is ever, yet never, the same, "Whereunto hath God created us ? Is't but to sorrow and pain ?" But the all knowing, fathomless sea, As it rolled vast, foam crested and dim, To the paling light of the horizon, Was gray, relentless and grim. n8 THE GETTYSBURG MERCURY. The billows sighed for the mystery And the sorrow of this mortal span ; For man's short life and the losses That come in "three score and ten." "Is this all of your fabled knowledge ?" Broke from me then in my pain, For I sought to find comfort and soothing In the voice of the tossing main. In agony of soul I gazed seaward, When softly over the deep Stole an imperceptible radiance, As the dawn lights on the mountains creep. The mystery of the tossing billows Was hushed, and the thunderous murmur One cadence breathed on the night wind,— "Forget not the love of the Father." Ah, the peace that then came stealing As deep called afar unto deep; The assurance "Thy Father loves thee" Soothed my spirit to dreamless sleep. A CRITIQUE OF THE DOCTRINES OF MERACLITUS. WILLIAM W. FREY, '00. T TERACLITUS. the last representative of the Ionian school of * *■ Greek philosophy, lived, according to Laertius, in Ephesus, about 500 B. C. He belonged to one of the first families of Ephesus, and this is very manifest in the tone of his writings, in his contempt for the masses. In character he was of a melancholy temperament, without political ambition, disliking social inter-course, but greatly inclined towards philosophical speculation. His style of writing, as revealed to us in fragments, was concise, abrupt and very obscure; this obscurity has been attributed to dif-ferent causes by the historians. Ritter supposes it to have been due to the early infancy of prose philosophical writing and to the inadequacy of words to express accurately the thoughts of the lofty range of speculation in which he indulged. Mallet, Descartes and others ascribe it to an intention of the author not to make his meaning accessible to the common people. As to the contents of his work, there is also much controversy. Some regard it as ethical, others political, others solely metaphysical. It seems THE GETTYSBURG MERCURY. 119 likely, as Mallet says, that Heraclitus gave a wider range to phi-losophy in that he included physical, political, moral and mythical questions within his discussion. The problem he sought to solve—common to the Ionian school—was to discover the physical ground of all phenomena ; the principle which pervades and lies back of all natural phenom-ena. It was the "end of wisdom," Heraclitus held, to find this principle. He differed from the others, however, in assuming the position that Reality has necessarily its ground and principle in an "absolute, universal, illimitable, living, perfect essence," en-dued with vital energy or force, and, disregarding the hypothesis of the independent existence of individuals, he endeavored to grasp this notion. Furthermore, he attempted, too, to find out the law of development,—how all things came from this first principle. Let us now view more closely his philosophy, noting the falsity of some of his doctrines as we do so. The principle which seemed to him the most powerful, subtle and pervading of all elements was ''fire;" so he founded his system, according to Draper, upon the simple axiom "that all is convertible into fire and fire into all." By this fire, however, he means not a flame but a sort of dry vapor, using it symbolically to represent the principle of universal vital-ity,— something more than the "arche" of previous philosophy— a life pervading all. He held that from this one principle, all things proceed, and are again resolved into it by a perpetual flux. Nature resembles a river flowing incessantly. There is no Being but Becoming; the common character of all phenomena is a perpetual strife, but still a strife according to necessary, irresistible laws. By opposi-tion wehave harmony ; by rarefaction and condensation, all things, by contraries, all movement. So fire in producing all things; passes through a series of transformations—this is strife; and again, by assimilation all things die out—this is peace. Testing this thought by actual life experiences, one cannot help but notice how true it is. Life is a struggle; death is rest. In his adaptation of fire as a symbol, again we seethe appropriateness, for fire is rest-less, striving, longing to pass into other forms, continually active until extinguished. But when we consider further that he denies existence to everything except the Law of Change, fallacies are very apparent. I 120 THE GETTYSBURG MERCURY. For motion always implies something that moves; change sug-gests materials which are transformed. There can be no "real" phenomena thought of, except in connection with something ex-isting. One attribute is necessary to every substance, viz. Being; and, of course, we must have substance in order to conceive of any attribute at all, such as capability of motion, which is essen-tial to the phenomena of motion or change. Though there is con-tinual change, nevertheless we see more than the process, we see also the things themselves changing. At this place, we must con-sider another false doctrine of Heraclitus—shared later by other philosophers. His teaching that our senses are unreliable and practice deception when they give us certain impressions, is found in different forms and under various guises in the writings of Hamilton, J. S. Mill, Bain, Spencer and others. To discuss this subject,—"the relativity of knowledge," would require a greater expansion of our topic than would be proper. Suffice it to say, in Dr. Valentine's words, that "this theory in whatever form, would do away with the possibility of attaining truth of any kind." The best philosophy of centuries affirms the truth that the ''ratio cognoscendi is grounded in the ratio essendi.'' Of course, Heraclitus, not accepting the senses as giving us truth, and start-ing with the assumed basis of eternal motion, could easily deny Being. Another doctrine, palpably false, which reappeared again many years later, was the "universality of belief as the criterion of truth." He maintained that the universal or divine reason, that medium which surrounds us, which is common to all, only could be relied upon ; but the conceptions of the individual reason were not to be trusted. He says, "to think is common to all; and he that would speak rationally must abide by that which is main-tained by all in common." It must be borne in mind that all his doctrines concerning things both subjective and objective are wholly speculative, not empirical. In pursuing his "vital principle" he lost sight so entirely of the individual that he considered it only as purely phenomenal and delusive. "The only proper starting point is the individual.'' Having begun, as he did with the assumption of the reality only of the universal energy, and then, too, considering this as pure transition alone, it is no wonder that the individual drops out en-tirely as such, and is merged into the universal. THE GETTYSBURG MERCURY. 121 As to his theory regarding the physical universe little need be said. If one bears in mind that it was all theory and not observa-tion, all a priori speculation and not science, his hypotheses will not appear so very unreasonable after all. He supposed the heavens to be basins or bowls, the concave part turned towards us; the stars and sun, flames from earthly evaporations; the size of the sun is just twelve inches ; it is kindled every morning and goes out every night; eclipses are caused by the turning around of the basins. His moral system is based upon the physical, the fundamental doctrine being the excellence of fire. Thus he accounted for a drunkard's acts, by his having a moist soul, and drew the infer-ence that a warm or dry soul is best. His doctrine of the soul of man was that it is a ray from the great fire that is in every phe-nomenon and throughout all nature. He did not approach the idea of a soul as we conceive it to-day,—it was not spiritual at all; in fact some of his writings seem so near later materialistic theories, that Cousin calls them, "Materialism in its infancy." Fatalism is very evident in Heraclitus ; movement is the essential. In Heraclitus as in almost all the better Greek writers, we can easily trace the strong national feeling. Political considerations enter frequently. Note the maxim : "A people ought to fight for their laws as for their walls." With such a system and viewing the conditions of his native country at that time, one is not surprised at his deprecatory esti-mation of humanity which finds expression in this : "The very birth of a man is a calamity—a birth unto death." THE NOBLE HERO. S. W. AHALT, '02. ABOUT two miles south-west of Keedysville, and a mile and a half from Sharpsburg there is a beautiful little cottage sur-rounded by a magnificent grove. In front of the house there is a small porch which is covered with ivy. Directly in front of the porch is a fountain, around which there is a gravel drive. For many years this place was owned by an old man named Hastings. He was a very rich old fellow, yet he spent his yearly income on his only daughter, Naomi. Naomi was a beautiful, fair-cheeked girl with golden hair and dark blue eyes. She was very fond of 122 THE GETTYSBURG MERCURY. fine clothes (as most girls are), and her father tried his utmost to please her in every way possible. Mr. Hastings gave many re-ceptions and dances for his daughter and her numerous friends. At these balls Naomi was looked upon more as a queen than an ordinary girl. Unlike most girls of her age, she did not have any particular gentleman friend, but she was of the opinion that all men are born equal and she treated them as such. One day a young man named Roberts, from N. Y., who was stopping at the Ross hotel in Sharpsburg, called to see Mr. Hastings. It being near the middle of the day, he was asked to stay and take dinner with them, which he did willingly. Mr. Hastings was very much pleased with the appearance and the manners of the gentleman, so he invited him to attend a dance to be given the following evening. Mr. Roberts thanked him very kindly for the invitation and promised him to be present. In the evening, Mr. Roberts was among the first to drive up to the house. He, being a stranger to all the guests, asked for Mr. Hastings, who introduced him to all present. It was a very short time until Roberts became acquainted with all. He was quite a graceful dancer, and of course all the girls were very anxious to dance with the fine-looking stranger. All the time he was dancing you could see that he kept his eye on Naomi and would give her a pleasant smile whenever a chance was given. He had asked her several times to be his partner, but it seemed that she always had an engagement. The dance continued far into the night and it was now time for the friends to say, "Au Re-voir." Roberts was slow in taking his departure, as he desired to speak a few words with Naomi before leaving. One by one the carriages passed through the gate of the yard, until but one re-mained. Naomi and Roberts stepped out on the porch and as soon as Naomi heard the trickling of the water from the fountain the thought struck her that she must have a drink, and in a few moments the two stood beside the beautiful fountain drinking the water from a silver cup. The moon shone brightly and the stars twinkled like diamonds in the azure sky. A few snow-white clouds were floating in the heavens, and a slight breeze, made fra-grant by the rose-buds and peach-blossoms, was moving the leaves of the trees. They watched the little fish swim in the moonlight, and talked about the enjoyable evening they had spent, and Roberts told her THE GETTYSBURG MERCURY. 123 how anxious he had been to dance with her. Roberts now took his departure, but not until Naomi had invited him to call again to see her. After this his visits were very numerous, and at last they became engaged to be married. About this time the famous battle of Antietam was fought and on the 16th of July, '62, Roberts decided to go into the battle and fight for his country. He spent that evening at Hastings', and Naomi tried every way possible to induce him to stay out of the battle, but he was determined to help his struggling country and he did so. When he departed that night Naomi left these words with him: "Farewell! The sun no longer shines, The skies no more are blue Above this lonely life of mine ; The sunlight goes with you. But oh, whatever lot I see Thro' sunshine or thro' rain, My L,ove, I will be true to thee Until we meet again." Yes, the battle was fought and the victory won. The noble hero had done his part, although it cost his life. Naomi watched both day and night for her lover's return, but alas ! she watched in vain. He was among the many hundreds of soldiers who were lying dead upon the battlefield, covered with blood and dust. There was a letter in his pocket from Naomi, which was the only thing that kept him from being buried among the unknown. A few days afterwards, Naomi was walking past the graves of the soldiers and she saw her lover's name (A.M. Roberts) in her own hand-writing tacked upon a slab at the head of a grave. She burst into tears, but consoled herself by thanking God that she knew where he was buried. For many years Naomi kept flowers upon the hero's grave, and you can now see his name upon the headstone on the western slope of the National Cemetery at Sharpsburg. I24 THE GETTYSBURG MERCURY. WOMEN AS TEACHERS. GERTRUDE FREY, '00. HPHE higher education of women is a problem which has been * agitated for many years. Formerly woman's subjection to man was very nearly complete in all respects, whether considered from a social, a political or an intellectual point of view. But from being the property of man, she emerged, under civilization, from the sphere of drudgery to that of social power, and conse-quently to the liberty of cultivating her mental faculties. Some people profess to believe that the development of woman's mind is undesirable, because there is a tendency toward what is called "strong-minded" women. But the higher education, rightly pursued, does not make women cold, hard and semi-mas-culine, as many claim it does. Indeed, the more a woman knows of life, the better she understands the past and present of the world, and the experiences and conclusions of its greatest thinkers, the less likely she will be to confuse the masculine and feminine ideals, or to underrate the latter in comparison with the former. Experience has proved to us that women are capable of just as high intellectual development as men ; and many have taken ad-vantage of the opportunity given for the higher education, whether they expect to enter a profession or not. A study of the census statistics leads to the broad statement that there are but few lines of remunerative employment not now open to woman. She is found in nearly all departments of pro-fessional life—ministry, medicine, literature, art, music, the drama, education and science. Of the 128 occupations classified in the census of 1890, only one—military pursuits—had no femi-nine representative. There are some professions which I think are not desirable for women to enter. Generally when the college woman thinks of doing something as a means of livelihood, she thinks of teaching. There have been many objections made to this, because it cannot be assumed that 50 per cent, of all college women have special gifts in the same direction. Experience shows that the special gift for teaching is as rare as other talents, and as valuable when it finds its true expression. Kate Claghorn writes that the evil results to the teacher her-self of this overcrowding of her profession are many. First, ' 'she THE GETTYSBURG MERCURY 125 must accept a low rate of pay for her work ; next, she must be content with an inferior position; furthermore, she must lengthen her period of preparation, not always with advantage to the work that she wants to do." She also says, that the remedy for this is plain : That women who graduate from college with the inten-tion of earning a living, should look about for other occupations than that of teaching. " With lowered competition, not only would salaries be raised, but quality of service also." While it is admitted that there are many teachers who perhaps would do better work in other professions, yet it cannot be denied that teaching is one of the best and most suited professions for women. There are many more female teachers than male, yet there are many discriminations made against them. There is no longer a discrimination of position, because women hold just as high posi-tions as men. Women are holding the positions of State, City and County Superintendents. These are principally in the West. But there is a discrimination in salaries, except in the higher positions, where they are the same for all. Let me give a few of Mr. Wright's reasons why women receive less than men. First, "stepping out of industrial subjection, woman comes into the in-dustrial system as an entirely new economic factor. Secondly, woman occupies a lower standard, both in physical features and in mental demands. Thirdly, she receives low wages through an insufficient equipment for life's work, which is not the result of incapacity or lack of skill, but is due largely to the hope that the permanence of work will be interrupted by matrimony." This is in some cases true, and it has a tendency to lower the wages, so that those who do intend to make it a life-work, and do it because they feel that they can do better along this line, cannot receive the salary that they should have. There are many other reasons given why women are paid less than men; but it seems to me that there should be no discrimina-tion made in the payment of salaries if the work is equally well done. Agues Wright says : " The growing importance of woman's labor, her general equipment through technical education, her more positive dedication to the life-work she chooses—all these combined will place her on an equality with man. As she ap-proaches this equality her remuneration will be increased and her economic importance acknowledged." 126 THE GETTYSBURG MERCURY. While I am in favor of the higher education of woman which places her on an equal basis with man, I think she should net be given the right of suffrage. This would not elevate her. It would take her out of her proper sphere, and tend to destroy all the characteristic traits which are especially desirable in a true womanly character. SPRING. C. R. SHDLTZ, '03. As I hear the bluebird's song And the robin's sweet refrain, I know that Spring- has come again, With pleasures for weak and strong. O, the beautiful days of Spring, Of all the days the best! When Nature, renewed by rest, Again the flowers doth bring. The Earth has been quickened by rain, And hath donned her cloak of green; And leafless trees, by a hand unseen, Have been brought to life again. Hail, then, thou glorious Spring ! For we greet thee with good cheer; Hail, blessed season of the year! Thy praise we do gladly sing. _-L .'THE. GETTYSBURG MERCURY Entered at the Postoffice at Gettysburg as second-class matter. Voi,. IX. GETTYSBURG, PA., JUNE, 1900. No. 4 Editor-in- Chief, S. A. VAN ORMEH, '01. Assistant Editors, W. H. HETRICK, W. A. KOHLSE. Business Manager, H. C. HOFFMAN. Alumni Editor, REV. P. D. GARLAND. Assistant Business Manager, "WILLIAM C. NEY. Advisory Boards PROF. J. A. HIMES, LIT. D. PROF. G. D. STAHLEY, M.D. PROF. J. W. RICHARD, D. D. Published monthly by the students of Pennsylvania (Gettysburg-) College. Subscription price, One Dollar a year in advance; single copies Ten Cents. Notice to discontinue sending1 the MERCURY to any address must be accompanied by all arrearages. Students, Professors, and Alumni are cordially invited to contribute. All subscriptions and business matter should be addressed to the Business Manager. Articles for publication should be addressed to the Editor. Address THE GETTYSBURG MERCURY, GETTYSBURG, PA. EDITORS' DESK. ^~\N Saturday evening, May 12th, the Y. M. C. A. entertain- ^-"^ ment course was completed with a lecture on Literature as a Personal Resource, by Hamilton Wright Mabil, editor of The Outlook. None but words of appreciation were heard from those who are interested along the line of Mr. Mabil's lecture. The lecture was delivered in a conversational rather than in an oratorical manner. His smooth flow of plain language, to-gether with his great breadth and unusual discrimination, are the characteristics that captivate his audiences. He gave us the best thoughts that have accumulated from his broad experience in the field of literature. Mr. Mabil seems to have felt the pulsations of the hearts of the masters, and received their vitalizing in-fluences. ! 128 THE GETTYSBURG MERCURlt \V7E gratefully acknowledge the receipt of Commencement pro- ** grams and invitations from State College and Dickinson. J> 'THE cause advocated by the following letter merits recognition *■ in THE MERCURY, hence we publish it in full, hoping that by so doing we may lend some assistance to a worthy cause. The tireless efforts of President Passmore will, we hope, be rewarded in this meeting. ■To TEACHERS, DIRECTORS AND FRIENDS OF EDUCATION IN PENNSYL-VANIA : I desire to call your special attention to the next meeting of the Pennsylvania State Teachers' Association, which will be held this year in the city of Williamsport, Pa., July 3rd to 6th, inclusive. Every enrolled member of this Association will receive a copy of the addresses and other proceeding's, not only of the State Teachers' Association, but of the City, Borough and Township Superintendents' Association, and also of the State School Directors' Convention, thus getting1 the very best thought along these different lines in the State. I appeal to the friends of education in Pennsylvania to enroll in large numbers. There are over 26,000 teachers in the State in the pub-lic schools alone, and the number of superintendents, teachers, direc-tors and other friends of education enrolled should not be less than 10,000. The trip to Williamsport is a pleasant one. It is an ideal place to meet—fine hotels, its citizens noted for their hospitality, elegant drives; and the excursion to Eaglesmere will be a great attraction. The pro-gram is excellent. Turn out in large numbers, and show your interest in the great educational Association of your State. If you find it utterly impossible to attend the meeting, send your enrollment fee of $1.00 to Prof. David S. Keck, Treasurer, Kutztown, Pa., who will promptly send you a certificate of membership. Let me not plead in vain for our dear old Commonwealth to make this meeting a record-breaker. JOHN A. M. PASSMORE, President. A S this is the last issue of THE MERCURY this college year, it ■**■ seems in place to express our appreciation of the courtesies of the Student body and Alumni who have so generously fur-nished us the material with which to fill our pages. The primary object of the journal is to encourage writing on the part of the students, both in prose and verse; and it seems to be accomplish-ing this end. Not all the articles that appear are of the first or-der, nor can this be expected; for, if only the best were accepted, THE GETTYSBURG MERCURY. 129 we should want for material, and again that needed stimulus would not be furnished to the students in general—which is THE MERCURY'S mission. The present number—and such is the case with most issues—contains articles above the average, articles worthy of study. \V7E are glad to acknowledge the receipt of the May numbers " of The Washington Jefferso7iian and The Western JJyiiver-sity Courant, two journals that have not been reaching us. OTSEGO LAKE. WM. M. ROBENOLT, '02. f~\F the many little sheets of water found in the mountainous ^-' districts of central and eastern New York there is none which surpasses Lake Otsego either in the beauty and variety of its surrounding scenery or in the number and interest of the historical events connected therewith. "Peerless among- these mountain gems, Unmatched 'mong nature's diadems, Is Lake Otsego, 'Glimmerglass,' Whose grandeur rare naught can surpass." This body of water, forming a basin ten miles in length and one in width, is located on the hills forming the watershed between the Mohawk and Susquehanna rivers, its elevation above the sea level being about 1,300 feet. At its outlet is where the Susque-hanna enters upon its long and winding and troubled course toward the ocean. It lies within the territory formerly occupied by the Mohawks, and this region was their favorite fishing and hunting ground. Along its western bank was the trail of these Indians in their journeys toward the south. From this region, undoubtedly, furs and skins were sent to Ft. Orange to be bartered with the early Dutch traders, for the hills abounded in fur-bearing animals of different species. This lake furnished a means for Gen. James Clinton, after making his expedition up the Hudson and the Mohawk, to convey his army southward to meet Gen. Sullivan who was to yAn him from the south and then march into the country of the Cayugas and Senecas. On the first of July, after carrying his boats over-land from the Mohawk, he embarked at the head of the lake with 130 THE GETTYSBURG MERCURY. over two hundred boats and began his journey over its placid waters toward the Susquebanna—a larger fleet, doubtless, than shall ever again float on these waters. After landingat the outlet they encamped on ground now occupied by the village and waited for orders to move southward. During the stay here of nearly six weeks he and his men amused themselves by hunting the deer on the hills and fishing in the lake. This beautiful sheet of water is the first on which James Fenimore Cooper's eyes fell with a conscious look, and be-ing reared along its shores, it was always a charming spot to him. It has been made famous by his classic pen, for in and about this lake are laid some of the most interesting scenes found in his "Leather Stocking Tales.'' In this vicinity is where Natty spent his time in hunting with the Indians, and now may be seen on the eastern shore near the foot of the lake a fine marble statue of him, standing erect on a small monumental column ; the tall white figure of the old hunter stands gleaming among the higher branches of a grove of young pines, looking over lake and valley. The one who visits this lake to-day does not see the unbroken sylvan surroundings that were here in the days of Clinton and Cooper. When Clinton encamped here there were no permanent dwellings and very few in Cooper's younger days. Now may be seen a village at either end and cottages and beautiful farm houses around its shores. To one who has an eye for the beauties of Nature, the views about this lake are an unceasing source of delight. Hills, inter-spersed with woods and meadows, abounding in springs whose water trickles down their banks finding its way to the basin of the lake, rise from either side, those to the east being for the most part steep and rugged, while those to the west have a more gentle slope. Thousands of visitors seek this spot every summer, and the entire length of its beach is dotted with tents and camping houses. A roadway parallels the whole lake and pleasure seekers often take a drive, making the complete circuit, a distance of twenty-five miles. The village lying at its southern shore is called Cooperstown, from the name of its founder. Here are the summer residences of some of the most prominent people of this country. From the pier at this place one can get a view of nearly the whole lake. To the right of the pier and not far from the outlet THE GETTYSBURG MERCURY. 131 may be seen the rock which formed the place of meeting for Deer-slayer and Chingachgook, with the limpid waves rippling about as they did at the time of this meeting. It is now known as Otsego or Council Rock. The river for the first few rods, after receiving the water from the lake, flows so smoothly that scarcely a ripple may be seen. Its terraced banks are covered with scenery which may well challenge a rival. It has been termed the "Lover's Lane." To the eastward of the outlet and beyond the village, rising in terraces, is the "Lakewood" cemetery, one of the most beautiful in the country, among whose marble columns, one erected to the memory of Cooper towers above the rest. On its base are sculptured emblems of the author's thought, and on the top, with dog and gun, is Leather Stocking—Fiction's son. The body of Cooper, however, was laid to rest in the village churchyard nearby. At the east from the cemetery one of the slopes rising above the others is known as Mt. Vision. From this height where the whole lake is visible it appears like an opal enclosed in an emerald. To the north of the cemetery, a little distance up the hillside from the beach, is found the Fairy Spring. Chaliced in a solid rock, its waters form a mirror here in the hillside. Every summer many little parties picnic here for a day and many interesting little stories are connected with the consecrated spot. Farther up along the eastern coast and not far from the shore has been erected a tower which commands the view of the lake. The name "Kingfisher Tower" has been given this. A short distance to the north and up on the hillsides, which here are so steep they can scarcely be climbed, may be found a rocky glen, the famous "Leather Stocking Cave." "Sulphur Spring" is the next point of interest, whose waters are valuable for medicinal purposes. A short distance from here two streams side by side glide down the mountain with a narrow ridge between them in the form of a roof, called the "Hog-back." When viewed from the lake the deep ravines which form the bed of these streams appear like a large "W." Farther on the hills take a gentle slope and through them flows a stream which is one of the most beautiful places about the whole lake. Its banks are lined with trees whose images are reflected in the water. It is termed the "Shadow Brook," the northern "Lover's Lane." Nearby lies a promontory whose f 132 THE GETTYSBURG MERCURY. gentle slopes have been cleared of their forest growth. This viewed at a distance assumes the form of some monster crouching for his prey, and from this resemblance has been called the "Sleeping Ivion." Tradition tells us that in Cooper's day an island lay off the coast of this promontory. (On this island was Hutter's cottage.) It, however, has since been submerged and lies but a few feet below the surface. An interesting story is connected with this and the "Sleeping L,ion." It is said that the lion outstretched his paws, struck the island and caused it to sink beneath the water, and to-day we have the "Sunken Island." This brings us near the head of the lake where the village of Springfield is situated. The points of interest along the western shore are not so numerous, though the views gained from this side are much more beautiful than those gained from the east side. Two points of interest, however, command our attention, Three Mile and Five Mile Points, situated, respectively, three and five miles from the village of Cooperstown. It is scarcely possible to imagine a spot more charming than the one first mentioned. Jutting out into the limpid waters of the lake at the foot of a height, lined with a pebbly beach, covered with trees and a grassy carpet, it seems to possess every charm to render it a favored spot. A limpid spring, remarkable for the coolness and sweetness of its waters, rises from the gravel of the beach at the very root of ancient trees. A wild brawling brook coming down from the hills has torn for itself a rude channel, adding variety to the ground, and often blending the troubled murmur of its waters with the gentle play of the ripple on the beach. The views in every direction are unsurpassed. In the rear, rise hills which seem to touch the sky in the distance. The eye, having wandered over a beautiful expanse of water, sees hills on the opposite side covered with woods and meadows from the strand to their crest. To the northward is the isolated height before mentioned as the "Sleeping Lion." To the southward lies the village of Cooperstown and the valley of the Susquehanna with a background of low mountains in the distance. This was one of the places selected by Cooper for several of his most impressive scenes. On this point the "Mingoes" are encamped when Natty's daring rescues Hist; and here he sends the canoe with the Indian lovers adrift and remains himself a THE GETTYSBURG MERCURY. 133 prisoner. And here is where Deerslayer was captured by the Indians. Ever since the days of Cooper this spot has been sacred. During the summer several boats make daily trips from one village to the other, stopping at the intermediate points of interest. Who, after enjoying a ride on the Natty Bumpo, can forget the beautiful scenery gained from her deck ? Smaller crafts may be seen floating on the glassy surface for its entire length. This lake will always be held dear in the memory of one who has visited it. All whose paternal homes lie on or near a fine lake shore can readily say with Natty, "My eyes never a-weary looking at it." Irving waters are the very soul of a landscape. There is certainly no other natural object, however fine, whether imposing like a grand mountain or winning like a smiling valley, which carries with it so much of the spirit of companionship through all the successive years of a human life, as a lake, and one of a limited size awakens more of this feeling than a larger body of water. THE TURK IN RELIGION. A. H. MERDINYAN, '01 (KONIA, ASIA MINOR). 'THE Mohammedan world is proud of her children, who have intense loyalty to their religion, and are active for its wel-fare. Although the nation is a prey to the misteaching of the Koran, still feeling it j»o be the best pioneer of truth, they live under its obscure banner and the misery of misleading religion. The Turk is intensely religious in his belief, and endeavors to accomplish all the rites and duties of his religion. He is held within the limits of his false religion, and his freedom of thought and private judgment is crushed, and he cannot find an occasion to develop for better. He has no freedom to accept the other re-ligion, which is far better than his. The Turk in religion is what he is, and remains what he is, because his religion is Moham-medan. There is no leaven in it. Elements of kindness, politeness, hospitality and religious fer-vor are their good qualities ; but they show anger, hatred and bitter cruelty when occasion offers. In the highest attitude of his religious inspiration he often gets too wild, and is not less than a beast. He is a cold-blooded murderer and butcher to carry on the false mission of the Koran, as he believes it to be his reli-gious duty. In his religious inspiration he cries out, "O Eord of 134 THE GETTYSBURG MERCURY. all creatures ! O Allah ! Destroy the infidels and polytheists, thine enemies, the enemies of the religion ! 0 Allah ! make their children orphans, and defile their abodes, and cause their feet to slip; give them and their families, their households, their women, children, possessions and race and their wealth and lands as booty to the Moslems, O God of all creatures !" The Turks are missionaries as well as Christians. They press steadily forward to convert the world. They labor under a mis-erable delusion and misconception that Mohammedanism is an elect, and paves the way for a purer faith, which leads to the life eternal. The sword of Mohammed and the Koran are the most stubborn enemies of civilization and truth the world has yet known; and every believer in the Koran is in the same propor-tion anxious to bring many under the bloody and shameful banner of his religion. They have the great honor (?) of being the most destructive and cruel nation of the world. To-day the largest religious university in the world belongs to the Mohammedans— " Ayhar," the university in Cairo, where nearly ten thousand young men are preparing themselves for the priesthood, to spread and proclaim the doctrines of Mohammed to the wide world. Al-most every town and city of the country is provided with theo-logical schools, graduating every year scores of young priests for the mission of Mohammed. Iconium, with its sixty thousand population, has thirty-five Mohammedan theological schools. Mohammedanism is an aggressive religion, and is anxious to bring "kafirs" Infidels (as they call the Christians or non-Mo-hammedans) within its pale. We cannot overlook the fact that in late years they have written pages of history with their sword dipped in Armenian blood. Their extreme civil and religious measures were more than an Armenian nation could bear, and the result has been cold-blooded murder throughout the land. The blame is on Christian nations, who, being unconcerned, tol-erated their brothers and sisters to suffer unto the death under the paw of a wild and cruel nation, which every day strives to exter-minate all those who are outside of their religious sphere, as well as on the Moslems. So long as the political power and supremacy rests in the Turk, there can be no real civil and religious liberty in that country. There are 200,000,000 Mohammedans in the world—nearly one-eighth of the human race—who live and die under the stub- THE GETTYSBURG MERCURY 135 born doctrines and statutes of the Koran; under its sway the radi-cal evils of polygamy and divorce are fully practiced among them. Islams can legally and religiously take as many as four wives, but the number of concubines is not limited. The Turk not only looks upon polygamy as right and proper, but he considers it a religious duty. The practical duties of a Mohammedan are pro-fession of faith, " L,a ilahe illallah Mohammed er-resoul-oallah" (There is no God but one God, and Mohammed is the Apostle of God); ablution with prayer; giving alms to the poor; and going to Mecca. Kach faithful believer ought to pray five times a day —at dawn, at noon, in the afternoon at three o'clock, at six o'clock, and in the evening at eight o'clock. Before each prayer ablution, washing of hands, feet, mouth, ears and face is impera-tive. "While doing this certain prayers are offered for the for-giveness of the sins which are committed with these several mem-bers. The form of worship consists of kneeling down, rising, bowing down, kneeling again, and putting face against the floor, and each time whispering certain prayers; then clasping the hands over the face, passing them down and off as if driving the devil away. The mosques are open at all hours during the day. The external part of the mosque is most gorgeous and mag-nificent, but internally it is very plain. The floor is covered with beautiful rugs or carpets. No chairs are in the mosque. Here and there some texts from the Koran are written in large letters. Mosques have no bells. "Magin," with loud voice, yell from the top of minarets, " There is no God but one God, Mohammed is the Apostle of God;" "Come to prayer, come to the temple of life." That is the echo which comes from the hundreds of mina-rets each day five times. Friday is their Sabbath. After ablution each believer enters into the mosque, after taking off his shoes at the vestibule or door, and takes his place beside his fellow-be-lievers. An ultimate reverence and respect prevails during the prayer—no talking, no laughing, no sleeping ; even coughing is checked by each believer, in intense reverence to prayer. In perfect harmony the immense body of believers worship in such a solemn manner as can hardly be seen in any other place of wor-ship. The preacher is at the altar. He is without any special garment. He leads the prayer, and each of his movements or prostrations are observed and imitated by hundreds and thousands of worshipers. After prayer they may hear some exhortations from the Koran on their practical duties of religion, and then they are dismissed. 1 PATRONIZE OUR ADVERTISERS. C F. SOLT MERCHANT TAILOR Masonic Bldg., GETTYSBURG Our collection of Woolens for the coming Fall and Winter season cannot be surpassed for variety, attractive designs and general completeness. The latest styles of fashionable novelties in the most approved shades. Staples of exceptional merit, value and wearing durability. Also altering, repairing, dyeing and scouring at moderate prices. .FOR UP-TO-DATE. Clothing, Hats, Shoes, And Men's Furnishing Goods, go to I. HALLEM'S MAMMOTH CLOTHING HOUSE, Chambersburg St., GETTYSBURG, PA. ESTABLISHED 1867 BY ALLEN WALTON. ALLEN K. WALTON, President and Treasurer. ROBT. J. WALTON Superintendent. Hummelstooin Broom Stone Company Quarrymen and Manufacturers of Building Stone, Sawed Flagging and Tile Waltonville, Dauphin Co., Pa. Contractors for all kinds of Telegraph and Express Address. Cut Stone Work. BROWNSTONE, PA. Parties visiting the Quarries will leave cars at Brownstone Station on the P. & R. R. R. For a nice sweet loaf of Bread call on J. RAMER Baker of Bread and Fancy Cakes, GETTYSBURG. PA. EIMER & AMEND, Manufacturers and Importers of Chemicals and Chemical Apparatus 205, 207, 209 and 211 Third Avenue, Corner 18th Street NEW YORK. Finest Bohemian and German Glassware, Royal Berlin and Meissen Porcelain, Pure Hammered Platinum, Balances and Weights. Zeiss Mi-croscopes and Bacteriological Apparatus; Chemical Pure Acids and Assay Goods. SCOTT PAPER COMPANY MAKERS OF FINE TOILET PAPER 7th and Greenwood Ave. PHILADELPHIA PATRONIZE OUR ADVERTISERS. The Century Double-Feed Fountain Pen. Fully Warranted 16 Kt. Gold Pen, Indium Pointed. GEO. EVELER, Agent for Gettysburg College PRICE LIST. No. 1. Chased, long- or short $2 00 No. 1. Gold Mounted 3 00 No. 3. Chased 3 00 Spiral, Black or Mottled $2 50 Twist, " " 2 SO Hexagon, Black or Mottled 2 50 No. 3. Gold Mounted 4 00 Pearl Holder, Gold Mounted 5 00 THE CENTURY PEN CO., WHITEWATER, WIS Askyour Stationer or our Agent to show them to you. Agood local agent wanted in every school mmmv,-,_.,u. sammmmmmwmwmmmmmmmmmmwwwgg Printingand Binding We Print This Book THE MT. HOLLY STATIONERY AND PRINTING CO. does all classes of Printing- and Binding-, and can furnish you any Book, Bill Head, Letter Head, Envelope, Card, Blank, or anything- pertain-ing- to their business in just as good style and at less cost than you can obtain same elsewhere. They are located among the mountains but their work is metropolitan. You can be convinced of this if you give them the opportunity. Mt. Holly Stationery and Printing Co. K SPRINGS, PA. =3 H. S. BENNER, .DEALER IN. Groceries, Notions, Queenswcire, Glassware, Etc., Tobacco and Cigars. 17 CHAMBERSBURG ST. WE RECOMMEND THESE BUSINESS MEN. Pitzer House, (Temperance) JNO. E. PITZER, Prop. Rates $1.00 to $1.25 per day. Battlefield a specialty. Dinner and ride to all points of interest,including the tb ree days' fight, $1.25. No. 127 Main Street. MUMPER & BENDER Furniture Cabinet Making, Picture Frames Beds, Springs, Mattresses, Etc. Baltimore St., GETTYSBURG, PA. You will find a full line of Pure Drugs and Fine Sta- People's Drug Store Prescriptions a Specialty. .GO TO. {}otel (Gettysburg Barber Sfyop. Centre Square. B. M. SEFTON J. A. TAWNEY ». Is ready to furnish Clubs and Bread, Rolls, Etc. At short notice and reasonable rates. Washington & Middle Sts., Gettysburg. W.F.CODORI, M*£T£&! Dealer in Beef, Pork, Lamb, Veal, Sausage. Special rates to Clubs. York St., GETTYSBURG. Davxb Croxel, Dealer in ^tne (groceries cmb notions «-«-4}ork Street. .GO TO. CHAS. E. BARBEHENN, Barber In the Eagle Hotel, Cor. Main and Washing-ton Sts. YOHN BROS. Agents for the Keystone State, Waldo, Washburn, Groupner & Meyer. Highest Grade Mandolins, Guitars, Banjos, Mandollas and Mandocellos. Headquarters for Phonographs, Graphophones and supplies. Trimmings of every description. All sheet music one-half off. Large discounts on Books and studies. 326 Market St., Harrisburg, Pa. FAVOR THOSE WHO FAVOR US. Spalding's OFFICIAL Athletic Goods Officially adopted by the leading Colleges, Schools and Athletic Clubs of the Country. Every requisite tor Baseball, Football, Golf, Tennis, Athlet-ics, Gymnasium. Spalding's Offi- 'cial League Ball is the Official Ball of the Na-tional League and all the lead-ing college asso-ciations Handsome cata-logue of Athletic Sports free to any address. Spalding's Baseball Guide for 1900,10 cts. A. Q. SPALDINQ & BROS. New York Chicago ROWE. YOUR GROCER Carries Full Line of Groceries, Canned Goods, Etc, Best Coal Oil and Brooms,at most Reasonable Prices. OPPOSITE COLLEOE CAMPUS. S. J. CODORI, Stationery, Blank Books, Amateur Pho-tographic Supplies, Etc., Etc. BALTIMORE ST. R. H. CULP PAPER HANGER, Second Square, York Street. COLLEGE EMBLEMS. EMIL ZOTHE, ENGRAVER, DESIGNER AND MANUFACTURING JEWELER. 19 S. NINTH St. PHILADELPHIA. PA. SPECIALTIES:- Masonic Marks, Society Badges, College Buttons, Pins, Scarf Pins, Stick Pins and Athletic Prizes. All Goods ordered through A. N. Bean. To Repair Broken Arti-cles use Major's Cement Remember MAJOR'S RUBBER CEMENT, MAJOR'S « LEATHER CEMENT. Meneely Bell Co. TROY, N. Y. MANUFACTURERS OF SUPERIOR BELLS The 2000 pound bell now ringing in the tower of Pennsylvania Col-lege was manufactured at this foundry. PATRONIZE OUR ADVERTISERS. The Pleased Customer Is not a stranger in our establish-ment— he's right at home, you'll see him when you call. We have the materials to please fastidious men. J. D. LIPPY, Merchant Tailor 39 Chambersburg- St., Gettysburg, Pa. G. E. SPANGLER, Dealer in Pianos, Organs, Music, Musical Instruments, Strings, Etc. YORK STREET, 1ST SQUARE. GETTYSBURG. L. D. Miller, GROCER Confectioner and Fruiterer. Ice Cream and Oysters in Season. 19 Main St. GETTYSBURG City Hotel, Main St. Gettysburg. ^ Free 'Bus to and from all Trains Thirty seconds' walk from either depot Dinner with drive over field with four or more, $1.35 Rates $1.50 to $2.00 per day John E. Hughes, Prop. Capitol Cit? Cafe Cor. Fourth and Market Sts. HARRISBURQ, PA. First-Class Rooms Furnished. Special Rates to Private Parties. Open Day and Night. European Plan. Eunch of All Kinds to Order at the Restaurant. ALDINGER'S CAPITOL CITY CAFE. POPULAR PRICES. F. Mark Bream, Dealer in Fancy and Staple Groceries Telephone 29 Carlisle St., GETTYSBURG, PA. .Photographer. No. 3 Main St., GETTYSBURG, PENNA. Our new effects in Portraiture are equal to photos made anywhere, and at any price PATRONIZE OUR ADVERTISERS alright, 140-142 Woodward Avenue DETROIT, MICH. Manufacturers of High Grade Fraternity Emblems Fraternity Jewelry Fraternity Novelties Fraternity Stationary Fraternity Invitations Fraternity Announcements Fraternity Programs Send for Catalogue and Price List. Special Designs on Application. MOTEL GETTYSBURG LIVERY GETTYSBURG, PA. LOING & HOLTZWORTM, Proprietors Apply at Office in the Hotel for First-Class Guides and Teams THE BATTEFIELD A SPECIALTY TTbe JSoIton Market Square "Ibartfeburg, lpa. Large and Convenient Sample Rooms. Passenger and Baggage Elevator. Electric Cars to and from Depot. Electric Light and Steam Heat. J. M. & M. S. BUTTERWORTH, Proprietors Special Rates for Commer-cial Men "EZ 1ST IMMER CUT ET WAS ZU WISSEIN." These are the words of Goethe, the great German poet, and are as true in our day as when uttered. In these times of defective vision it is good to know something about eyes. A great deal has been learned about the value of glasses and their application since Goethe lived. Spectacle wearers have increased by thousands, while at the same time, persons losing their eyesight, have been greatly diminished. If your eyes trouble you in any way let me tell you the cause. Examination free and prices reasonable. We grind all our own lenses and fit the best lenses (no matter what anyone else has charged you) for $2.50 per pair and as cheap as SO cents per pair, or duplicate a broken lens if we have one-half or more of the old one, at a reasonable charge, returning same day received. .E. L. EGOLP. 807 and 809 North Third Street, MARRISBURG, PA. r PATRONIZE OUR ADVERTISERS. (^entFal [lotel, ELIAS FISSEL, Prop. (Formerly of Globe Hotel) Baltimore Street, Gettysburg, Pa. Two doors from Court House. MODERN IMPROVEMENTS. Steam Heat, Electric Light and Call Bells all through the House. Closets and Bath Rooms on Every Floor. Sefton & Fleui-mrng's Ijivery is connected with this Hotel. Good Teams and Competent Guides for the Battlefield. Charges Moderate, Satisfaction Guaranteed. Rates $1.50 Per Day. GET A SKATE ON And send all your Soiled L,inen to the Gettysburg Steam Laundry R. R. LONQ, Prop. R. A. WONDERS, Corner Cigar Parlors. A full line of Cigars, Tobacco, Pipes, Etc. Scott's Corner, Opp. Eagle Hotel. GETTYSBURG, PA. J^ Try My Choice Eine of A t. High-Grade Chocolates 3 L p y. J. V. at 40c per lb. Always fresh at ,\ £ CHAS. H. McCLEARY j £ Carlisle St., Opposite W. M. R. R. j) l. Also Foreign and Domestic Fruits A j" Always on Hand. ** JOHN M. MINNIQH, Confectionery, lee, • andIee Creams. Oysters Stewed and Fried. No. 17 BALTIMORE ST. HARRq f}. 3EFTON The Leading Berber v>f)op (Successor to C. O. Sefton) Having- thoroughly remodeled the place is now ready to accommodate the public Barber Supplies a Specialty. .Baltimore Street. GETT*l5§UR(i, PA. ESTABLISHED 1876 PENROSE MYERS, Watchmaker and Jeweler Gettysburg Souvenir Spoons, Col-lege Souvenir Spoons. NO. 10 BALTIMORE ST., GETTYSBURG, PENNA. L. (\. klltW Manufacturers' Agent and Jobber of Hardware, Oils, Paints and Queensware. GETTYSBURG, PA. The Only Jobbing House in Adams County.

Diese Arbeit bietet eine solide theoretische Grundlage zu Philanthropie und religiös motivierten Spendenaktivitäten und deren Einfluss auf Wohltätigkeitstrends, Entwicklungszusammenarbeit und einer auf dem Gedanken der sozialen Gerechtigkeit beruhenden Philanthropie. Untersucht werden dafür die Strukturen religiös motivierte Spenden, für die in der islamischen Tradition die Begriffe "zakat", "Waqf" oder im Plural auch "awqaf-" oder "Sadaqa" verwendet werden, der christliche Begriff dafür lautet "tithes" oder "ushour". Aufbauend auf diesem theoretischen Rahmenwerk analysiert die qualitative und quantitative Feldstudie auf nationaler Ebene, wie die ägyptische Öffentlichkeit Philanthropie, soziale Gerechtigkeit, Menschenrechte, Spenden, Freiwilligenarbeit und andere Konzepte des zivilgesellschaftlichen Engagements wahrnimmt. Um eine umfassende und repräsentative Datengrundlage zu erhalten, wurden 2000 Haushalte, 200 zivilgesellschaftliche Organisationen erfasst, sowie Spender, Empfänger, religiöse Wohltäter und andere Akteure interviewt. Die so gewonnen Erkenntnisse lassen aussagekräftige Aufschlüsse über philanthropische Trends zu. Erstmals wird so auch eine finanzielle Einschätzung und Bewertung der Aktivitäten im lokalen Wohltätigkeitsbereich möglich, die sich auf mehr als eine Billion US-Dollar beziffern lassen. Die Erhebung weist nach, dass gemessen an den Pro-Kopf-Aufwendungen die privaten Spendenaktivitäten weitaus wichtiger sind als auswärtige wirtschaftliche Hilfe für Ägypten. Das wiederum lässt Rückschlüsse zu, welche Bedeutung lokale Wohltätigkeit erlangen kann, wenn sie richtig gesteuert wird und nicht wie bislang oft im Teufelskreis von ad-hoc-Spenden oder Hilfen von Privatperson an Privatperson gefangen ist. Die Studie stellt außerdem eine Verbindung her zwischen lokalen Wohltätigkeits-Mechanismen, die meist auf religiösen und kulturellen Werten beruhen, und modernen Strukturen, wie etwa Gemeinde-Stiftungen oder Gemeinde-"waqf", innerhalb derer die Spenden eine nachhaltige Veränderung bewirken können. Daher bietet diese Arbeit also eine umfassende wissenschaftliche Grundlage, die nicht nur ein besseres Verständnis, sondern auch den nachhaltiger Aus- und Aufbau lokaler Wohltätigkeitsstrukturen in Ägypten ermöglicht. Zentral ist dabei vor allem die Rolle lokaler, individueller Spenden, die beispielsweise für Stiftungen auf der Gemeindeebene eingesetzt, wesentlich zu einer nachhaltigen Entwicklung beitragen könnten – und das nicht nur in Ägypten, sondern in der gesamten arabischen Region. Als konkretes Ergebnis dieser Arbeit, wurde ein innovatives Modell entwickelt, dass neben den wissenschaftlichen Daten das Konzept der "waqf" berücksichtigt. Der Wissenschaftlerin und einem engagierten Vorstand ist es auf dieser Grundlage gelungen, die Waqfeyat al Maadi Community Foundation (WMCF) zu gründen, die nicht nur ein Modell für eine Bürgerstiftung ist, sondern auch das tradierte Konzept der "waqf" als praktikable und verbürgte Wohlstätigkeitsstruktur sinnvoll weiterentwickelt. ; This work provides a solid theoretical base on philanthropy, religious giving (Islamic zakat, 'ushour, Waqf -plural: awqaf-, Sadaqa and Christian tithes or 'ushour), and their implications on giving trends, development work, social justice philanthropy. The field study (quantitative and qualitative) that supports the theoretical framework reflects at a national level the Egyptian public's perceptions on philanthropy, social justice, human rights, giving and volunteering and other concepts that determine the peoples' civic engagement. The statistics cover 2000 households, 200 Civil Society Organizations distributed all over Egypt and interviews donors, recipients, religious people and other stakeholders. The numbers reflect philanthropic trends and for the first time provide a monetary estimate of local philanthropy of over USD 1 Billion annually. The survey proves that the per capita share of philanthropy outweighs the per capita share of foreign economic assistance to Egypt, which implies the significance of local giving if properly channeled, and not as it is actually consumed in the vicious circle of ad-hoc, person to person charity. In addition, the study relates local giving mechanisms derived from religion and culture to modern actual structures, like community foundations or community waqf that could bring about sustainable change in the communities. In sum, the work provides a comprehensive scientific base to help understand- and build on local philanthropy in Egypt. It explores the role that local individual giving could play in achieving sustainable development and building a new wave of community foundations not only in Egypt but in the Arab region at large. As a tangible result of this thesis, an innovative model that revives the concept of waqf and builds on the study's results was created by the researcher and a dedicated board of trustees who succeeded in establishing Waqfeyat al Maadi Community Foundation (WMCF) that not only introduces the community foundation model to Egypt, but revives and modernizes the waqf as a practical authentic philanthropic structure.

1TUGAS DAN TANGGUNG JAWAB BADAN PENANGGULANGAN BENCANA BERDASARKAN PERATURAN DAERAH NOMOR 3 TAHUN 2010 TENTANG PENANGGULANGAN BENCANA DI KABUPATEN PESISIR SELATAN JURNAL Diajukan Guna Melengkapi Sebagian Persyaratan Untuk Mencapai Gelar Sarjana HukumOleh: RULLY INDRA PERMANA NPM: 0810013111031 FAKULTAS HUKUM UNIVERSITAS BUNG HATTA PADANG20132FAKULTAS HUKUM UNIVERSITAS BUNG HATTA PERSETUJUAN JURNAL Nama : RULLY INDRA PERMANA Nomor Pokok Mahasiswa : 0810012111031 Program Kekhususan : Hukum Tata Negara Judul Skripsi : Tugas Dan Tanggung Jawab Badan Penanggulangan Bencana Berdasarkan Peraturan Daerah Nomor 3 Tahun 2010 Tentang Penanggulangan Bencana Di Kabupaten Pesisir Selatan Telah disetujui pada hari Selasa tanggal Tiga Bulan September tahun Dua Ribu Tiga Belas untuk dipertahankan dihadapan Tim Penguji.1. Nurbeti, S.H., M.H. (Pembimbing I)2. Dr .Sanidjar Pebriharihati R, S.H., M.H. (Pembimbing II)1TUGAS DAN TANGGUNG JAWAB BADAN PENANGGULANGAN BENCANA BERDASARKAN PERATURAN DAERAH NOMOR 3 TAHUN 2010 TENTANG PENANGGULANGAN BENCANA DI KABUPATEN PESISIR SELATAN Rully Indra Permana 1), Nurbeti 2), Sanidjar pebrihariati.R 2)1) Mahasiswa Program Kekhususan Hukum Tata Negara2) Dosen Program Kekhususan Hukum Tata Negara , Fakultas Keguruan Hukum Universitas Bung HattaEmail : indrapermana99@Gmail.com ABSTRACT Indonesian culture and life in the midst of things that smell renewal claiming more advanced and civilized in terms of thinking, working and acting compared with indigenous peoples in ancient times. The issues contained in this paper is 1) What forms of environmental damage that causes natural disasters? 2) What sort of responsibility for disaster management in the South Coastal District?. Authors use the juridical sociological research methods research approach that examines the look and Regulation Legislation issues and connecting with the reality on the ground. Data sources of primary data and secondary data, namely primary data obtained from interviews and secondary data obtained from the study of documents, then the data is processed using qualitative data analysis. Based on these results we can conclude 1. Other forms of environmental degradation in the South Coastal District, 2.forms responsibility for disaster response and responsibilities of local governments in disaster management set out in Article 8, namely: (1) Guarantee the fulfillment of rights and refugee communities affected, (2) protection of society from the impact of disasters, (3) integration of disaster risk reduction and disaster risk reduction, (4) the allocation of disaster relief funds. Keywords:Environment,disaster prevention,non-governmental.PENDAHULUANA. Latar Belakang MasalahIndonesia sebagai negara kepulauan yang secara geografis terletak di daerah khatulistiwa, di antara Benua Asia dan Australia serta di antara Samudera Pasifik dan Hindia, berada pada pertemuan tiga lempeng tektonik utama dunia merupakan wilayah teritorial yang sangat rawan terhadap bencana alam.Posisi geografis dan geodinamik Indonesia telah menempatkan Indonesia sebagai salah satu wilayah yang rawan bencana alam (natural disaster prone region). Indonesia merupakan negara kepulauan tempat dimana tiga lempeng besar dunia bertemu, yaitu lempeng Indo-Australia, lempeng Eurasia, dan lempeng Pasifik. Interaksi antar lempeng-lempeng tersebut lebih lanjut menempatkan Indonesia sebagai wilayah yang memiliki aktivitas kegunungapian dan kegempaan yang cukup tinggi. Lebih dari itu, proses dinamika lempeng yang cukup intensif juga telah membentuk relief permukaan bumi yang khas dan sangat bervariasi, dari wilayah pegunungan dengan lereng-lerengnya yang curam dan seakan menyiratkan potensi2longsor yang tinggi hingga wilayah yang landai sepanjang pantai dengan potensi ancaman banjir, penurunan tanah dan tsunaminya. Lingkungan hidup merupakan anugerah Tuhan Yang Maha Esa yang wajib dilestarikan dan dikembangkan kemampuannya agar tetap dapat menjadi sumber penunjang hidup bagi manusia dan makhluk hidup lainnya demi kelangsungan dan peningkatan kualitas hidup itu sendiri. Lingkungan hidup adalah ruang yang ditempati oleh manusia bersama makhluk hidup lainnya. Manusia dan makhluk hidup lainnya tentu tidak berdiri sendiri dalam proses kehidupan, saling berinteraksi, dan membutuhkan satu sama lainnya. Kehidupan yang ditandai dengan interaksi dan saling ketergantungan secara teratur merupakan tatanan ekosistem yang di dalamnya mengandung esensi penting, dimana lingkungan hidup sebagai satu kesatuan yang tidak dapat dibicarakan secara terpisah. Maka dari itu penulis tertarik untuk membahas dan mengkaji persoalan lingkungan dan menuangkannya ke dalam sebuah tulisan ilmiah yang berjudul: "Tugas Dan Tanggung Jawab Badan Penanggulangan Bencana Daerah Di Kabupaten Pesisir Selatan Berdasarkan Perda Nomor 30 Tahun 2010 Tentang Penanggulangan Bencana".Metodologi Metode penelitian merupakan hal yang sangat penting dalam penelitian skripsi ini, karena metode penelitian dapat menentukan langkah-langkah dari suatu penulisan, baik mengenai pendekatan masalah, teknik pengumpulan data dan sumber data maupun analisis datanya. Oleh karena itu, demi mencapai tujuan dari penulisan ini, maka metode penelitian yang dipakai sebagai dasar penulisan ini, yaitu sebagai berikut:1. Pendekatan MasalahPenelitian ini menggunakan metode Pendekatan Yuridis Sosiologis yaitu berdasarkan pada peraturan perundang-undangan yang berlaku dikaitkan dengan apa yang terjadi di lapangan (pelaksanaan), sehingga dalam penelitian ini peneliti menggunakan bahan hukum.a. Sumber data1) Data PrimerData primer merupakan sumber data yang diperoleh secara langsung dari informan. Di dalam penelitian ini yang akan menjadi informan adalah pejabat Badan Penanggulangan Bencana Daerah Kabupaten Pesisir Selatan.2) Data SekunderData yang diperoleh peneliti dari Badan Penanggulangan Bencana Daerah3(BPBD) Kabupaten Pesisir Selatan. Selain itu penulis juga menggunakan data sebagai berikut:a. Bahan Hukum Primer yaitu mempelajari peraturan perundang-undangan tentang Penanggulangan Bencana dan Peraturan-peraturan lainnya yang terkait yaitu:1) Undang-Undang No 32 Tahun 2009 tentang Perlindungan dan Pengelolaan Lingkungan Hidup (UUPPLH),2) Undang-Undang No 24 Tahun 2007 tentang Penanggulangan Bencana,3) Peraturan Presiden Republik Indonesia No 8 Tahun 2008 tentang Badan Nasional Penanggulangan Bencana,4) Peraturan Daerah No 3 Tahun 2010 tentang Penanggulangan Bencana.b. Bahan Hukum Sekunder, yaitu mempelajari berbagai literatur (buku-buku, makalah, laporan penelitian, jurnal) yang berkaitan dengan masalah Penanggulangan Bencana serta kerusakan lingkungan.2. Teknik Pengumpulan dataa. Studi dokumen adalah dengan melakukan pengambilan objek dokumen-dokumen hasil monitoring atau objek surat dankliping Koran yang relevan dengan penelitian ini.b. Wawancara yaitu dengan melakukan wawancara bebas dengan para informan yaitu para pejabat Badan Penanggulangan Bencana Daerah Kabupaten Pesisir Selatan.3. Pengolahan dan Analisis DataMengumpulkan data dengan mengadakan pencatatan yang diambil dari dokumen, buku laporan dan buku catatan lainnya yang berhubungan dengan materi yang ditulis. Pengolahan data yang diperoleh untuk kemudian diolah lebih lanjut secara kualitatif dan dirumuskan secara sistematis dan dikaitkan dengan apa yang terjadi dalam pelaksanaannya di dalam kenyataan lalu setelah itu dikaitkan dengan pokok-pokok permasalahan dalam penulisan ini. Hasil Penelitian dan Pembahasan Pembahasan hasil penelitian ini berdasarkan pada hasil analisis data yang diperoleh, bahwa:A. Bentuk-Bentuk Kerusakan Lingkungan Yang Menyebabkan Bencana Alam di Kabupaten Pesisir SelatanSecara geografis dengan strategi bencana daerah kabupaten pesisir selatan berada disekitar 0059'-228' LS dan 10018' yang merupakan wilayah4administrasi dengan luas 5749,89 m2. Secara khusus kabupaten pesisir selatan memiliki topografi wilayah berbukit-bukit dengan ketinggian berkisar 0-1000m dari permukaan laut,memiliki 57 pulau serta dialiri sebanyak 18 sungai dengan 11 sungai besar dan 7 sungai kecil. Pesisir selatan merupakan iklim tropis dengan temperatur bervariasi antara 230C hingga 320C disiang hari dan 20 C 280C dimalam hari dengan curah hujan rata-rata 224,63 mm perbulan. Kondisi permukaan lahan kabupaten pesisir selatan dewasa ini adalah sebagai besar lahan hutan yaitu 70,54% hutan lebat dan 13,37% hutan belukar,lahan sawah 6,07%,perkebunan, 2,30% dan sisanya adalah perkampunga, kebun campuran dan kebun rakyat lainnya: 1 Bentuk-bentuk bencana Alam di Kabupaten Pesisir Selatan. berikut ini:a) TsunamiGelombang air laut yang membawa material baik berupa sisa-sisa bangunan, tumbuhan dan material lainnya menghempas segala sesuatu yang berdiri di dataran pantai dengan kekuatan dahsyat. Bangunan yang mempunyai dimensi lebar dinding sejajar dengan garis pantai atau tegak lurus dengan arah datangnya gelombang akan mendapat tekanan yang paling kuat sehingga akan mengalamikerusakan yang paling parah. Gelombang air ini juga akan menggerus pondasi dan menyeret apapun yang berdiri lepas di pemukiman dataran pantai dan dibawa ke laut. Contoh di wilayah pesisir selatan di kecamatan linggo sari baganti pada tahun 2007 terjadi tsunami yang berakibat rusaknya pemukiman tempat tinggal penduduk setempat dan hancurnya kapal-kapal nelayan setempat.b) Gempa BumiGempa bumi adalah getaran yang ditimbulkan karena adanya gerakan endogen. Semakin besar kekuatan gempa, maka akan menimbulkan kerusakan yang semakin parah di muka bumi. Gempa bumi menyebabkan bangunan-bangunan retak atau hancur, struktur batuan rusak, aliran-aliran sungai bawah tanah terputus, jaringan pipa dan saluran bawah tanah rusak, dan sebagainya. Jika kekuatan gempa bumi melanda lautan, maka akan menimbulkan tsunami, yaitu arus gelombang pasang air laut yang menghempas daratan dengan kecepatan yang sangat tinggi.5Contoh yang paling nyata adalah pada tahun 2007 di kecamatan lunang silaut terjadi gempa bumi dengan kekutan 6,9 skala richter yang mengakibatkan kerusakan -kerusakan bangunan dan menimbulkan banyak kerugian secara materil dan spritual.c) BanjirBanjir merupakan salah satu bentuk fenomena alam yang unik. Dikatakan unik karena banjir dapat terjadi karena murni gejala alam dan dapat juga karena dampak dari ulah manusia sendiri. Banjir dikatakan sebagai gejala alam murni jika kondisi alam memang memengaruhi terjadinya banjir, misalnya hujan yang turun terus menerus, terjadi di daerah basin, dataran rendah, atau di lembah-lembah sungai. Selain itu, banjir dapat juga disebabkan karena ulah manusia, misalnya karena penggundulan hutan di kawasan resapan, timbunan sampah yang menyumbat aliran air, ataupun karena rusaknya dan atau pintu pengendali aliran air. Kerugian yang ditimbulkan akibat banjir, antara lain, hilangnya lapisan permukaan tanah yang subur karena tererosi aliran air, rusaknya tanaman, dan rusaknya berbagai bangunan hasil budidaya manusia. Bencana banjir bandang merupakan salah satu bencana alam yang hampir setiap musim penghujan melanda di beberapa wilayah di Wilayah Pesisir Selatan Kecamatan Lengayang pada Tahun 2011 yang mengakibatkan hilangnya korban jiwa berjumlah 6 orang.d) Tanah LongsorKarakteristik tanah longsor hampir sama dengan karakteristik banjir. Bencana alam ini dapat terjadi karena proses alam ataupun karena dampak kecerobohan manusia. Bencana alam ini dapat merusak struktur tanah, merusak lahan pertanian, pemukiman, sarana dan prasarana penduduk serta berbagai bangunan lainnya. Peristiwa tanah longsor pada umumnya melanda beberapa wilayah Indonesia yang memiliki topografi agak miring atau berlereng curam. Di wilayah Pesisir Selatan dibeberapa Wilayah Kecamatan Tarusan, Kecamatan Bayang, IV jurai, Batang Kapas, sutera dan ranah pesisir yang selama musim hujan terjadi banyak titik rawan longsor6yang mengakibatkan kerusakan bangunan atau tempat tinggal penduduk setempat, terputusnya jalur transportasi darat, dan rusaknya areal pertanian dan perkebunan.e) Badai/Angin TopanAngin topan terjadi karena perbedaan tekanan udara yang sangat mencolok di suatu daerah sehingga menyebabkan angin bertiup lebih kencang. Di beberapa belahan dunia, bahkan sering terjadi pusaran angin. Bencana alam ini pada umumnya merusakkan berbagai tumbuhan, memorakporandakan berbagai bangunan, sarana infrastruktur dan dapat membahayakan penerbangan. Salah satu contohnya adalah di wilayah Pesisir Selatan Kecamatan IV Jurai, Sutera, dan Lengayang yang mengakibat kerusakan tempat tinggal penduduk dan kerusakan fasilitas umum .B. Bentuk Tanggung Jawab Pemerintah Kabupaten Pesisir Selatan terhadap Penanggulangan Bencana Alam di Kabupaten Pesisir Selatana. Tanggung Jawab Pemerintah Daerah:Tanggung jawab Pemerintah Daerah dalam Penanggulangan Bencana yaitu:1. Penjaminan pemenuhan hak masyarakat dan pengungsi yang terkena bencana sesuai dengan standar pelayanan minimum;2. Perlindungan masyarakat dari dampak bencana;3. Pengurangan risiko bencana dan pemaduan pengurangan risiko bencana dengan program pembangunan; dan4. Pengalokasian dana penanggulangan bencana dalam anggaran pendapatan belanja daerah yang memadai.b. Wewenang Pemerintah Daerah:Wewenang pemerintah daerah dalam penanggulangan bencana yaitu:1. Penetapan kebijakan penanggulangan bencana pada wilayahnya selaras dengan kebijakan pembangunan daerah;2. Pembuatan perencanaan pembangunan yang memasukkan unsur-unsur kebijakan penanggulangan bencana;3. Pelaksanaan kebijakan kerja sama dalam penanggulangan bencana dengan provinsi dan/atau kabupaten/kota lain;4. Pengaturan penggunaan teknologi yang berpotensi sebagai sumber ancaman atau bahaya bencana pada wilayahnya;75. Perumusan kebijakan pencegahan penguasaan dan pengurasan sumber daya alam yang melebihi kemampuan alam pada wilayahnya; dan6. Pengendalian pengumpulan dan penyaluran uang atau barang pada wilayahnya (pengawasan terhadap penyelenggaraan pengumpulan uang atau barang berskala provinsi, kabupaten/kota yang diselenggarakan oleh masyarakat, termasuk pemberian ijin yang menjadi kewenangan gubernur/bupati/walikota sesuai dengan kewenangannya)Berdasarkan Peraturan Daerah Nomor 3 Tahun 2010 tentang penanggulangan bencana yaitu:(1) Pemerintah daerah menjadi penanggung jawab dalam penyelenggaraan penanggulangan bencana(2) Dalam melaksanakan tanggung jawab penanggulangan bencana pemerintah daerah melimpahkan tugas pokok dan fungsinya kepada BPBD(3) Tugas pokok dan fungsi sebagaimana dimaksud pada ayat (2) yang bersifat sangat teknis dilaksanakan oleh BPBD(4) BPBD dalam melaksanakan tugas dan fungsinya dapat melibatkan unsur-unsur antara lain masyarakat,lembaga kemasyarakatan, lembaga usaha, lembaga internasional.Adapun tugas dan BPBD yaitu:1. Menetapkan pedoman dan pengarahan sesuai dengan kebijakan pemerintah daerah dan badan Nasional Penanggulangan Bencana terhadap usaha penanggulangan bencana yang mencakup pencegahan bencana, penanganan darurat, rehabilitasi serta rekonstruksi secara adil dan setara.2. Menetapkan standarisasi serta kebutuhan penyelenggaraan penanggulangan bencana berdasarkan peraturan perundang undangan.3. Menyusun, menetapkan dan menginformasikan peta rawan bencana.4. Menyusun dan menetapkan prosedur tetap penanganan bencana.5. Melaksanakan penyelenggaraan penanggulangan bencana pada wilayahnya.6. Melaporkan penyelenggaraan penanggulangan bencana kepada daerah setiap sebulan sekali dalam kondisi normal dan setiap saat dalam kondisi darurat bencana.7. Mengendalikan pengumpulan dan penyaluran uang dan barang.8. Mempertanggungjawabkan penggunaan anggaran yang diterima8dari anggaran pendapatan dan belanja daerah.Melaksanakan kewajiban lain sesuai dengan peraturan perundang undangan. Kesimpulan Dari hasil penelitian yang telah peneliti lakukan, maka dapat diambil kesimpulan, Bentuk-bentuk kerusakan lingkungan yang menyebabkan bencana alam di Kabupaten Pesisir Selatan yaitu kerusakan lingkungan akibat proses alam seperti tsunami, gempa bumi, banjir, tanah longsor, dan badai angin topan,serta Bentuk tanggung jawab pemerintah Kabupaten Pesisir Selatan terhadap penanggulangan bencana alam di Kabupaten Pesisir Selatan yaitu Tanggung jawab Pemerintah Daerah dalam Penanggulangan Bencana Ucapan Terima Kasih Pada kesempatan ini penulis mengucapkan terima kasih banyak kepada pihak-pihak yang sudah membantu penulis selama menyelesaikan skripsi. Pihak-pihak yang dengan sabar membimbing dan selalu memotivasi penulis dalam menyelesaikan skripsi.Pihak tersebut adalah: (1) Ibu Nurbeti, S.H., M.H, selaku Pembimbing I dan Wakil Dekan Fakultas Hukum (2) Ibu Dr. Sanidjar Pebrihariati. R, S.H., M.H, selaku Pembimbing II (3) Bapak Suamperi, S.H., M.H selaku Ketua bagian Hukum Tata Negara Fakultas Hukum. (4) Keluarga tercinta yang selalu memberi dukungan moril maupun materi. (5) Adik-adik penulis, (6) kekasih penulis, (7) serta Teman-teman seperjuangan. Daftar PustakaA. Buku-bukuAsrul Pramudya, 2008. Kajian Pengelolaan Daratan Pesisir Berbasis Zonasi di Provinsi Jambi, Semarang: Thesis Pasca Sarjana Magister Teknik Sipil Universitas Diponegoro. Arsan Andi, I Made, 2007. Batas Maritim Antar Negara Sebuah Tinjauan Teknis dan Yuridis, Yogyakarta : Gadjah Mada Univ. Press. Faried Ali, 1996. Hukum Tata Pemerintahan dan Proses Legislatif Indonesia, Jakarta: Raja Grafindo Persada. Huala Adolf, 1996. Aspek-aspek Negara Dalam Hukum Internasional, Jakarta: Raja Grafindo Persada. Jimly Asshiddiqie, 2007. Pokok-pokok Hukum Tata Negara Indonesia Pasca Reformasi, Jakarta : Bhuana Ilmu Populer. Melda Kamil, 2007. Adriano Hukum Internasional Hukum yang Hidup, Jakarta: Diadit Media. Mukhtasor, 2007. Pencemaran Pesisir dan Laut, Jakarta; Pradnya Paramita. Soerjono Soekanto dan Sri Mamudji, 1990. Penelitian Hukum Suatu Tinjauan Singkat, Rajawali Pers. Jakarta. Syamsuharya Bethan, 2008. Penerapan Prinsip Hukum Pelestarian Fungsi Lingkungan Hidup dalam Aktifitas Industri Nasional (Sebuah Upaya Penyelamatan Lingkungan Hidup dan Kehidupan Antar Generasi), Bandung: Alumni.9Zainuddin Ali, 2010. Metode Penelitian Hukum, Sinar Grafika, Jakarta.B. Karya IlmiahBadan Penelitian dan Pengembangan Departemen Luar Negeri, 1986. Perjuangan Indonesia di Bidang Hukum Laut, Jakarta : Deplu, 1986 Samsul Arifin, Permasalahan Lingkungan Hidup di Sumut, materi perkuliahan disampaikan pada perkuliahan Hukum Lingkungan Administrasi pada tanggal 4/10/2010 di kelas regular A, Program Pasca Sarjana Magister Ilmu Hukum.C. Perundang-undanganUndang-Undang No 24 Tahun 2007 tentang Penanggulangan Bencana, Undang-Undang No 32 Tahun 2009 tentang Perlindungan dan Pengelolaan Lingkungan Hidup (UUPPLH) Peraturan Presiden Republik Indonesia No 8 Tahun 2008 tentang Badan Nasional Penanggulangan Bencana Peraturan Daerah No 3 Tahun 2010 tentang Penanggulangan Bencana di Kabupaten Pesisir selatan

THE CHOICE OF WORDS, TRANSITIVITY, AND IDEOLOGY OF THE HEADLINES IN THE JAKARTA POST REPORTING APEC IN INDONESIA 2013 Lydia Anggar Wati Language and Literature Department, Faculty of Languages and Arts, Surabaya State University lydia82012@gmail.com Lisetyo Ariyanti, S.S., M.Pd Language and Literature Department, Faculty of Languages and Arts, Surabaya State University lisetyo.a@yahoo.com ABSTRAK Penelitian ini fokus dalam menganalisa headlines mengenai berita APEC karena headlines menyimpan informasi penting dari peristiwa di dunia. Rumusan masalah diantaranya (1) apa saja word choice dalam headlines di Koran The Jakarta Post pemberitaan APEC di Indonesia 2013, (2) apa saja transitivity yang ditemukan di headlines The Jakarta Post pemberitaan APEC di Indonesia 2013, (3) sikap ideologis apa pada word choices dan transitivity di headlines The Jakarta Post pemberitaan APEC di Indonesia 2013. Penelitian ini menggunakan deskriptif kualitatif. Data dikumpulkan dari koran harian The Jakarta Post mengenai APEC tanggal 9 September 2013 sampai 9 Oktober 2013 (31 hari). Hasil penelitian ini: 1) word choice yang ditemukan dalam headlines ditulis dalam bentuk simple present tense menunjukkan peristiwa yang baru saja terjadi. Headlines ditulis dalam bentuk klausa penuh yang terdiri dari sedikitnya subjek dan kata kerja. Pada headlines terdapat bentuk omisi dari verba bantu be agar penulisan berita lebih efektif, 2) proses verba sebagian besar menggunakan material process. Sirkumtansi dalam headlines ditulis oleh frase nomina dan frase kata kerja. APEC sering disebutkan sebagai aktor atau pelaku dalam headlines yang memiliki verba positif seperti vows, talks, hopes, changers. Dari kata kerja tersebut terlihat kekuatan dominasi aktor pada tujuan. Kata Kunci: headlines, word choice, transitivity, ideology ABSTRACT This study focuses on the analysis of the headlines newspaper in APEC news event because headlines provide the main important information of the events in the world. The research questions are (1) what the word choice is found in the headlines of The Jakarta Post reporting APEC in Indonesia 2013, (2) what the transitivity is found in the headlines of The Jakarta Post reporting APEC in Indonesia 2013, (3) what ideological in word choice and transitivity found in the headlines of The Jakarta Post reporting APEC in Indonesia 2013. The study is descriptive qualitative. The data was collected The Jakarta Post daily newspaper about APEC news event from September 9th, 2013 until October 9th, 2013 (31 days). The study found: 1) word choice is found in headlines is written in simple present tense form to show the immediate past happening. The headlines are written by full clause form which consist of minimal a subject and a verb. There is omission in headlines as the aim of the effectiveness headlines writing, 2) the process of the verbs are mostly material process. The circumstances of the headlines are written by noun phrase and verb phrases. APEC is mostly mentioned as the actor or the doer in the headlines that has positive verbs such as vows, talks, hopes, changers. From those verbs that is seen dominance power in actor for the goal. Keywords: headlines, word choice, transitivity, ideology INTRODUCTION Language is very important in human life to make good interaction, people need language to communicate with other. The language in use for communication is called discourse (Cook, 1989:6). It means that all of the language to use for communicating with other people is named "discourse". In the recently times, Linguists' interest in discourse focus on the linguistic structure of the text into how texts draw in the social process. The reason is linguists' want to get satisfied more than analyzing linguistic text which focused in linguistic features only. The knowledge of understanding in grammar, syntax, morphology, semantic and phonology of the text have not need of understanding in a text. The rhetoric intent, the coherence, and the worldview that the author and receptor convey the similarity essential of the text (Kaplan, 1990) as cited in Taiwo (2007:218). Texts always produce and read in real world with all the complexity, not in the isolation area. Consequently, language can show the reality. Language delivers from word by word in written or oral a broad sense of meanings and the meaning delivers with those words in social, political, and historical condition. Language can bring the power that shows in written or spoken. Mass media, it means that delivery message. It has two types of mass media. There are printed mass media and electronic mass media. Printed media are newspaper, tabloids, and magazines. Electronic mass media includes radio, smart-phone, and television. It is used to communicate with other political as the instrument to convey idea, message, and political work program. It has hidden of power relation. As one of the printed mass media, newspaper become as one of the most popular mass media. It occurs because newspapers contain many variant of news every day. By using actions of outstanding figures and statement, newspapers have formed. Opinion leaders, government, newspaper editors, etc, play crucial role in shaping the issue in the society and setting the boundaries of what is talked about, how is talked about (Taiwo, 2007: 218). However, the critical reader frequently takes the new granted. The analysis focused on the analysis of the headline newspaper because the headline summarize the content of the news, and attract the reader to read the article. The writer of newspaper always makes the headline short but in a headline can describe the core of the complicated new story in a few words. In Richardson (2007), Van Dijk (1988) says that news headlines are particularly key for the way readers understand of news text, they stakes that monitor attention, perception and reading process. The study concerned on headlines since daily newspaper provides the main important information of events in the world. Nevertheless, it is difficult for readers to read all of the news articles in the daily newspapers because all the variant news are very interesting and the time restraint. Therefore, they have to be selective by looking on the headline. The main function of news headline is to make the readers easily to know the main content of the news and the general picture of the news stories although they do not read all news stories. The study chooses The Jakarta Post daily newspaper as the sources of data since The Jakarta Post is the leading daily English language newspaper in Indonesia that published since 1983. The newspaper was launched on April 25th 1983. The paper is owned by PT Bina Media Tenggara, and the head office is in the nation's capital, Jakarta. It is the largest English language newspaper in Indonesia with an average circulation of around 50,000 copies. (www.wikipedia.com/jakarta-post). The analysis of headlines reporting APEC (Asia-Pacific Economy Cooperation) 2013 in Bali, Indonesia was the focus of the research since the news in September 2nd 2013 until October 14th 2013. In that day, Indonesia prepare everything what is needed to annual meeting of APEC in this year held in Nusa Dua, Bali, Indonesia. APEC is established in 1989 which has the aim to strengthen economic growth and strengthen the community of nations in the Asia Pacific. In the annual meeting in this year, APEC generate seven agreement. APEC have the important role in economic global. In that meeting, there are delegates 21 state leader who are important people in their country as presidents and a hundreds business people from whole the world. However, there are many particular world of economy-politic that they used. (http://id.wikipedia.org/wiki/Kerja_Sama_Ekonomi_Asia_Pasifik) The study has There are two similar studies. First, a similar studies was conducted by Kirana (2009). She conducted a study entitled "Critical Discourse Analysis of Headlines in The Jakarta Post Reporting Invasion in Gaza". Kirana's study and this study are quite similar on the analysis of headlines. The difference is sited of the data. She uses the data of the event of conflict in Gaza. However, this study analyzes headlines in story event of APEC 2013 that held in Indonesia. Second, a study was conducted by Yunianti (2010). She conducted a study entitled "Critical Discourse Analysis in The Jakarta Post Reporting Ruhut's Behavior During Parliament Inquiry Session On The Bank Century". The difference between this study and Yunianti's study, we have the same case (power and ideology), but this study analysis newspaper headlines while her study analyses newspaper's article. In the end of her study, she found ideological value that is showed by kinds of syntactical and word choice features utilized by articles The Jakarta Post newspaper. Furthermore, this study analyzes the headlines as the aim was attempt to look at how the language is used headlines to show particular social ideologies and power relations. Critical Discourse Analysis (CDA) as the method of Discourse Analysis was used as the approach to show development of linguistics features which is used in the headlines focused in studying and analyzing the linking between linguistics analysis and social analysis, the ideology, and power relations. The analysis headlines are produced by actual and social matters. CDA was considerably useful to show the source of power, dominance, abuse, inequality and bias and how these sources are initiated, maintained, reproduced and transformed within specific social, economic, political and historical context. More specifically, the study focused on the analysis of ideological representation in the headline present in examining the word choice and transitivity, particularly transitivity of the headlines. Therefore, this study is written to know the ideological distance underlying the linguistics forms existed in the headlines in The Jakarta Post newspaper reporting APEC in Indonesia. Hence, the study wants to analyze the word choice and transitivity of the headlines in The Jakarta Post newspaper reporting APEC in Indonesia 2013 so that the research questions are as follows: 1)What word choice is found in the headlines of The Jakarta Post reporting APEC in Indonesia 2013?, 2)What transitivity is found in headlines of The Jakarta Post reporting APEC in Indonesia 2013?, 3)What ideological stance in the word choice and transitivity found in headlines of The Jakarta Post reporting APEC in Indonesia 2013?. Moreover, the purposes of the study are: 1)To describe the word choice found of headlines in The Jakarta Post reporting APEC in Indonesia 2013. 2)To describe the transitivity found of the headlines in The Jakarta Post reporting APEC in Indonesia 2013. 4)To reveal the ideological stance in the word choice and transitivity found of headlines in The Jakarta Post reporting APEC in Indonesia 2013. The study intends to analyze word choice items and transitivity of the headlines APEC in The Jakarta Post by using CDA theory. The study is expected to be able to give theoretical and practical contribution to the area of applied linguistics and CDA. By conducting this study, the study greatly expects that the finding will be useful to enrich the awareness of how language assists especially through mass media in the particular social ideology and power relations. METHODE The study will be conducted by using qualitative research. The study approaches to Critical Discourse Analysis (CDA). Furthermore, Fairclough (1989:26) states that CDA has three dimension, or stages, of critical discourse analysis: which include the relationship between texts, interactions, and contexts. Thus, there are three steps in analyzing discourse are through description, interpretation, and explanation. Data analysis in this study was also done in three steps which then results in three forms of analysis: first, the analysis of the text; second the analysis of the discourse practice which refers to the process of text production, text distribution and text consumption as commonly happen in the culture in which the writer and the participants live; third, the analysis of the social practice of the society in which the writer and participants live. The source of data in this study is taken from The Jakarta Post newspaper on alternate days from September 9th, 2013 until October 9th, 2013 (31 days). The data are the headlines which taken from The Jakarta Post newspaper. The study chooses the story event of APEC 2013 which held gathering in Indonesia. The data consist of 10 headlines. The data analysis technique in this research was applied descriptive analysis. The aim of the study was to describe certain phenomena occurred in this research setting. The certain phenomena probably occurred in terms of linguistic features. The stages of CDA are proposed by Fairclough (1989:26) was used in this research in the following procedure: 1)Description, In this stage which is concerned with formal properties of the text. There are several steps to describe the texts: Analyzing the word choice: the choices meaning of words used in the headlines, including all types of words, but particularly nouns, adjectives, verbs, and adverbs which carry connoted and denoted meanings. Analyzing the transitivity: sentence construction. There are three components to discuss in transitivity, they are the participant, the process, and the circumstance; 2)Interpretation, It is focused in relationship between text and interaction by seeing of the text as the product of a process of interpretation, notice that is used as the term interpretation for both the interactional process and a stage of analysis; 3)Explanation, It is focused in relationship between interaction and social context by determination of social process of production and interpretation, and their social effects. Then, the data collect based on the focus of this research. After that the data are analyzed based on word choice and transitivity. Thus, the data are interpreted descriptively and argumentatively by using critical discourse analysis devices in order to reveal the ideological stance of headlines of The Jakarta Post newspaper reporting APEC 2013 in Indonesia. DATA ANALYSIS AND DISCUSSION In line with study, the research question one, two, and three will be answered in this section. The data consist of 10 headlines which are displayed by three parts. In part A, the data will be analyzed by word choice, then part B analyzes transitivity and the last is part C that the data will be investigated by the ideological stance. Data 1: Protest in motion amid poor security (The Jakarta Post, Monday, September 30, 2013) In data 1, the situation is three days before APEC summit. APEC was held in Bali that got negative response from the activists and students Hundreds of activists and students came together on Sunday to plan protests against the Asia-Pacific Economic Cooperation (APEC) summit in Bali amid signs of heightened security at the venues that will host the powwow of 21 Pacific-rim leaders this week. Activist Ni Luh Gede Yastini from the Bali Legal Aid Foundation, confirmed that hundreds of activists from more than 30 local and international non-governmental organizations under the Indonesian People's Alliance would carry out protests against the summit. They had not been determined because they were aware that security forces could possibly block the moves as they could be considered a disturbance to the summit. In addition, the alliance will probably raise issues such as the environment, migrant workers, human rights and fair trade. Other issues will also include religious intolerance, unsolved killings of activists, alleged human rights abuses in Papua and foreign occupations of domestic natural resources. Activists reject "the liberalization of investments" which would provide red carpets to foreign businesses to easily exploit Indonesia's natural resources. Dozens of students had already staged a small "anti-APEC" rally outside the Ketapang Port in Banyuwangi, East Java, on Sunday. The port is the gateway for those who travel by land from Java to Bali. (The Jakarta Post) a. Word choice The headline in data 1 is written in simple present tense which omits being of the verb. The headline (3) may read: Protests in motion [is] amid poor security. The omitting being of the verb (is) as the aim to make the headline writing more effective so that it can shows clear, short, and interesting. The headline (3) consists of a subject protest in motion as noun phrase and the complement object amid poor security as prepositional phrase. The word protest means that to the expression strong disagreement with or opposition to something. Protest refers to the act that doing by hundreds activists and students who against APEC summit 2013 in Bali. b. Transitivity The headline in data 1 is written in active sentence which uses relational process. The headline (3) consist of a carrier protest in motion (noun phrase) and attributive amid poor security (prepositional phrase). The omission (is) is classified into relational processes, process of being abstract relations such as have, seem, and be (is), which involve an agent and attributive (e.g. 'You are x'; I have y'). The carrier is protest in motion and the attributive amid poor security. In the other written, it can be said that protest in motion is among poor security. Look at the fraction below: Protest in motion [is] Amid poor security Carrier Process: relational Attributive c. Ideological stance The headline in data 1 is negative side for delegates of APEC, 21 state leaders. In this case, it can unsafe for them. The summit is crucial to discuss economy growth. The headline tries to show protest motion that is done by hundreds activist and student to against APEC summit. Dozens of students had already staged a small "anti-APEC" rally outside the Ketapang Port in Banyuwangi, East Java, on Sunday. The port is the gateway for those who travel by land from Java to Bali. In the text tells who is the doer, the one who against APEC summit. Data 2: No game changers at APEC summit (The Jakarta Post, Wednesday, October 02, 2013) In data 2, Asia-Pacific Economic Cooperation (APEC) officials may drive a hard bargain to produce new tangible trade policies as the bloc's prestigious annual summit kicked off on Tuesday amid perturbing signs in the US economy that, once again, sent jitters across the globe. For the duration of the concluding senior officials meeting (CSOM), which will run from Oct. 1 to 2, officials from the 21 Pacific-rim economies would have to show their commitment to the "Bogor Goals" of free, open trade and investment. Officials expect no "big surprises" in the attempt to progress on the liberalization of trade, but are aware of several contentious issues that have the potential to hurt Indonesia and other emerging economies, if not addressed properly during the negotiations. According to documents obtained by The Jakarta Post, there are five deliverables to be discussed as first priorities of the summit. These include Indonesia's initiative to include crude palm oil (CPO) and natural rubber on the list of environmental goods subject for liberalization. Indonesia, which holds the rotating APEC chairmanship, has several requirements for businesses to use local products for certain industries, such as oil and gas. Economist Sri Adiningsih of Gadjah Mada University's APEC study center said Indonesia should focus on taking advantage of existing commitments rather than trying to push for a new agenda. While the summit is likely to produce few benefits for domestic interest, it is crucial to help facilitate other APEC priorities such as commitments to help avoid another round of impasse in the upcoming World Trade Organization (WTO) ministerial conference in December in Bali. APEC accounts for about 55 percent of the world's gross domestic product (GDP), some 44 percent of global trade and 40 percent of the world's population (The Jakarta Post). a. Word choice The headline in data 1 is written in full clause, consists of a subject no game (noun phrase), a verb changers (infinitive +s) and an complement at APEC summit. No classified in adverb, it means that used with a following adjective to imply a meaning expressed by the opposite positive statement, game (common noun) means a physical or mental activity or contest that has rules and that people do for pleasure, the verb changers means to replace with another. The verb summit means international meeting; a meeting or series of meetings between the leaders of two or more governments, so that the complement at APEC summit means that International organization meeting. b. Transitivity The headline in data 1 is written in active sentence. According to SFL: Transitivity, the process of the sentence is intransitive action which consists of only one participant no game, the actional verb changers which is intransitive verb which does not need object and circumstance at APEC summit, an additional information of the purpose of the action. The processes of doing in the physical world are shown in material processes that show the power of the doer of doing something to the real world, unlike mental processes which are abstract. Look at fraction below: No game Changers At APEC summit Actor Process: material Circumstance: purpose c. Ideological Stance The headline in data 6 is positive toward APEC. the word no as the negation of the verb game. APEC is the International organization. In this case no game can be changers in this International meeting. Indonesia no longer pushes for green goods. Another summit priority, is the US initiative to discuss barriers to trade, which includes opposition against local-content requirements implemented by several APEC members, including Indonesia. Indonesia, which holds the rotating APEC chairmanship, has several requirements for businesses to use local products for certain industries, such as oil and gas. While the summit is likely to produce few benefits for domestic interest, it is crucial to help facilitate other APEC priorities such as commitments to help avoid another round of impasse in the upcoming World Trade Organization (WTO) ministerial conference in December in Bali. The headline is definitely positive toward APEC. To know furthermore of the information, the study classified the analysis of the headline in the table below. No Headlines Word Choice NP FC Process Ideology 1. Competitive SMEs 'crucial' to APEC's growth Compe-titive SMEs - P Relational process Positive 2. Nusa Dua closed for tourists during APEC Nusa dua - P Relational process Positive 3. Protest in motion amid poor security Protests - P Relational process Negative 4. SBY to have bilateral talks with Obama in Bali SBY - P Verbal process Positive 5. APEC agrees to joint efforts to develop renewable energy APEC - P Material process Negative 6. No game changers at APEC summit No game - P Material process Positive 7. RI hopes for deal on rubber shattered RI - P Mental process Negative 8. Challengers force APEC to adjust Challen-gers - P Material process Positive 9 Giants exert clout at APEC Giants - Material process Negative 10 APEC vows to avoid mishaps APEC - Material process Positive Table 1. Word Choice, Transitivity, and Ideology *Note: NP= (Noun Phrase); FC= (Full Clause) Discussions Table 1 the word choice, transitivity and ideology of the headlines into who is the actor or doer, writing headlines, involving in which process, in the end of the analysis it can conclude that what the ideology inside of headlines. First is classified into who is the doer in that event which can show the subject or the doer regularly appear in headline newspaper. Here are the headlines which actors are APEC, it shows in headline in data 5 and data 10. Data 5: APEC agrees to joint efforts to develop renewable energy Data 6: APEC vows to avoid mishap APEC is classified in proper noun which is abbreviation from Asia Pacific Economy Cooperation. Proper noun is a word which is the name of person (e.g. Lisa, John, Marry, etc), a place (e.g. Surabaya, California, Sydney, etc.), an institution (State University of Surabaya, Oxford University, etc.), etc. And it is written with a Capital Letter wherever its located in a sentence. In these headline, the proper noun APEC refers to the International economy meeting summit. The member of APEC consist of Australia, Canada, Indonesia, Japan, South Korea, Malaysia, New Zealand, Philippines, Singapore, Thailand, United States, Chinese Taipei, Hongkong, China, Mexico, Papua New Guinea, Chile, Peru, Russia, Vietnam. Meanwhile, APEC as the doer or participants above, it is essentially useful to quantify the types of clause and verb processes used and their distribution across sampled newspaper. The table above is clearly that shows the principle difference between the headline: the ratio of noun phrase (NP) headlines to choose containing full clause (FC). All the headlines APEC summit 2013 in Bali are written in full clause, no one of the headline is written in noun phrase. Full clause consist of minimal one subject and one verb. The headline is written in full clause as the aim to give emphasize the actor or the doer who does the action towards the goal, not only states the noun phrase of the doer, the goal or the result that the doer does. Furthermore, classifying into processes that the processes which have four main verb processes across the headline. The process has four type which consist of material process, verbal process, mental process, and relational process. Look at the headlines below: Data 1: Competitive smes 'crucial' to APEC Data 2: Nusa dua closed for tourists during APEC Data 3: Protest in motion amid poor security The example of headlines above is classified in relational process which can show the typically retain the source responsible for the statement. The headlines is written in shorter, punchier headlines, and the omission of be (is, am, are) as the aim to make effectiveness in headline writing is classifies into relational process, process of being in the world abstract relations. According SFL: Transitivity, the abstract relationships generally finds between two participants associated with the process is regarded, however it is different from material process, a participant does not influence the other participant in a physical sense. The omission (is) is classified into relational processes, process of being abstract relations such as have, seem, and be (is), which involve an agent and attributive (e.g. 'You are x'; I have y'). The verbal process is used in this headline: Data 4: SBY to have bilateral talks with Obama in Bali The word talks is classified in verbal processes, a process of saying such as speaking, shouting, or singing. The word "talk" support of (Halliday 1994: 107) that the verbal process expresses the relationship between ideas constructed in human consciousness and the ideas enacted in the form of language. A verbal process is the process of saying, and it exists on the borderline between mental and relational processes. The participants roles associated with verbalization processes are the sayer, the individual who is speaking and that of the target, the addressee to whom the process is directed. This may be added with verbiage, that which is said. The mental process is used in this headline: Data 7: RI hopes for deal on CPO rubber shattered. From the headline in data 7, it can be shown that the headline includes Mental processes. That is the fact that theory from (Halliday, 1994: 117) that Mental processes are "internalized" processes which exists in processes of doing and speaking. The example are such as thinking, dreaming, and deciding. Mental process by encode the meaning of feeling or thinking. Mental process verbs can be subcategorized into three types; Cognition (verbs of thinking, knowing, understanding), Affection (verbs of liking, loving, fearing, heating), and Perception (verbs of seeing, hearing). The word "hopes" includes in dreaming as the article of the text tells that RI has dream or hopes to lift barriers to the trade in Crude Palm Oil (CPO). The material process is used in this headline below: Data 5: APEC agrees to joint efforts to develop renewable energy Data 6: No game changers at APEC summit Data 8: Challenges force APEC to adjust Data 9: Giants exert clout at APEC Data 10: APEC vows to avoid mishap According SFL: Transitivity, the headlines above belongs to the material process, processes of doing in the physical world. Material processes have two inherent participants involved in them. The first of these Actors, which is an obligatory element and expresses the doer of the process. The second is the Goal, which is an optional element and expresses the doer of the process. In addition to these two inherent participant roles, there is an extra element called Circumstance, which provides additional information on the "when, where, how, and why" of the process. Furthermore, the circumstance associated with the process also contribute to an ideological representation of the APEC summit. In the sampled headlines, the circumstance regularly exists in prepositional phrase which can be used to modify both noun and verb phrases, providing extra details on the time, place or the manner in which the action described in the process. They are identified by a preposition (e.g. 'in', 'of', 'on', 'for', 'to', 'with', 'as' etc). The use of preposition in each of these headlines is highly ideological. In each case, the prepositional phrase is underlined: Competitive smes 'crucial' to APEC Challenges force APEC to adjust The reporters or the publication is most often positive toward APEC. The headlines state APEC as the doer which has dominate power which does the actions towards the goal. It can be shown of 10 headline that the headlines writer does not want to cover or hide the subjects or the doers or the actions even the circumstances of the events. Actually, it is the fact that the way of reporting is very ideological since wants the readers to be clear on who is the doer is, the action and the effected entity. The writer wants the readers have the same thinks. Thus, most of the sample headlines have positive ideology towards APEC. Besides APEC, to increase the economy of 21 economies in Asia Pacific, there is Small and Medium Enterprises to unleash economic potential and drive growth. Smes is very useful to the advancement of the ASEAN community and the global community in 2020. Most of all the 21 APEC leaders had proposed bilateral meetings with Susilo Bambang Yudhoyono as the president of Indonesia. APEC was held in Indonesia has positive towards Indonesia so that's way the ideological stance is shown of the headline writer, in this case the editor of The Jakarta Post who represents the ideological stance of the institution. The Jakarta Post newspaper is daily English newspaper in Indonesia has budget of selection news which is showed for world so that people in the world will know Indonesia actually with reading The Jakarta Post newspaper. It is built in 1982 as the collaboration between four Indonesian media under the demanding of minister of information Ali Moertopo and politician Mr. Jusuf Wanandi, who represented the government-backed Golkar newspaper Suara Karya. Minister Moertopo mentioned the possibility of publishing an English-language newspaper of the highest editorial quality. The Jakarta Post newspaper is more than a decade of opening up the economy to the global community but more importantly one that would be able to provide an Indonesian perspective to counter the highly unbalanced Western-dominated global traffic of news and views. CONCLUSION AND SUGGESTION Conclusion The data consist of 10 headlines about news event of APEC. The study finds word choice in headlines that the headlines are written in simple present tense that is shown the immediately past event. The headlines that consist of 10 headlines are written by full clause (FC) form which consist of minimal a subject and a verb. The subject or the doer of the headlines are mostly APEC which can be seen that the focus of news reporting is APEC. From the subject or the doer of headlines, APEC is shown as active doer that has dominance power in APEC news event that APEC summit 2013 in Nusa dua, Bali. The most dominance verbs are mostly infinitive+s with singular subject that consist of such as the verbs talks, efforts, changers, hopes, vows. From the verbs are describe the active action for the power relation in the doer and the goal. Furthermore, the process of the verbs are mostly material process which have two inherent participant involved in them. According SFL: Transitivity material process is process of doing in the physical world. There are some omission in headlines as the aim of the writing of headlines more effective. The circumstance in the headlines are written by noun phrase and verb phrases, supplying extra details on the time, place or the manner in which the action described in the process. They are identified by a preposition (e.g. 'in', 'of', 'on', 'for', 'to', 'with', 'as' etc). The use of preposition in each of these headlines is highly ideological which concluded of the analysis in headlines that the study has positive appreciation, feeling, and judgment with APEC summit 2013 in Bali. APEC is mostly mentioned as the actor or the doer in the headlines that has positive verbs such as vows, talks, hopes, changers. From those verb that is seen dominance power in actor for the goal. Suggestion The study analyzes the headlines in The Jakarta Post newspaper which is as the object of study. The headlines are elaborated based on the word choice features, transitivity, and the end of the analysis can be investigated the ideological distance. It can be shown by the object of sentence in headlines. For the future, the study hopes the deeper investigation to have a more critical analysis and useful for studying critical analysis to be better. REFERENCES Brown, Gillian and Yule, George. 1983. Discourse Analysis. Cambridge: Cambridge University Press Cook, Guy. 1992. Discourse. Oxford: Oxford University Press. Crystal, David. 1997. Dictionary of Linguistics and Phonetics 4th Edition. United Kingdom: Blackwell Publishers. Ltd. Fowler, R. 1991. Critical Linguistics. In: Halmkjaer, K. (ed.), The Linguistic Encyclopedia. London/ New York: Routledge. 89-93. Fairclough, Norman. 1989. Language and Power. Essex: Longman Group Ltd. Fairclough, N, L. 1995a. Critical Discourse Analysis: The Critical Study of Language. Harlow, England: Longman. Fairclough, N, L. 1995b. Media Discourse. London: Edward Arnold. Halliday, M. A. K. 1994. An Intoduction to Functional Grammar. 2nd Edition. London: Edward Arnold. Kirana, Dhinuk Puspita. 2009. Critical Discourse Analysis of the Headlines in The Jakarta PostReporting Invasion in Gaza. Unesa: Unpublished Kress, G. and Hodge, B. 1979. Language as Ideology. London: Routledge. Mills, Sara. Feminist Stylistics. 1995. USA and Canada: Routledge. Pasha, Talaat. (2011). Islamists in The Headlines: Critical Discourse Analysis of The Representation of The Muslim Brotherhood In Egyption Newspapers. The University of Utah. Richardson, E. John. 2007. Analyzing Newspaper. An Approach from Critical Discourse Analysis. New York: Palgrave MacMillan. Taiwo, Rotimi. 2007. Language, Ideology and Power Relation in Nigerian Newspaper Headlines, from(www.noblewords.biz/images/Taiwo2.pdf). Taiwo, Rotimi. 2004. "Speech as Headline in Nigerian Newspaper", in Segun Awonusi and E. A. Babalola, eds The Domestication of English in Nigeria. (Lagos: University of Lagos Press 323-325), from (www.noblewords.biz/images/Taiwo1.pdf) Van Djik, T. A. 1993. Elite Discourse and Racism. Newbury Park, CA: Sage. Van Djik, T. A. 1998. News as Discourse. (Hillsdale, New Jersey: Erlbaum.

Professor David Dabydeen is a Guyanese-born writer, critic and academic at the Centre of Caribbean Studies at the University of Warwick. In 1993 he became Guyana's ambassador at UNESCO and is still a member of their Executive Board. He has been Guyana's ambassador to China since 2010. Professor Dabydeen has also won several international and national prizes such as the Commonwealth Poetry Prize, the Quiller-Couch Prize, and the Hind Rattan (Jewel of India). Among his works are Slave Song (1984), The Intended (1991), Disappearance (1993); and Our Lady of Demerara (2004). He also co-edited The Oxford Companion to Black British History in 2007. RB[1]: You are both a writer and a university professor of comparative literature. Do you know yourself first as a writer or a university professor?DD[2]: First as a writer. When I was a boy that is basically all I wanted to be. As a teenager I wrote the usual self-pitying stuff and, at 16 or 17, I attempted a novel in verse, inspired by some story in the Bible, I forgotten which; but gave up after a couple of pages. Why want to be a writer? I don't know. In my youth in Guyana I never encountered a writer. I think it must have been youthful aspiration to emulate the writers of Nancy Drew and Hardy Boys novels, which were standard childhood fare in Guyana. Also, since I come from a large family, it must have been the regular escape to the New Amsterdam public library to be alone, and whilst there( the place was usually empty), discovering books in the Ladybird series on great scientists, great politicians etc. I distinctly remember reading about Benjamin Franklin, Madame Curie, Alexander the Great, and others, at the age of nine or ten. There were also the odd books on Greek myths, lavishly illustrated for children. The story of Andromeda chained and naked and threatened by a monster, before being saved by Perseus, awakened unfamiliar boyish erotic feelings… perhaps not 'unfamiliar '( I was 8 or 9 ) but certainly the first time a book had aroused such feelings. When I was about 11 or 12 I came across V.S. Naipaul's MIGUEL STREET and was awed by how it made our lives in Guyana so familiar. It was set in Trinidad but the characters lived down my street. A great contrast to the Andromeda story which was exotic and erotic as opposed to the familiar lives of ordinary folk described by Naipaul.Being an academic has also been important to my writing. Firstly, you get a lot of time to read and discuss books with very bright students. Teaching in seminar groups has been amazingly exciting at times, and that intellectual excitement, sensuous in intensity, inspires the act of writing. I used to teach MA courses on Black British Literature and on Literature and Slavery. Certainly, Olaudah Equiano's autobiography in 1789, which I read multiple times for teaching purposes, left an impact on my writing, which is dotted with 'Equiano' figures ( people who moved from deprivation to the craft of writing, through cunning and an inclination for mischief mostly). Secondly, as an academic, you are exposed to theory, which can fertilised your writing and give it a 'metaphysical' content. Overexposure leads to didacticism, which I am sure my writing suffers from. As Derek Walcott says, you shouldn't "put Descartes before the horse." Most importantly, being an academic pays the bills, so whilst hunger has provoked a lot of writers, I preferred to have a house rather than a hovel. Growing up in Guyana was to exist in relative lack of material things. Many years ago I met Maya Angelou, she had kindly invited me to her house, and she had cooked a lovely Southern meal. She said: "I drive a Cadillac. I don't do bicycles, which were my youth. And I eat meat, because all I had as a child was garden vegetables'. I appreciated her extravagance, though deep down she was a kindly person, and generous. RB: You are also a politician. In 2010 you were appointed as Guyana's Ambassador in China. How have you proved yourself as a politician?DD: I don't belong to any political party in Guyana, but I enjoyed a close friendship with Cheddi and Janet Jagan. Cheddi had been cheated out of office as a result of the CIA and the British Government, in the 1960s, because he was a committed man of the left. In 1984, when I was appointed to Warwick University, I invited Cheddi to lecture there. He had no money, so the University and a travel agent friend, Vino Patel, were persuaded to provide his economy ticket and accommodation whilst at Warwick. We treated him as the true President of Guyana. All the national elections had been fiddled, and he was kept out of office for decades. Warwick offered him a platform, when other places thought of him as a 'has been'. He visited about five times, then in 1992, the Berlin Wall having fallen and the Cold war ended, the Americans allowed us to have free and fair elections, supervised by President Carter and Cheddi Jagan won and became President of Guyana. I was his regular houseguest from 1992 until 1997 when he died. He taught me more about how colonialism behaved than any textbook. He had lived through the colonial period and was jailed by the British in 1953. All his life was dedicated to the betterment of the poor: he was fiercely concerned with reducing and eliminating poverty. In return for his great hospitality, all I could do was to edit and publish some of his political speeches. He also asked me to be his Ambassador at Large and to sit on the UNESCO Executive Board representing Guyana. He had no money, since he inherited a bankrupt country in 1992, so it was an amazing honour to serve him pro bono. One day I will write something more extensive about him… one of the stories he told me was about Fidel Castro. The two of them were friends and political comrades in the late 50s and early 60s. It was Cuba who supplied us with food in the early 1960s when the CIA formented strikes and shortages in Guyana. Castro, however, needed allies in the region, against American embargo, so when Cheddi was manoeuvred out of Office, Castro started to court the friendship of our new autocratic Prime Minister, Forbes Burnham, and more or less dropped his relationship with Cheddi. I learn from this that politics trumps decency; that politicians by and large are opportunists. Learning this first hand from a great and ethical politician like Cheddi Jagan was more powerful than learning this from textbooks.As to Janet Jagan, his wife, who, when he died, was elected President in our national elections, with an enhanced vote, she was an astonishingly generous host. My role was to edit and publish her short stories for children. She was a bit lonely in Guyana, in terms of only a few people to share her passion for the arts, so whenever I showed up, a bottle of wine was uncorked, or better still, a bottle of Bailey's Irish Cream( we had a local equivalent). She too had been jailed by the British in 1953, so, again, I learnt from her intimate details of Guyana's struggle for independence, and the callousness of politicians ( Forbes Burnham had attempted to murder her in the 1964 but his bomb went off in the wrong place in the Party's Headquarters, killing a young activist instead, Michel Forde. Janet suffered from minor injuries.)As to Walter Rodney, Guyana's internationally renowned historian, assassinated by Forbes Burnham and the State apparatus in 1980( the International Commission of Enquiry into his death was issued to Guyana's Parliament last month), it was an enlightened decision on the part of the University of Warwick to set up an annual Memorial Lecture . The Walter Rodney lecture has been given, since 1985, by some of our leading Caribbean scholars, like Hilary Beckles, Carolyn Cooper, Harold Goulbourne, Michael Gilkes, Clem Seecharan, Ken Ramchand, Verene Shepherd and others.I don't think I have proved myself as a politician in any concrete way. My only possible 'political' act was, in 2012-2013 lobbying the Government of Guyana vigorously and regularly to set up an International Commission of Enquiry into the death of Walter Rodney. I took full advantage of my friendship with the then President, Donald Ramotar, who was readily sympathetic to Pat Rodney's written request for such an Inquiry( Walter's widow). As a member of the Walter Rodney Foundation's Advisory Group, I liaised with Pat Rodney and in 2013 the Government of Guyana agreed to set up the Commission. I don't think this was a 'political' act on my part, merely the obligation I felt to Walter Rodney, a fellow academic whose books were monumental. RB: How do you define politics?DD: In a small underdeveloped or developing country, politics normally is about the acquisition of power over state resources for the benefit of family and friends. Idealism goes out of the window as soon as the politician assumes Office; the struggle then is for survival and continuation of Office, so very little good gets done, political energy being spent on maintaining and expanding the arena of privilege. Exceptions are rare, people like CheddiJagan, Nelson Mandela…Cheddi was famous for his frugal lifestyle. He died intestate, owning no property. He never stole from the national treasury, rare for a politician from the developing world. Had Rodney lived, he would have been a leader of exemplary ethics. I should add my admiration for a previous, undemocratically elected President of Guyana, Desmond Hoyte, who, long before the Rio Summit and long before 'Climate Change' was topical, bequeathed a million acres of Guyana's rainforest to the Commonwealth, for the study of sustainable development (the Iwokrama Project). This was in 1989. It was an act of rare vision by a Caribbean politician. So, politicians like Hoyte might have been elected by crookery, but can prove to be significant and visionary leaders. I enjoyed cordial relations with him, when he was President (1985-1992) as well as when he was Leader of the Opposition, again based on books. We talked a lot about Egbert Martin, the first Guyanese poet and short story writer (19th century), and about the Guyana Prize for Literature which he had instituted in 1987, in the hope of bolstering the literary and intellectual life of Guyana and its Diaspora. He had a wonderful library, and he cared deeply for literary achievement. We talked little about party politics, except about the sharing of political power and the Mandela Rainbow ideal. Towards the end of his life he was all for power sharing, though he had enough integrity to worry about where oppositional ideas would come from if we were all in alliance. RB: Do your political affairs affect your creative writing?DD: There is no direct link, though I have written about the dereliction of Guyana under the autocratic rule of Forbes Burnham. My new novel-in-progress, set partly in China, is provoked by the unimaginable cruelty imposed on the people by the Emperors and their warlords. So, politics breeds in me a despair which can stimulate writing. One of the great disappointments, living in Britain, was Tony Blair's loss of idealism ( he seemed abundantly idealistic , which is why people voted him into Office in 1992) and the lies he told about Iraq's military capacity to justify a hideous and bloody invasion of Iraq. On the other hand, in Britain, there were politicians like Jo Cox, who was visionary and full of promise( she was murdered recently), and who made all of us feel hopeful and glad to be alive. If only we had a handful of such politicians in Guyana! I am privileged to enjoy a long-standing friendship with Clare Short, the former Labour politician whose heart is as big as Mount Kilimanjaro.RB: You have often depicted Guyanese characters and settings in your fiction such as Disappearance (1993), The Counting House (1996), and Our Lady of Demerara (2004). Does it mean that you still live in your past? and that you know yourself devoted to your homeland?DD: I do live in the past, in that my childhood in Guyana left indelible memories of family and friends and village landscape. Especially the creole language we spoke at home, and the creative tension with the 'proper' English we spoke at school. The slippages between the two are fascinating, with potential for comedy and pathos. The vigour of creole is always with me.Leaving Guyana as a boy was exciting (the prospect of adventure) but then proved to be lonely and hurtful, since I was never settled in England. On the one hand, England was a world of books but at the same time a world of grunting and guttural 'skinheads' daubing racist slogans on walls and threatening to assault immigrants. London has changed profoundly since the 60's and 70's, it is now a diverse space, enriched by waves of immigrants from the Commonwealth and from Europe. There is still a strong undercurrent of racial hostility, but more in the north of England, hence the recent vote to leave the European Community. Many in the north of England have not got accustomed to the loss of Empire and the new order of the free movement of goods and people. This hostility is at the ideological level, and contradictory, because on a day to day level, people are, by and large, decent to each other, irrespective of ethnicity. London is different; it is run by people of immigrant backgrounds: nurses, doctors, builders, hotel and retail staff, care workers. I am astonished at how much has changed, and I am excited to be living in London. The creative energy of the city is palpable, and the diversity of people is inspiring. I no longer feel culturally or physically threatened, as in the 1960's and 1970's. In other words, I feel London is home, but so is Guyana. I return to Guyana at least once a year, to renew my sense of the past, to be refreshed by creole language and creole ways, and to be awed and terrified by the rainforest. I also keep writing about Guyana partly out of a sense of obligation to the place. We only have a handful of writers, so I feel it is important to write about the place. Guyana came into modern being, in a sense, through literature: I am thinking specifically of Walter Raleigh's DISCOVERIE OF GUIANA (1596), the first text about us. RB: Why do you often depict historical tensions and challenge traditional cultural representations of the slave in your novels?DD: Guyanese history, in relation to contact with Europe, is stark: the decimation of indigenous people, the enslavement of Africans, the system of Indian indentureship. It is stark in terms of the immensity of suffering, and the sheer injustices of colonial rule. Yet, we became acquainted with Samuel Johnson's DICTIONARY and the magical properties of the English language; with the lyricism and storytelling of the Bible, of Shakespeare, of Victorian poetry. These new texts supplemented the ones we brought from Africa and India ( the KORAN, the RAMAYANA) . Ancient and living Carib, Arawak and other Amerindian stories fertilised the situation. We rewrote and reimagined our inheritance, hence Walcott, Naipaul, Jean Rhys, Pauline Melville, Grace Nichols, John Agard, and a host of others. I write about the injustice (historical, but also self-inflicted in our postcolonial condition) but more about the urge to creativity and expression that emerged from being on the margins; the fierce resolve to become educated, literate, creative, venturing beyond boundaries. Our postcolonial politicians may have failed us repeatedly, but I am forever astonished at how resilient Guyanese are. When I visit parts of India, parts of China, the nature of poverty there is brutal and overwhelming. We don't have that level of deprivation, because we have created the means of survival and the prospect of abundance, whether on the plate or on the page. RB: Do you believe that there is any nation on earth that enjoys true freedom and independence?DD: I don't know what true freedom or independence mean, we are all constrained and liberated and catapulted into creativity by being with each other. However, I recall what Walcott said about slavery: that the enslaved African being herded to the cane fields would have seen something sensationally beautiful along the way, given how lush Caribbean landscapes are. A hummingbird or kiskadee or blue-saki or brightly coloured viper…Walcott said that such encounters with beauty were moments of freedom which could only be partially understood, partially described, because they also contained the seeds of tragedy and terror. If you venture into Guyana's rainforest, you will experience the sublime which contain elemental terror and a tragic sense of how life is constantly being destroyed and remade and destroyed by tooth and claw.[1] Ruzbeh Babaee[2] David Dabydeen

1PELAKSANAAN PERLINDUNGAN HAM TERHADAP ANAK YANG MENJALANKAN HUKUMAN DI LEMBAGA PEMASYARAKATAN ANAK TANJUNG PATI PAYAKUMBUH JURNAL Ditulis Kepada Fakultas Hukum Universitas Bung Hatta Untuk Memenuhi Salah Satu Persyaratan Guna Memperoleh Gelar Sarjana Hukum (S.H)Oleh: FERRY KURNIAWAN NPM: 0810012111110 FAKULTAS HUKUM UNIVERSITAS BUNG HATTA PADANG201321PELAKSANAAN PERLINDUNGAN HAM TERHADAP ANAK YANG MENJALANKAN HUKUMAN DI LEMBAGA PEMASYARAKATAN ANAK TANJUNG PATI PAYAKUMBUH Ferry Kurniawan1) Nurbeti1 Suamperi2 1)Mahasiswa Program Studi Ilmu Hukum Fakultas Hukum Universitas Bung Hatta E-mail: ferry-kurniawan08@ymail.comABSTRAK In serving his sentence in prison, and the Legal Protection of Human Rights against children set out in Law no. 23 of 2002 on Child Protection, so that children who are in the prison service can feel as though their children in general in serving. In this paper the authors formulate the problem, namely 1. How is the protection of human rights of children who run the prison sentence in Tanjung Pati Payakumbuh? 2. What are the constraints faced by prison officers Tanjung Pati Payakumbuh child? 3. How can efforts be undertaken by officers in correctional institutions in the breakdown behavior of children in child prisons Tanjung Pati Payakumbuh?. In this study the authors used socio-juridical writing method using the material library and field research through interviews with respondents and informants in prison, the data obtained in the field is analyzed and formulated in the form of conclusions in the study. Conclusions from this research is conducted with the protection of human rights provide protection to children's rights, providing legal protection and social guarantees for the children, the protection of health, education, skill, mental and social and cultural. Constraints faced by prison officers in dealing with solving behavior is different on each of the students of Corrections Keywords: Child Protection, Corrections, MinistryPendahuluanPermasalahan anak di Indonesia belum dapat ditangani secara serius dan benar. Penanggulangan permasalahan anak menjadi kurang di tengah hiruk-pikuk persoalan politik. Ironisnya, di satu permasalahan anak di anggap sesuatu yang penting hingga membutuhkan perhatian dan kepedulian yang sungguh-sungguh, tetapi di sisi lain, dalam realitasnya permasalahan anak, tindak kekerasan dan penelantaran anak masih belum dapat ditangani dengan baik. Masih terjadi kesenjangan antara harapan dengan kenyataan yang dihadapi anak Indonesia (Abu Huraerah, 2006. Kekerasan terhadap Anak, Penerbit Nuansa, Bandung, hlm. 18)Setiap anak memerlukan pembinaan dan perlindungan dalam rangka menjamin pertumbuhan dan perkembangan fisik, mental dan sosial secara utuh, serasi, selaras dan seimbang. Pembinaan dan perlindungan anak tak mengecualikan pelaku tindak pidana anak. Kerap disebut sebagai "anak nakal". Anak yang melakukan tindak pidana, dalam hal ini sebagaimana yang di tentukan dalam Pasal 1 angka 1 Undang-undang No. 32Tahun 1997 tentang Pengadilan Anak, ialah orang yang mencapai umur 8 tahun tetapi belum mencapai umur 18 tahun dan belum pernah menikah (Manunggal K.Wardaya,2010. Perlindungan terhadap Anak yang Melakukan Tindak Pidana, http://kuliahmanunggal.wordpress.com.Perlindungan-terhadap-anak-yang-melakukan-tindak-pidana. 8 Februari 2013) Anak merupakan penerus cita-cita bangsa dan sumber daya manusia bagi pembangunan nasional. Agar kedudukan anak ini dapat diwujudkan, maka terhadap anak diperlukan pembinaan secara terus menerus demi kelangsungan hidup, pertumbuhan dan perkembangan fisik, mental, sosial serta perlindungan dari segala kemungkinan yang akan membahayakan mereka dan bangsa di masa depan.Upaya untuk perlindungan terhadap anak dalam kenyataannya tidak semudah yang dipikirkan, melainkan anak seiring dihadapkan pada berbagai permasalahan dan tantangan dalam masyarakat dan kadang-kadang dijumpai penyimpangan pada perilaku di kalangan anak, bahkan lebih dari itu terdapat anak yang melakukan perbuatan melawan hukum atau melakukan tindak pidana seperti yang dilakukan oleh orang dewasa (Manunggal K.Wardaya,2011. Perlindungan HAM terhadap anak yang berhadapan dengan hukum, http://kuliahmanunggal.wordpress.com.Diversi-sebagai-bentuk-perlindungan-hak-asasi-manusia-anak-yang-berhadapan-dengan-hukum. 8 Februari 2013) Orang tua, keluarga, dan masyarakat bertanggung jawab untuk menjaga dan memelihara hak asasi tersebut sesuai dengan kewajiban yang dibebankan oleh hukum. Demikian pula dalam rangka penyelenggaraan perlindungan anak, Negara dan pemerintah bertanggung jawab menyediakan fasilitas dan aksebilitas bagi anak, terutama dalam menjamin pertumbuhan dan perkembangannya secara optimal dan terarah. Undang-undang No. 23 Tahun 2002 menegaskan bahwa pertanggungjawaban orang tua, keluarga, masyarakat, pemerintah dan Negara merupakan rangkaian kegiatan yang dilaksanakan secara terus-menerus demi terlindungnya hak-hak anak. Rangkaian kegiatan tersebut harus berkelanjutan dan terarah guna menjamin pertumbuhan dan perkembangan anak, baik fisik, mental, spritual maupun sosial.Mengingat kedudukan anak sebagai sumber daya manusia bagi pembangunan nasional dalam rangka meneruskan cita-cita bangsa, ciri dan sifat anak yang khas, serta faktor-faktor penyebab anak melakukan tindak pidana, maka diperlukan perlindungan hukum yang bersifat khusus bagi anak yang melakukan tindak pidana. Artinya, harus ada perbedaan perlakuan3antara anak sebagai pelaku tindak pidana dan orang dewasa sebagai pelaku tindak pidana. Anak Indonesia sebagai anak tidak atau belum mempunyai kemampuan untuk sendiri melengkapi dan mengembangkan dirinya untuk dapat melaksanakan hak dan kewajibannya sebagai warga negara yang bertanggung jawab dan bermanfaat untuk sesama manusia. Kondisi fisik, mental, sosial seorang anak yang dependen seringkali memungkinkan dirinya disalahgunakan secara legal atau illegal, secara langsung atau tidak langsung oleh orang sekelilingnya tanpa dapat berbuat sesuatu (Arif Gosita, 2004, Masalah Perlindungan Anak (Kumpulan Karangan), PT. Bhuana Populer, Jakarta, hlm. 166) Selain dengan itu, dalam menjalani hukumannya anak juga dapat melakukan pembinaan seperti juga dengan anak lainnya sehingga itu tidak menyia-nyiakan kesempatannya, tetap mendapat perlakuan seperti anak pada umumnya dan anak tersebut juga dapat memberikan contoh yang baik. Secara yuridis formal, perlindungan hak asasi manusia terhadap anak sebagai pelaku tindak pidana telah terimplementasi di beberapa hukum positif, antara lain:1. Undang-undang No.3 Tahun 1997 tentang Pengadilan Anak pada intinya menentukan, bahwa penyelenggaraan pengadilan terhadap anak dilakukan secara khusus, berbeda dengan terdakwaanak dilakukan orang dewasa. Kekhususan itu antara lain berupa:a. Terhadap tersangka anak yang belum mencapai umur 8 (delapan) tahun, penyidik berwenang untuk tidak melanjutkan penyidikan dan menyerahkan kembali anak tersebut kepada orang tua wali atau tua asuhnya, atau menyerahkan kepada Departemen Sosial.b. Sidang pemeriksaan perkara pidana dengan terdakwa anak dilakukan secara tertutup.c. Pidana penjara yang dapat dijatuhkan terhadap anak pelaku tindak pidana paling lama setengah dari ancaman maksimum ancaman penjara bagi orang dewasa.2. Undang-undang No. 39 Tahun 1999 tentang Hak Asasi Manusia, antara lain menentukan :a. Penangkapan, penahanan, dan pemenjaraan terhadap anak hanya dapat dilaksanakan sebagai upaya terakhir.b. Penahanan dan pemenjaraan terhadap anak harus dipisahkan dari orang dewasa.c. Pelaku tindak pidana anak tidak dapat dijatuhi hukuman mati atau hukuman penjara seumur hidup.3. Undang-undang No. 23 Tahun 2002 tentang Perlindungan Anak, antara lain menentukan perlindungan khusus bagi4anak yang berhadapan dengan hukum dilaksanakan melalui:a. Penyediaan petugas pendamping khusus anak sejak dini.b. Pemberian jaminan untuk mempertahankan hubungan dengan orang tua atau keluarga.c. Perlindungan dari pemberitaan identitas melalui media masa dan untuk menghindari labelisasi.Selain itu bagi anak yang menjalankan hukumannya sebagai narapidana anak di dalam lembaga pemasyarakatan dapat dilindungi serta mendapatkan pelayanan sebagai mana mestinya anak tersebut dalam keadaan kurang sehat, dan lembaga pemasyarakatan dapat memberikan pelayanan sesuai dengan kebutuhan anak tersebut secara medis. Hak-hak Anak maupun Undang-undang Perlindungan Anak menetapkan empat prinsip penting dalam memenuhi hak-hak anak, yakni :a) Non diskriminasi.b) Penghargaan terhadap pendapat anak.c) Hak hidup, kelangsungan hidup tumbuh dan berkembang.d) Kepentingan yang terbaik bagi anak (Direktorat Bina Kesehatan Anak http://Pedoman Yankes Anak Dilapas. Wordpress.com.8 Februari 2013.)Sebagaimana yang tercantum dalam Undang-undang No. 23 Tahun 2002 tentang Perlindungan Anak Pasal 46 menyebutkan: "Negara, pemerintah, keluarga, dan orang tua wajib mengusahakan agar anak yang lahir terhindar dari penyakit yang mengancam kelangsungan hidup dan atau menimbulkan kecacatan", sehingga anak yang ada dalam lembaga pemasyarakatan tersebut dapat merasakan pelayanan sebagaimana anak pada umumnya walaupun ia dalam menjalani hukuman. Sekarang telah dimulai dilaksanakan suatu sistem yang lebih baik yaitu sistem pemasyarakatan, yang dititikberatkan pada upaya agar seseorang terpidana dapat kembali ke jalan yang benar dan diberi bekal hidup untuk kemudian hari yang bersifat jasmani dan rohani. Konsepsi ini muncul tanggal 5 Juli 1963 yang diperkenalkan oleh Suhardjo dan idenya dijabarkan dalam Konferensi Direktur Penjara Seluruh Indonesia tanggal 17 April 1964 di Lembaga Bandung. Dalam konferensi ini dimulai adanya tekad untuk memperbaiki sistem pembinaan narapidana atau anak pidana berdasarkan atas Pancasila dan Undang-Undang Dasar 1945 (Harsono, 1995. Sistem Baru Pembinaan Narapidana, Penerbit PT Grametika, Jakarta, hlm 1)Dari uraian di atas maka penulis ingin mengetahui lebih lanjut bagaimana pelaksanaan bentuk perlindungan HAM yang di berikan terhadap anak dalam menjalankan hukumannya di lembaga pemasyarakatan tanjung pati Payakumbuh sebagai anak pidana sesuai dengan apa yang5diharapkan dalam system pemasyarakatan Indonesia yang tercantum dalam Undang-undang No. 12 Tahun 1995 tentang pemasyarakatan. Metode Penelitian Metode yang digunakan dalam penelitian ini adalah metode pendekatan yuridis sosiologis yakni pendekatan terhadap masalah melalui penelitian hukum dengan melihat kenyataan hukum tersebut dalam praktek, kemudian dihubungkan dengan fakta-fakta yang ada dari permasalahan yang akan diteliti. Pendekatan ini dilakukan dengan cara turun langsung ke lapangan untuk memperoleh data primer mengenai pelaksanaan perlindungan HAM terhadap anak yang menjalani hukuman di Lembaga Pemasyarakatan Anak Tanjung Pati Payakumbuh.1. Bahan atau materi penelitianPenelitian ini menggunakan dua sumber yaitu:a. Data primerData yang diperoleh melalui penelitian di lapangan dengan melakukan wawancara di Lembaga Pemasyarakatan Tanjung Pati Payakumbuh.b. Data SekunderData tambahan atau data pendukung yang memiliki kekuatan mengikat ke dalam, yang diperoleh dari bahan-bahan berupa catatan, Koran, dokumen, laporan yang berhubungan perlindungan hukum bagi anak di lembaga pemasyarakatan anak. Bahan hukum yang di pakai dalam penelitian ini adalah sebagai berikut :1. Bahan hukum yang mengikat yang antara lain :a) Undang-Undang Dasar Negara Republik Indonesia 1945b) Undang-undang No. 39 Tahun 1999 tentang HAMc) Undang-undang No. 12 Tahun 1995 tentang Lembaga Pemasyarakatand) Undang-undang No. 26 Tahun 2000 tentang Peradilan HAMe) Undang-undang No. 23 Tahun 2002 tentang Perlindungan Anakf) Undang-undang No. 23 Tahun 2004 tentang Penghapusan KDRTg) Undang-undang No. 3 Tahun 1997 tentang Peradilan Anak2. Bahan hukum sekunderMeliputi buku-buku yang berkaitan dengan penelitian, hasil penelitian, karangan ilmiah dan lain-lain.3. Teknik pengumpulan dataDalam pengumpulan data penelitian menggunakan beberapa teknik antara lain :a. Studi Dokumen, dalam mengumpulkan data di gunakan studi dokumen bertujuan untuk mengumpulkan data yang utama untuk mengarahkan penulis dalam melakukan penelitian.6Contoh: data, jumlah anak yang berada di Lapas pemasyarakatan anak Payakumbuh.b. Wawancara, pengumpulan data dengan cara pengadaan percakapan atau tatap muka langsung untuk memperoleh data dan keterangan baik secara lisan maupun secara tulisan kepada pihak responden dan informan.4. Analisis DataSetelah data diperoleh / dikumpulkan dari penelitian, maka analisis data dilaksanakan secara kualitatif yaitu mengelompokkan data menurut aspek-aspek yang diteliti/diambil suatu kesimpulan dengan/tanpa menggunakan angka statistik. Hasil Penelitian dan Pembahasan Dalam hal perlindungan hukum dan hak-haknya bagi anak-anak merupakan salah satu sisi pendekatan untuk melindungi anak-anak Indonesia, agar perlindungan hak-hak anak dapat dilakukan secara teratur, tertib dan bertanggung jawab maka diperlukan peraturan hukum yang selaras dengan perkembangan masyarakat Indonesia yang dijiwai sepenuhnya oleh Pancasila dan UUD Negara Republik Indonesia 1945.Kaitannya dengan perlindungan hukum bagi anak-anak maka dalam Pasal 34 UUD Negara Republik Indonesia 1945 telah ditegaskan bahwa " fakir miskin dan anak-anak terlantar dipelihara oleh Negara". Hal ini menunjukkan adanya perhatian serius dari pemerintah terhadap hak-hak anak dan perlindungannya. Usaha perlindungan anak sudah sejak lama ada, baik pengaturan dalam bentuk peraturan perundang-undangan maupun dalam pelaksanaannya, baik pemerintah maupun organisasi sosial, namun demikian usaha tersebut belum menunjukkan hasil yang memadai sesuai dengan kebutuhan perkembangan masyarakat Indonesia. Keadaan ini disebabkan situasi dan kondisi serta keterbatasan yang ada pada pemerintah dan masyarakat sendiri belum memungkinkan mengembangkan secara nyata ketentuan peraturan perundang-undangan yang telah ada. Meskipun seorang anak sedang menjalani hukuman di Lembaga Pemasyarakatan, ketentuan-ketentuan tentang hak-hak anak tetap harus berlaku padanya. Keberadaan mereka di Lembaga Pemasyarakatan dan statusnya sebagai anak didik Pemasyarakatan tidak menghapuskan hak-hak yang melekat pada diri mereka yang wajib dipenuhi serta dilindungi dengan baik. Dalam memberikan perlindungan HAM terhadap anak yang menjalani hukuman di Lembaga Pemasyarakatan Anak Tanjung Pati ada beberapa hak yang harus diberikan terhadap anak antara lain :1. Hak untuk melakukan ibadah sesuai kepercayaan masing-masing72. Hak untuk mendapatkan perawatan kesehatan3. Hak untuk mendapatkan pendidikan4. Hak untuk menyampaikan keluhan atau konseling5. Hak untuk mendapatkan pembinaan keterampilan6. Hak untuk menyalurkan minat dan bakat7. Hak untuk berkunjung keluarga.Pelaksanaan hak-hak anak dalam menjalankan sanksi hukuman di Lembaga Pemasyarakatan merupakan suatu hasil interaksi antara berbagai fenomena yang saling terkait dan saling mempengaruhi. Dimulai dengan memperhatikan aspek-aspek mental, fisik, sosial, ekonomi, guna didapat pemahaman atas penyebab timbulnya hambatan atas pelaksanaan perlindungan Hak Asasi Manusia terhadap anak didik Pemasyarakatan. Menurut petugas Lembaga Pemasyarakatan Anak Tanjung Pati Payakumbuh perlindungan yang diberikan kepada anak ketika dia sedang berhadapan dengan masalah hukum serta berkonflik dengan hukum sebagai berikut :a. Perlakuan atas anak secara manusiawi sesuai martabat dan hak-hak anakb. Penyediaan petugas pendamping khusus anak sejak dinic. Menyediakan sarana dan prasarana khususd. Penjatuhan sanksi yang tepat untuk kepentingan yang terbaik bagi anake. Pemantauan dan pencatatan terus menerus terhadap perkembangan anak yang berhadapan dengan hukumf. Pemberian jaminan untuk mempertahankan hubungan dengan orang tua atau keluarga, dang. Perlindungan dari pemberitaan identitas melalui media massaSelain daripada itu ada pula terdapat kendala-kendala yang dihadapi oleh anak dalam menjalani hukumannya seperti :1. Kurangnya fasilitas air yang terdapat pada tiap-tiap kamar Pemasyarakatan anak Tanjung Pati2. Kondisi tempat kunjungan keluarga terlalu kecil, bahkan ada keluarga yang antri untuk berkunjung anaknya di Lembaga Pemasyarakatan3. Kurangnya petugas yang ada di Lembaga Pemasyarakatan Anak Tanjung Pati4. Cara berfikir atau pemahaman orang-orang terhadap anak sebagai narapidana yang membuat anak tersebut menjadi tidak percaya diri5. Kuatnya anggapan bahwa anak sebagai narapidana adalah seseorang penjahat maka mereka di dalam kehidupan bermasyarakat akan dikucilkan, sehingga orang merasa tidak percaya terhadap anak tersebut86. Anak selaku narapidana adalah sebagai orang yang tidak baik dalam masyarakat karena telah terbukti melakukan perbuatan tercela7. Singkatnya waktu kunjungan keluarga terhadap narapidana.Upaya-upaya yang di oleh petugas dalam pemecahan prilaku anak di Lembaga Pemasyarakatan antara lain :1. Petugas Lembaga Pemasyarakatan melakukan pendekatan dengan anak agar bisa bersosialisasi2. Setiap anak yang berprilaku buruk atau anak yang melakukan aksi kekerasan sehingga terjadi aksi perkelahian, maka petugas Lembaga Pemasyarakatan akan melakukan tindakan mengurung anak tersebut di dalam kamar isolasi agar anak itu mendapat efek jera3. Upaya pelayanan kesehatan terhadap anak di Lembaga Pemasyarakatan di berikan oleh petugas terhadap anak didik Pemasyarakatan setiap hari4. Pelaksanaan kegiatan olah raga yang di lakukan anak didik Pemasyarakatan setiap hari5. Pelaksanaan kegiatan kesenian agar membantu mewujudkan kreatifitas terhadap anak Lembaga Pemasyarakatan6. Pelaksanaan wirid pengajian yang di lakukan terhadap anak merupakan suatu pemahaman terhadap agama bagi anak Lembaga Pemasyarakatan.Simpulan1. Dalam memberikan perlindungan HAM terhadap anak yang menjalani hukuman di Lembaga Pemasyarakatan Anak Tanjung Pati ada suatu hak yang harus diberikan terhadap anak antara lain :a. Hak untuk melakukan ibadah sesuai kepercayaan masing-masingb. Hak untuk mendapatkan perawatan kesehatanc. Hak untuk mendapatkan pendidikand. Hak untuk menyampaikan keluhan atau konselinge. Hak untuk mendapatkan pembinaan keterampilanf. Hak untuk menyalurkan minat dan bakatg. Hak untuk berkunjung keluarga2. Kendala yang dihadapi oleh petugas Lembaga Pemasyarakatan adalah dalam menangani pemecahan prilaku yang berbeda-beda pada setiap anak didik Pemasyarakatan.3. Upaya-upaya yang di lakukan oleh petugas dalam pemecahan prilaku anak di Lembaga Pemasyarakatan antara lain dengan cara melakukan pendekatan kepada anak didik pemasyarakatan dan merubah prilaku anak didik pemasyarakatan menjadi9lebih baik setelah keluar dari Lembaga Pemasyarakatan dan tidak mengulangi perbuatan yang dilakukan sebelumnya.Ucapan terima kasih Pada kesempatan ini penulis mengucapkan terima kasih banyak kepada pihak-pihak yang sudah membantu penulis selama menyelesaikan skripsi. Pihak-pihak yang dengan sabar membimbing dan selalu memotivasi penulis dalam menyelesaikan skripsi.1. Pihak tersebut adalah: (1) Ibu Nurbeti, S.H., M.H, selaku Pembimbing I dan Wakil Dekan Fakultas Hukum, (2) Bapak Suamperi, S.H., M.H, selaku Pembimbing II, merangkap Ketua Jurusan Hukum Tata Negara, (3) Bapak Boy Yendra Tamin, S.H., M.H, sebagai Penguji 1, (4) Bapak Drs. Suparman Khan, M. Hum, sebagai Penguji II, (5) Ibu Dr. Sanidjar Pebrihariati. R, S.H., M.H, selaku Penguji III, (6) Keluarga tercinta yang selalu memberi dukungan moril maupun materi. (5) Adik-adik penulis, kekasih serta Teman-teman seperjuangan.Daftar Pustaka Abu Huraerah, 2006. Kekerasan terhadap Anak, Penerbit Nuansa, Bandung, hlm. 18Manunggal K.Wardaya,2010. Perlindungan terhadap Anak yang Melakukan Tindak Pidana, http://kuliahmanunggal.word press.com.Perlindungan-terhadap- anak-yang-melakukan-tindak-pidana. 8 Februari 2013 Arif Gosita, 2004, Masalah Perlindungan Anak (Kumpulan Karangan), PT. Bhuana Populer, Jakarta, hlm. 166Direktorat Bina Kesehatan Anak http://Pedoman Yankes Anak Dilapas. Harsono, 1995. Sistem Baru Pembinaan Narapidana, Penerbit PT Grametika, Jakarta, hlm 1 Tim Fakultas. Hukum, 2006. Pedoman Penulisan Usulan Penelitian dan Skripsi, UBH, Padang.

Confession without Borders: 1st Wave Feminism against Woman's Right Disproportion in AtiqRahimi'sThe Patience Stone TitikHariPangestu English Literature Faculty of Languages and Arts State University of Surabaya Titik_hari@ymail.com Diana Budi Darma, SS. M.Pd. English Department Faculty of Languages and Arts State University of Surabaya Dianabd9@gmail.com Abstrak Penelitianinimemfokuskanpadaketidakseimbanganatashak-hakperempuan di Afghanistan denganmenggunakantindakantokohutamadalam novel inisebagaisumberdalamtesisini. Ktidakseimbanganhakmunculsebagaiakibatdaridominasisatusisikesisi lain. Masalahpertamadalamtesisiniberbicaratentangdominasilaki-laki. Yang keduamengungkapkanpengakuanperempuansebagaicerminandarifeminismegelombangpertama. Dalammenjawabpertanyaanpertama, penelitianinididukungolehteoripatriarki, sertadidukungolehbukuNawal El – Saadawi, dimanabukuiniberfokuspadadominasilaki-laki di wilayahArab. Permasalahankeduaakandijawabdenganmenggunakanteoridarifeminism, yang mengkhususkanpada feminismgelombangpertama. Analisisiniakanmenunjukkanbahwaketidakseimbanganperempuandisebabkanolehadanyawarisan agama danbudayasecaraturuntemurundalamkomunitasini. Setelahmenggambarkandoominasikaumpria, selanjutnyatesisiniakanmenggambarkanbagaimanaperempuan di wilayahinimenghadapiketidakseimbanganini. Tesisiniakanmengemukakan,sistemPatriarki yangdinilaisebagaipenyebabmunculnyaketidakseimbangantersebut,.Ketidakseimbanganinimemberikantekananbesartercermindalampengakuanistri, yang padaakhirnyamemberinyakekuatanuntukmelawanterhadapketidakseimbanganini. Kata kunci: Patriarki ,FeminismeGelombangPertama Abstract This study focuses on depicting Afghan women's rights disproportion by using main character's act inside this novel. Right disproportion appears as a result of the domination of one sides to the other. The first problem talks about the domination of men's. The second reveal the women's confession represent first wave feminism. In answering first question, this research is supported by patriarchy theory, and supported by Nawal-El-Saadawi's book which focus on men's domination in this region. The second statement of problem will be answered by using a theory from the first wave feminism. The analysis reveals the disproportion of women right caused by hereditary thought of their religion and cultural and also how women in this region face this disproportion. Patriarchal believes is use as a cause of the disproportion. Furthermore, this disproportion which cause a huge pressure analyzing by wife's confession finally give her a power to fight back against this disproportion. Keywords: Patriarchy, First Wave Feminism INTRODUCTION Offending to women in the society, especially to traditional system, it must dribble a fact of disproportion of women within it. This fact finally grounds the responder of it, especially to whom it may concern with cultural study to talk to. Besides that, this phenomenon also creates an unforgettable experience to author to write it down in utterance of beautiful work, especially novel that brings conflicts in detail. According to Rene Wellek and Austin Warren say that literary work is the representation of the author toward social life and society (Wellek & Warren, 1949: 90). According those quotation, literary can be affected by society because the author is part of the society. His idea can come from his or her society. The author combining his experience with some fiction than use this as the main source of literary works. In other word, between literary work and society or social life is tightly related each other. By using particular literary work, a researcher can identify a social condition in a particular area. Empirically, women are seen as the weakness subject. They are only put in in the second position in this life. Their duties only focus on domestic area such as bearing a child, cook for the household, and clean the house. Functionally, in war era women are only used for king and warrior sex satisfaction. They do not have any important role struggling for the war. Women's involvement in the war seen as a problem. They are seen as the weakness creature that will cause difficulties and also seen as a stupid creature who does not understand about war strategy. So, in this era, they were only used as the object for the warrior's sexual desire. Institutionally women are consider as the womb of baby child before it is born to the world. Unfortunately after their birth, the right of their naming is totally in their father hands. For example, in Chines system of family name, the structural of their kids name is come from their father family name. From those explanation, it can be conclude that women only seen from their function rather than their role. Women do not have their own in making important decision, to give their opinions, especially deliver about their feeling. They cannot live with their own will. Their man is the center of their live. They have to fulfill what their man need. This Traditional gender role cast men as rational, strong, protective, and decisive. They cast women as emotional (irrational), weak, nurturing, and submissive (Lois Tyson, 2006: 84). Men is the leader of their women, they have total control in decide how the women behave and act. However, in fact this traditional gender role still occur in this modern era, especially in Middle East country such as Afghanistan. This country known as an Islamic country which is uses Koran as their main laws, and guidance of their live. In Koran. Islam had been stated that "Men are the protectors and maintainers of women, because God has made one of them to excel the other, and because they spend from their means. Therefore the righteous women are devoutly obedient and guard in the husband's absence what God orders them to guard. It is also said that men are little bit higher than women and they are oblised to protect and save the women. Patriarchy has become an inevitable issue of the growth of Afghanistan as a Muslim country. Especially during the Taliban leadership, which began in 1996 till 2001. Taliban as a part of Arabian world has different perception in apply Islamic laws. The Taliban's version ofIslamappears too many Muslims to be a new-bornfaithdeveloped, canonized, and interpreted by Taliban scholars with the reclusive supreme leader, Mohammed Omar at the helm giving his stamp of approval for implementation. Afghan women were forced to wear theburqaat all times in public which is quite different with burqa from Arabian women. Afghan women cover all of parts their body including their face except their eyes area. Taliban see face of a woman is a source of corruption for men who are not related to them.In a systematic segregation sometimes referred to asgender apartheid, women were not allowed to work, they were not allowed to be educated after the age of eight, and until then were permitted only to study theQur'an. Women were beaten for showing a bit of ankle or wearing noisy shoes. They could not speak in public or to men who were not relatives. They were beaten, even killed, for minor violations of these rules. But all of that oppression does not make women in Afghanistan hate Taliban men. Marrying Taliban warrior seen as one of the pride in their life. It cause the Taliban warrior seen as the hero in Afghanistan. They were struggling for their freedom from the western shackles, even in fact their coming give another suffering for women in Afghanistan. Marry them can increase the assessed value and the social status of a family. They will be considered as a family of heroes who fought for his country. So, it is pride for any Afghanistan women to married a Taliban warrior even they know what kind of consequence that they will face. Finally, it sharpen to a problem about the relation of them, Islam, Taliban, Patriarchy, and women in the world, especially to the facts reflected in Atiq Rahimi's The Patience Stone. Generally, religion have a patriarchal view of the relationship between the genders. The relation between Adam and Eve how many religion view woman. As Al-Hibri writes, God was declared male, and man was declared to be created in His likeness. Eve became the symbol of temptation and sin. The woman was consequently judged as a less likely candidate for salvation and an everlasting life in heaven than man. (Al-Hibri, 1981:176). Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). As the living carrier of the danger of sexuality and its infinite social destructive forces, women have to be controlled. Since Islam regards women as an active sexual power, it is important to restrict women's sexual power over men. The result is isolating women and men in different worlds. In talking about women's oppression, feminism thought as the appropriate philosophy in investigate this phenomenon. Feminism is an awareness of women's oppression and exploitation in society. This theory is struggling to achieve dignity, rights, and freedom for women to control their lives and bodies within home and outside. According to its movement, this philosophy were divided into three waves, first wave, second and third wave. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. And according to the problem which is appear in the explanation above, the first wave movement of feminism, is appropriate movement that will be used to answer this question. Originally it focus on the promotion of equal contract and property rights for women and the opposition to chattel marriage and ownership of married women (and their children) by their husbands. This movement begin with Mary Wollstonecraft's Vindication of the Rights of Woman (1792). Wollstonecraft's was the first to issue an outspoken rallying cry to middle-class women, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational, till women are more rationally educated. Furthermore, this thesis will become a great analysis when it is known that the object of this thesis, AtiqRahimi's The Patience Stone, is the winner of prestigious Goncourt Prize in France, and is a deceptively simple book written in a spare, poetic style. It is rich read, part allegory, part of tale of retribution, part an exploration of honour, love sex, marriage, and war. It is without doubt an important and courageous book. This voice is in giving voice to those who, as the fable goes, suffer the most and cry out the least (Khaled Hosseini, The Patience Stone's Preface). The Patient Stone is a France novel which is translated in English version. Set almost entirely in one room - the bedroom of the husband and just about the only character who talks is the wife. The woman open up her feeling and thought to the men in her society, confronting the taboo of female oppression and sexuality. Her voice can describe the darkness in her live, her painful and her sorrow for being as a women. Her monologue definitely drive out the reader to think as the woman side, without eliminating the other character in this novel. Besides The Patience StoneAtiqRahimi also wrote some canon novel and won some prestigious appreciation. The first novel is Earth and Ashes, written in Persian and become an instant best seller in Europe and South America. A movie based on this book, directed by Rahimi, was awarded the Prix du Regard versl'Avenir at the 2004 Cannes Film Festival. The film was featured in 50 festivals, winning a total of 25 awards including the one at Cannes and a Golden Dhow award for best feature film at the Zanzibar International Film Festival. And the others work is A thousand Rooms of Dream and Fear. Working on disproportion of women right for study is always an interesting and courageous idea. Through the confession of "Wife" character in this novel, this study can reveal that there is a rebellion and courageous, and how this character survive from the disproportion in Taliban era. Wife already thought since she was young that man is leader for woman, so she must obey him. Rather than fight back against her husband, she choose to use her silence as a form of rebellion. By using this character, it is can be seen that there is a rebellion inside of hereditary understanding regarding woman and man positioned. With discussing this topic, there is a description about what happened in this country especially about the inequality and also how far the disproportion of the women right still exist in this country. RESEARCH METHOD As has been stated in the description above, literature is a reflection of a society portray and the combination of the author fiction. Literary work is meaningful. Hence, it delivers many meanings and interpretations that can be caught by the reader as an interpreter. In other word, to find the accounted result, it needs a method that is based on the problems to avoid the blurry result. This study take novel from Atiq Rahimi The Patience Stone as the main source, and using some quotation inside it as the data. The type of this research is qualitative research because it produces descriptive data. The problem in this study is concerning about man's domination and woman's inequality treatment that will be analyzed by using patriarchy and first wave feminism from several feminists. WOMAN IN ISLAM Islam already stated that man is a leader for woman so they obliged to educate, protect and maintain the woman. God had been created man little bit more than the woman. It can be seen by the existence of their muscle. This gift, make man as the stronger one so they are seen as the appropriate one to be a leader while woman is the follower. So, woman must follow and obey their husband. According to Saadawi's book, Islam inherited the old image of Eve and of women that depict them as the close followers and instrument of Satan, the body of women being his abode (Saadawi, 2001:274). So, it is important to envelop them in veils and flowing robes (Saadawi, 2001:275). In other word, this society position woman as the guilty one dealing with their body and sexuality. That is why, woman in Islam, especially in Patriarchy country must get married, so they need man to control their temptation. Islam makes marriage as the only institution where sex between men and women can be done in a way that is more moral (Saadawi, 2001:280). Sex is done outside this institution directly transformed into an act of sin and evil, even masturbation was not permitted. Based on Ibnu Abbas' (friend of Prophet Muhammad) statement "and married a slave is better than masturbation and fornication (zina)". Therefore an unmarried men divided into three sins, first married a slave, then masturbation the foremost is fornication (zina). In other words, marriage is an established system for sex where one part uses to avoid slander (fitnah) and the other side used it as the legalization for reproduction as much as they want, and off course get good agreement to acquire pleasure within the bounds of Islam (Saadawi, 2001:281). Based on the Al-Ghazali an Arabian philosopher statement in Nawal's book, besides for reproduction, the purpose marital is immunity against demons, break the sharp tip of the desire, distance from danger of lust, keep our eye from what who supposed not to be seen, protect male sexual organ, as well as follow the advice our prophet (Saadawi, 2001:276). But this institution is still different for men and women, especially dealing with their rights and obligations not only inside in their house hold but also in their society. In their household activities, wife only concern about their domestic business. Their main job only raising their children, cleaning their house and satisfying their husband in bed. They do not allowed to care about what happened outside their area. Marriage makes men's heart free from household and clean their house, so they can concern to their job, religion and science in other word, they can concern in developing themselves. Al-Ghazali states in Saadawi's book "In fact, your wife let you to work on the final day and she concern about your house and relieve your lust" (Saadawi, 2001:284). Therefore, a man is seen not able to devote themself in science development and religion unless they have a wife that can handle their household. ARABIC SOCIETY Arabic culture is male centered. Males dominate most cultural, political and social institutions. This has a direct impact on the cultural status of women in both Arabic and Islamic countries. While Islam emphasizes the equality of men and women, Arabic culture minimizes it. A Jewish Arab in Morocco or a Christian Arab in Syria adheres to the same system and thus would have the same views on the role and status of women. The socially-rooted conceptualizations of differences in women's and men's sexualities and their biological nature are so frequently evoked to the extent that they become part and parcel of the individual and collective consciousness. In this regard, the "natural role" of women is one of the most deeply rooted interventions at the conscious and unconscious levels. Consequently, women's fulfillment of their "natural role" associated with the reproductive process becomes compulsory and coercive. In the end, this leads to women's lives becoming regulated through the sharia, constitutions, laws, and predominant social norms, in ways that far exceed what applies to men. In Arab societies, women's status is mainly defined by their roles as mothers and wives. Their main job only concern about raising children, cleaning their house and also serve their husband (Saadawi, 2001:285). Different from the husband's position as head of the family, they are taking control over their families, so that the actual duty as a husband in this culture region is to control and supervise the family and finally it position woman in second position after their husband. Women could not make decisions based on their own beliefs, and had little control over their marriages. Society create that the noble obligation for a wife to completely obedient to their husband, they cannot be different, no asking a question or refused their orders, (Saadawi, 2001:286). In other words, there is no independent decision for women. Their freedom is limited or moreover it is deleted because the ideal women in this society is a woman who can follow her husband without complaining about anything. Essentially. So, it can be conclude women were slaves to men and made no decisions on anything, whether it be something that directly impacted them or not. LOVE AND SEX IN ARABIC SOCIETY The strong influence of the cultural background of the Arab and Islamic values which strongly stuck in Arabic life makes this nation see love and sex as something taboo and full of mystery. In this region, woman take crucial part in this ritual. As the legacy from cultural background and also religion values the Arabic seen women without exception as cause of fitnah (fornication). Arab woman adorned with temptation and fitnah. Where in this sense they become part of the spirit of Islam, which force women into sexual temptation in the community who bring libel. In this case is related to a conspiracy libel, resistance, which interfere with any order that has been built by the gods. So, they are very closely related to sex and sin (Saadawi, 2001:273). Men on the other hand, though had great sex appetite, not accused of sin unless driven by temptation and seduction of women. The power of the male sex being a part of the soul of the Arabs and its soul is connected with virility (Saadawi, 2001:294). Thus, man is ordered to marry in order to defeat the evil and the woman temptation. Despite the desire of sex are owned by both parties, but in fact women in this region bear all the restraints. Man sexuality is connected with virility different with women sexuality which their sex connected with sins and devil. So, it will be ashamed if men in this region have a problem in their sexuality that is impotent and the only one who can know this, is woman. But the solution taken upon of these problem were quite surprisingly. As quoted in Saadawi's book "Virgins were not permitted to know far about sex, while a widow who already have experience from her previous marriage definitely can recognize this weakness. That is why they give "Lower" for their label" (Saadawi, 2001:295). These restraints were taken up in order to protect men from women so they cannot drop them. Women must keep their virginity by their own self. A woman who lost her virginity before marriage will be confuse and fear of family rejection both from family or society, but men who come save her will be seen as a hero and respectful (Mernissi, 1999:86). In a marriage, blood of virginity is very important. In the first night after their marriage, commonly they will use white sheet in order to see virginity blood and this blood is an evidence of chastity and honor of family (Saadawi, 2001: 295). Contrary with men who cannot be identified their virginity from their physical and the limitation of the girls knowledge about sex, it makes them do not have any burden even they already ever had sex out of the marriage. So it can be said that Arabic society were more tolerate to men in their sexuality rather than women. Beside virginity blood, the other blood which is very crucial for Arabian society is menstruation "haid". In Islam haidseen as a dirt. In an authoritative Arab dictionary named Lisa Al'-Arab menstruation mean al- khubts (Viciousness combined with cruelty), al-makr (the desire to destroy been prepared with despicable). Menstruation for women is related with their sexuality. They are seen ready for their sexuality when they already in this period. So, when they arrive in this period, in Arabian culture means that their temptation was completed. And based on Surah above women in this period time were seen as the impurity women. PATRIARCHY IN TALIBAN When the Taliban took control of Afghanistan in 1996, the status of women declined rapidly until women were completely confined to home, or only allowed to leave home with a male escort while wearing a burqa. If a woman seen outside without being covered from head to toe, even if only a little skin was exposed, she would be beaten. These rules complicated things completely for women who no longer have a living male relative, or women who are too poor to be able to purchase a burqa.The other extreme rules confining women during Taliban are, the window in homes to be painted to prevent others from viewing women from the outside, women must not laugh, talk loudly, or make any noise at all when in public. All of these rules among others made women prisoners in their own homes, unable to go anywhere or do anything without being under the watch of man. Based on the explanation above, it can be conclude that there is a disproportion of rights in this sexes. The sense of patriarchy is definitely appear in regime. Taliban imposed straight rules for women or it is also can be said they tend to jail women., limited their access, hide them from worldwide and also do whatever they want to women. According to Millet, patriarchy's chief institution is family, where patriarchal ideology well maintained traditionally and modern. As the smallest unit, family contribute in strengthening this ideology (Millet, 1970:33). Encourage every family members to think and behave in accordance with the rules of the community who embraced the patriarchy. In this institution, commonly this ideology will be It will be taught into two categorize, that is how girl's role and boy's role. They will learn character, role and status between wife and husband and also father and mother. According to Millet, patriarchal ideology socialized into three categories. First, temperament involves the formation of human personality along stereotyped line of sex category ("masculine" and feminine), based on the needs and values of the dominant group and dictated by what its members cherish an themselves and find convenient in subordinates: aggression, intelligence, force, and efficacy in the male: passivity, ignorance, docility, "virtue" and ineffectuality in the female. This is complemented by a second factor, sex role, which decrees a consonant and highly elaborate code of conduct, gesture and attitude for each sex. In terms of activity, sex role assigns domestic service and attendance upon infants to the female, the rest of human achievement interest and ambition to the male (Millet 1970:26). Patriarchal ideology is very difficult to remove from this society because they still maintain it. Stereotypes attached to women as domestic workers made him weak because they did not get money from their work to take care of the household. Domestic work is taken for granted and it was her duty as a woman. She does not need to earn money from their work and the result she always dependent on her husband. Millet stated that patriarchal ideology cannot be torn down because women are economically dependent on men. Dependence that occurs throughout life. Conventionally men are the main source of income in the family while the woman is the housekeeper. Men worked outside for their economy and women living at home to do all the housework. Women are not allowed to make money, because men make it as property when they got married (Millet, 1970: 40). In a patriarchal system, men have full power to women so that they can do whatever it wants with his wife. Women economically dependent on her husband because they did not earn his money out of pain. According to De Beauvoir, regarded as a slave wife, while the husband is her master. This can lead to the occurrence of domestic violence (Beauvoir, 1989: xv). FIRST WAVE FEMINISM Feminist theory addresses two fundamental differences in the view of women and men. Expression of male-female differences in the biological aspects of the show as the essence of natural, innate. While expression masculine feminine is psychological and cultural aspects of difference (Megawangi, 2004: 184). Si mon de Beauvoir stated that in a patriarchal society, women are placed as the "Other", as second-class human beings, lower by nature (Selden, 1985: 137). Position as the "Other" affect all forms of social and cultural existence of women (Cavallaro, 2001: 202). Patriarchal society using a certain fact about the physiology of women and men as a basis to build a series of identity and masculine and feminine behaviors are enacted to empower men on one side and women on the other weakens. Patriarchal society convince themself that the construction of culture is "natural" and therefore "normality" depends on one's ability to demonstrate gender identity and behavior. This behavior is culturally associated with one's biological sex. Patriarchal society uses rigid gender roles to ensure women remain passive (loving, obedient, responsive to sympathy and approval, cheerful, kind, friendly) and men remain active (strong, aggressive, inquisitive, ambitious, full of plans, responsible, original, and competitive) Meanwhile, according to Millet, patriarchal ideology in academia, religious institutions, and family justify and affirm the subordination of women to men who lead for most women to internalize self to men (Millet, 1970:26). One way to understand the various dimensions of feminist theories and their theoretical approaches to understand patriarchy is to locate them within the broader philosophical and political perspectives that have been broadly classified as first, second and third feminism movement. This theory were categorize in three waves according to its concern about. First wave is concern about equality, second wave concern about the commitment of diversity, and third wave concern in diversity in specific normative. However, there are some ideological differences among the feminist groups, they are united in struggle against women inequality and hierarchical relationship between women and men. To be more focused on equality of women phenomenon, the first wave of this movement thought as the appropriate approach in analyzing this issue. The first wave of feminism took place in the late 19th and early 20th centuries, emerging out of an environment of urban industrialism and liberal, social politics. The goal of this wave was to open up opportunities for women, with a focus on suffrage.The feminist in this movement assumes that there is basically no difference between men and women. Therefore, women should have the same rights as men. Nevertheless, liberal feminists reject the overall equation between men and women. In some cases remain distinction (distinction) between men and women. However, the function of the female reproductive organs logical consequences in social life (Ratna Megawangi, 1999: 228). Mary Wollstonecraft is one of the pioneer for this movement. In her book Vindication of the Rights of Woman (1792) she talked about her life and personal significance as an icon of the women's movement. Wollstonecraft's was the first to issue an outspoken rallying cry to middle-classwomen, especially mothers, as major influences on society (Gamble, 2001:15). Her emphasis was on the need to make women rational. Far from portraying women as superior to men, Wollstonecraft wanted to raise their overall moral and intellectual stature to make them into more rational citizens. For the most part, she did not envisage their leaving the domesticsphere, nor did she ask for anything as radical as the vote. Even she accepted that women in middle-class would marry and remain at home, but she want every girls get same education as a purpose for their freedom and dignity rather than the ability to fascinate potential husband (Gamble, 2001:16). Not only Wollstonecraft who does not agree with this disproportion. Rosemarie Putnam Tong in her books "Feminist-Though: A More Comprehensive Introduction" imply that there is a restriction of women's activity and it cause they lack of power and knowledge so that they cannot develop themselves. DOMINATION REPRESENTED IN NOVEL The Arabian world are very thick by the influence of their culture either before or after Islam. Where both are directly or indirectly gave a special position for men rather than women. If the granting of this position was originally intended to separate human's daily task, but in fact this positioning has grown to become a leader and the led. Develop as the domination of one side to the other sides. Through this novel, this domination will be exposed as a reflection of the real condition in the country inside this novel. In this region Patriarchy ideology has been used as root for society structural in this region. This ideology still maintained in this modern era, make this ideology quite difficult to be changed or removed (Millet, 1970:40). Since their a little, boys and girl were already given an example by their parents behave, and when their already in their puberty time, they were thought how man and woman behave, and unconsciously differentiate them in two different position. As an example in this passage, 'When I got engaged, I knew nothing of men. Nothing of married life. I knew only my Parents. And what an example! All my dad cared about were his quails, his fighting quails! I often saw him kissing those quail but never my mother, nor us, his children. There were seven of us. Seven girls starved of affection (Rahimi, 2010:57). In this passage can be criticize that family is chief institution for this ideology to get developed. Family has huge contribution in strengthening this ideology. According to this passage, her family was the only example for her to understand about how is marriage life. Her father only care about his quails and never the girls and also her mother, but she never saw her mother complain about it. Made this situation seems normal and that how it was supposed to. Wife should not disturb her husband, especially complaining about what they do. Because wife's job only concern about their household and fulfill husband's satisfaction (Millet, 1970:40). Concerning about husband satisfaction, letting him do what they want to do can also meant as an effort in satisfying her husband and women is this family was supposed to be quite and submissively. In this group, women are defined as something odd, deviate from a prototype of human's body, physically passive and contain of emotional, different with man's body who have active and ably mind result a conclusion that women considered as a carrier for men's seed, so the real creator is the men (Millet, 1970:54) As what the author had been explained above, men is leader for women because God create them a little bit more than women, so they should follow their command. (Back to the passage 'Look, I breathe just like you! (Rahimi, 2008:7), and also in the passage "You know that I live only for you, at your side, by your breath" (Rahimi, 2010:9). Through those passage, women should follow their husband in every way. They led them in every case, metaphor with "breath" which can be meant that women should follow them in every way, and bow down to their rule (HR. Tirmidzi verse. 1159). Women must following the rhythm of their husband breath, walk inside their shadow, and hide behind their shoulders. It is also mean that men are take control of women's life. Mean have a charge to change the rhythm to their breath or even stop it when they want it, it is all their right, and women should follow them. No asking and complaining as can be seen in this part 'I hope you are able to think, to hear, to see…to see, and hear me…' (Rahimi, 2010: 52). This part can be used as a reflection that women in this society do not have a voice to deliver their feeling, never have a chance to be thought, and seen as the important subject. Those description can be used as the early indication about how men dominate women's life in this region especially in their marital section. Human in this region separated into two different world, women's world and men's world. As the author already said, men have their special world as a heritage from their culture and also their religion. Men in this regime do not have any straight boundaries. Start from how their outfit and also how they behave. Different with women which have to concern about what they do, and how they do it. Man created a little bit more. It can be seen with their muscle, where muscle is related with physically power, and finally spread in many aspect. In other hand, women who are created without muscle are directly related to the weakness and finally prison them in domestic job. The differences of their body led different attitude towards both. Women in this society who does not penis considered less than man is seen as the embracing one. Penis who located in outside seen as sign of autonomy and power, while women's genital are putted inside and hide (Beauvoir, 1989:18). As an example in this novel 'I was a piece of meat, into which you could stuff your dirty dick. (Rahimi, 2010:112). According to this passage penetrate woman also can be meant show their authority and power while woman only used as a bowl to put this power. According those explanation, women in this ideology were putted in inferior position which mean that they only putted in second class. Their existence indirectly eliminated in this regime. In order to keep maintain this existence patriarchy ideology woman only have one conditional, that is companied by her mahram, or husband (Beauvoir, 1989; 225). Patriarchal society provide scary threat for women who is living without men beside her. As can be seen in the page 17 in this novel, 'And you leaving him in this state? What about his children? And me? You can't, you can't, you've no right to leave us like this, without a man!' (Rahimi, 2010:17). In this passage, wife feels afraid if her husband died and let her alone. It is because she will be left alone, not only by her husband but also because of the society and her family. Hence, they should get married. Women in this ideology does not allowed to choose their husband. As can be seen in this monologue before her marriage, her mother-in-law came to her house and asked her to married her son (Rahimi, 2010:53). According this passage, women in this region do not have any right to choose their husband. Her father or family never asked about her opinion or her criteria about her ideal man, and accepted without slightest hesitation. In contrary, men can choose which one they want to get married. Married in this region also can be criticized as a transaction. They used Maharas a tool in this transaction, (Saadawi, 2001: 283) a transaction between abolishing family anxiety because of their virgin daughter and find the legality of fulfillment of lust. But if be observed further marriage can be said as announcement for their leadership, and independence for a man, different with the women. As the consequence, a virgin who agree to get married must throw their freedom and get ready of any rules that had been made by her husband. When a man had married they have a freedom in sexual intercourse that just being a story when they were teenagers. They also allowed to set up a small country named family that ultimately gave them a power. And women, unconsciously walk into a trap which restrictive their freedom as seen in this part, 'Three years! For three years I wasn't allowed to see my friend, or my family…It wasn't allowed to see my friends, or my family…it was considered proper for a young married virgin to spend time with other married women. Such rubbish! (Rahimi, 2010: 54). This passage can reflect the exile from the association in women side, different with man which does not any significance differences, or limitation of their association. Seems like marriage is also a way for them develop themselves about science and knowledge, as an example is a war. Commonly when a women marry because of arranged marriage, usually their marriage are not based on love. For woman in this ideology love is not always about feelings, but also about the commitment throughout body and soul unconditionally (Beauvoir, 1989:526). In fact love is very important for a woman, they can sacrifice anything while she did not realize that this feeling can make her suffering. Love can be illustrated as an essence of sexual oppression for women, because men can used it as cultural power to dominate women (firestone, 1972:121). As an example, when wife decided to accept her mother-in-law proposed "Who were you, really? No one knew. To all of us, you were just a title: the Hero! And like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen- years-old girl. (Rahimi, 2010:54). She directly falling in love with someone that she never known before. The reason was because of he was a hero, and it was a lovely thing married with a hero. But in fact, this love unconsciously made her sacrifice her freedom, and prepare to be a slave for her husband. He use her love to satisfy her lust, to bear their child and to clean and prepare for their meal. Love beat the rational thought of women, it was realize that the bride got married without her groom presence, 'At the ceremony, you were present in the form a photo, and that wretched khanjar, which they put next to me in place of you' (Rahimi, 2010:54). In this snippet of her monologue can be interpret the importance of man in women life. Even they have to marry with a strange men, whom only known from his photograph. This stage of live can be said as the place where patriarchy is definitely felt by women. Men have huge chance in developing their self because the already have wife who will concern about the domestic job (Ghazali,IhyaUlum ad-Din, 1964:699). As reflected in this passage 'Did you think about us for even a second, when you shouldered that fucking Kalashnikov? You son of a…'.the word suppressed again. (Rahimi, 2010:14). This passage can reflect that husband only concern about his struggle toward his enemy. Totally concern about his war, without understand his family. He throw domestic responsibility to his wife, and use her natural fate as his justification. Women should run in her roles as a wife who must serve their husband, bear a child, and satisfied her husband in their bed. This ideology see everything including about women with the male point of view (Beauvoir, 1989:xx). By using men likeness or dislike, patriarchy ideology make rule and prison them under men feet. As can be seen in this passage, It was not considered proper for a young married virgin to spend time with other married women, (Rahimi, 2010:54). Based on the passage above, woman could not see her friend or more is gossiping about many thing. Gossiping is not allowed in Taliban regime, because they see it as something useful. But if it see deeper, they are not allowed to see their friend especially among marriage woman because they afraid of being betrayed. Men never directly deliver this fears, they hide it hereditary. That is why they used this banning as law in their family. They use women's fear to control their behavior. And women who hereditary not rewarded by any right against her husband, do not have any effort except silent and following their command. Beside become the follower for the men, this region also put woman as place for bearing a child. This society make that women should birth a child, because it is their natural faith, and with that you will be the perfect women. So, it will be a huge problem if woman is infertile, they will be seen as imperfect or unideal woman because she cannot fulfill her nature destiny as a mother, she face divorce threat, and get low view from her society. As can be seen in aunt character. She got divorce because she cannot bear a child, and finally get exiled by her family. Society unilaterally blame her without care with her feeling and sadness because she cannot perfect as a woman. Different in man sides. If woman have their infertile problem, man will feel ashamed if he is impotence. But through this novel, it is not a big deal for men because the society seems like protect them for their weakness. In this novel there is a big secret that had been hidden since their marriage, the secret that only known by wife and her mother in–law. Start from her mother in-law unilateral decision that she was barren, 'Your mother had decided I was barren, and kept hassling me all the time' (Rahimi, 2010:65). From this part it can be used as an identification that in this region woman is the most important part in bearing a child, without care that woman also need man so they can bear a child. They blame all in woman shoulder, and try to find a solution as an interest of a descendant. And polygamy is the able solution for this case. Polygamy is allowed by the religion and of course make man have a big smile because of this policy. As reflected in the passage 'Your mother was dying to see you to take a second wife' (Rahmi, 2010:66). Based on this monologue, her mother in-law only concern about the real function of woman as a child bearing rather than a human. However unexpected situation came up and reveal that her husband is the infertile one. 'Because that child was not yours!' She falls silent, impatient to see her man finally crack. (Rahimi, 2010:131), 'Yes my sang-e sabur, those two girls are not yours! 'She sits up. 'And do you know why? Because you were the infertile one. Not me!' (Rahimi, 2010:132). The fact is, now they have two beautiful daughters and they are their real parent. Nobody know the secret except those women. Seems like everything was fine, and they can fulfill their natural fate. But if it is seen deeper, they create this scenario in order to keep save a husband. After her mother in-law knew that hers son is the weakness son, she did something that is contrary with her religion. She sent her to a Hakim, a kind of shaman until she is going to pregnant, as reflected in this passage 'She spent a lot of cash that day, I can tell you. And then I visited the Hakim several times, until I feel pregnant. As if by magic! But you know what, that Hakim was just my aunt's pimp. He mated me with a guy they had blindfolded '(Rahimi, 2010:132). The mother-in-law was willing to do anything for saving her son from bad view of social groups even she have to turn aside from her religion. In contrary with wife's aunt, because she is the infertile one, her family never look for a solution to save her, but they directly throw her from her family and forget about her. From those example can be criticize that society give a huge tolerant for men, gave more privilege to be understanding for their weakness. Hereditary it is done by the society. Give men some privilege either it is openly such as polygamy or closely by protecting their weakness. By sacrificing women's feeling. This condition finally raised women's anxiety for her husband satisfaction. According to this passage 'Although it often seemed to me that you weren't satisfied. And then I would guilty. I told myself that it was my fault, that I didn't know how to do it right. (Rahimi, 2010:105). According to this passage, wife feels guilty because of she believe that she cannot satisfied her husband. It was her fault because she believe that it was her duty as a field for her husband. Lacking of sexual knowledge make her blame herself (Saadawi, 2001:295). But after have several sexual intercourse she realize that it was her husband weakness, 'After a year, I discovered that actually, it was all coming from you, you gave nothing. Nothing' (Rahimi, 2010:105). Now he can find her husband weakness, but because of her position as woman which is does not have any voice, make her only keep inside her mouth. In sexual intercourse, although it was done by two subjects but in fact man is taking control for any movement or position in this intercourse. It because man is a leader for woman according to the religion. State by Al-Hasan an Islamic scholar in Saadawi's book state that man does not allowed to fulfill his woman command because he will throw into hell in the judgment day (Saadawi, 2001:286).In this monologue "If I'd asked all that to you…my God! I'd have got a broken nose! And yet it's not difficult…you just have to listen to your body. But you never listened to it (Rahimi, 2010:111). A woman can't make a favor though is aimed for their satisfaction. Women only follow the men, but in the end blame themselves if the husband feel unsatisfied in this intercourse. If in their personal intercourse, women must keep silent how about their daily live. Monologue above can used as the example that women in this region are completely silent. They feel afraid because they will get a punishment because of their favor. Men are allowed to beat their wife after they do advise and forsake them from bed. But in fact, for any reason that make her husband angry, he will directly beat them. As an example in this monologue, 'He beat up my mother, my sister and me, because we hadn't kept watch over his quail' (Rahimi, 2010:60). Her father beat them without clear reason. Because of he cannot find his quail make him angry and find an impingement. It is can be seen that his father forget about several steps before beating her wife, he only see "beat" word which is mean it was legally done by any chance. From those example above women in this region had already knew that marriage is not always beautiful like what they thought. But because of they live in patriarchy circle which put men as the central part make women in this region, completely need men. It would really frighten for a woman living without a man beside her, although it was just a name. In this novel wife only live with her husband name for three years, she must deal with her husband absence as a consequence having a hero husband. But it is fine for her, because she now has a man beside her, have somebody who is believed as her guardian, give her a distance as an accusation of temptation carrier. But when the husband back in a dying state and his wife, are required to maintain him, she still afraid of her society view, especially threat of widowed. In her monologue she stated 'She stands up. 'Even injured, you've been spared suffering' (Rahimi, 2010: 21). It can interpret even her husband lay down, suffering because of the shot, he never feel suffer because all of social cruelty come to her. She is afraid if her husband died brother in-law will come and harassing her. Afraid for become a widow and get exiled from her family. In other words it can be inferred that marriage is very important for a woman in compare man. Without marriage, which also mean that there is no man beside her, woman cannot retain their existence as part of their society. Excommunicated by the negative view about woman that hereditary this society inherited either from their religion and cultural background. Without marriage they will be seen as a devil with the temptation inside it. The devil who can bring trouble for their family and society. Always seen as the imperfect creature, which full of dirt and irrational emotion. CONFESSION WITHOUT BORDERS AGAINST DISPROPORTION Essentially, gender differences are not a problem as long as this difference create discriminative for one sides. There is a significance differences of the rights between women and men in this patriarchal world. Men are placed as the central, leader, and finally named as "The self"' while women who is seen physically weakness later differentiate as "the other" (Selden, 1985:137). As can be seen in this quotation, "There were seven of us. Seven girls starved of affection" (Rahimi, 2010:57). In this quotation, this girls feel starving of affection, although they have complete family. By using Selden's quotation above, seven of them feels less of affection because they do not get a figure of a father, in other hand their father only concern about his quail, and love it more than his family. This cold attitude can be seen as a disappointed feeling because they do not have a son, a son that can be a symbol of power, and heir his leadership. In other word, he see women as the unimportant one. As a formed of this disappointed, he use a quail. A quail is better than women, at least his quail can won and be a subject that he can proud of. In this regime, women in this region is not more meaningful rather than a display, 'She is still laughing. 'That story is so true. "You men! As soon have you have guns, you forget your women." (Rahimi, 2010:57), same like the theory about "women as the other". According this quotation, women are alienate with inanimate object or this inanimate is more prestigious than a women. When she speak about it she is laughing, this laugh can be seen as an expression that she has same level with that thing. But she cannot do anything against this attitude, except smile as her laugh at her sex bad destiny. Since in childhood she always alienate with inanimate, either with quail or a gun the positioning of women as "the other" has been tough since their childhood (Nunuk, 2004:76), so that they will adapt and unconsciously get usual with this called. According this situation it also can be imply that Family played a major role in this believed (Millet, 1970:26), parents become main teacher of this situation, especially mother who is seen as the real example for her daughter. In this region, where women performed as en-soi(Being-in-itself), while men performed as pour-soi(Being-for-itself) (Tong, 1998:181) will attempt to free from men's pressure. This is how was the normal human will struggle when they were in huge pressure. 'At that time, I was only ten …no…'She thinks about it. 'Yes, ten years old. I was scared. Scared that I too would become the stakes of a bet. So, do you know what I did with the quail?' She pauses a moment. It is unclear whether this is to make her story more exciting, or because she is afraid to reveal the next part (Rahimi, 2010:59).She was afraid, a quail is a danger for her. If it was lose, she will sent to live with a man like what happened with her sister. So, she will do anything to eliminate this danger. According this passage, there is a power inside this women's silence. She eliminate the quail to keep save, hope that by killed that bird she will not be used as bet. Using theory from Sartre, when there is a subject trying to free itself from the other, there is another subject who want to enslave it (Sartre, 1956:362). When her father trying to enslave her by using her as a bet, or beat her when he lose he find a way to free from him, that is by killed his bird. Started from this step, she finds a way to still save. And when she had enough to marry, she choose it as a solution for her to free from his father, but in fact after she got married, her husband enslave her. He put her as place to fulfill his sexual and also rearing a child. In other word it can be conclude that marriage is not a place to get a freedom, it is a form of slavery (Beauvoir, 1989:500). It is ultimately wrong if this society put women as the weak and fool creature only by using the weakness of their body. Because of they do not have a muscle and penis which always as a form of power because it penetrate women, does not mean that they are fool (Beauvoir, 1989:41). It is not enough use their body as the reason to put them as the inferior one. In those quotation we can see how women ability in order to protect themselves and the people she loves. She was lying, but it is work. She did keep her husband alive from the other shoot which directly kill him. She use her brain, her ability, her experience, and also the society norm to fight back. So it can be conclude that woman is not the other because of their lack of penis, but because of their lack of power,( Beauvoir, 1989:55), or it is also can be said that they were not allowed to get this power. In other word, if women put in same position with men, they would develop the same character (Wollstonecraft, 1975:23). But because of this society hereditary thought that women is lower than men, makes them deny their ability, which finally force them to keep silence, and killed their self-development. From this confession, she hide the fact, she did not want people to know about this, because she would be seen as a demon. So she kept silence, keep hide her power but indirectly she still use it to save her. But unconsciously she confess to her husband while he was lying powerless. Make her afraid if her husband hear it and finally beat her without understanding what will happened to her if this quail still alive. So it can conclude, because of this society treatment, who only blame women and hereditary this sex with the foulness of Eve (Saadawi, 2001: 278), they must hide it. Even use these weapons are not because they want to fight against their husband, but they use it in order to keep them save. Psychology and biological differences in the most contribute aspect in this disproportion. Men with their sperm give a life for the wife with their egg inside (Beauvoir, 1974:24), so it can be conclude that women is place while men is the real creature. CONCLUSION Live in patriarchy circle, make this women cannot do anything they want. As had been explain by the Beauvoir, women in this circle putted as passive, and submissive. Because of they are the weakness they need the superiority one to keep them as a part of this society. In other word, they need marriage to keep save inside this circle. In this region marriage can be seen as turning point that bestows prestige, recognition, and societal approval on both partners, particularly the bride. It also can be said as a social and economic contract between two families. But in other hand, marriage in this region is a new beginning of slavery that will happened to women. They have to sacrifice their freedom and concern about their household, but for men side marriage is a declaration for their leadership. And finally make them can be more focus in their self-development. Marriage is a form of slavery in all aspect related to women's body and sexuality including blood inside them. This research reveal the importance of virginity blood that is so important for women as its used as a proved that they can keep their dignity, and it is also make them as the ideal women that deserve to be married, contrary with menstruation blood which drop them in the lowest point as a women. It is happened because this society see menstruation blood as a dirt according by their holly book in verse 2:222. This research also reveal the differences treatment between a virgin and a widow. By using Saadawi's statement, based on the knowledge, this society limited virgin knowledge about sexuality, and widow is putted in bottom position as seen as the embracing one. This effort is taken as a way to protect men from their virility problem. So, it can be conclude that this society is more tolerant to men rather than to women. The Second statement of problem is the confession of women voiced by wife character in this novel. She reveal the real condition caused by the pressure that the society gave to her sex. Inside this confession, she deliver the disproportion that she gave in order to save her husband. As had been explained by Putnam Tong, this confession explicitly imply that she was created inside a men (en-soi), hide inside their body and shadow while men was created for their own self (pour-soi). This society believed that it was a natural faith that women must sacrifice themselves, and also follow what the leader had been said. But even it was already thought as their norm since their childhood, by using her confession this research reveal that they do not accept it totally. By using her husband dying body confess all her depress and her disappointed to her world. According her monologue, there are senses of hatred, insult, and harassment that happened to this woman, that make her angry and hate them. But because of the society will gave worse punishment to the women who against her husband who also seen as the rebellion, she only keep silence, but inside this silence she struggling by using her innocence, sexual and temptation . But this struggling is more to protect herself rather than fight back to her husband. Finally this confession make her realize what happened to her, how her society was being unfair to her. The accumulation of these unfair treatment make finally fight back and finally kill her husband by a Khanjar. REFERENCES Abrams, Meyer. H. 1971. The Mirror and The Lamp: Romantic Theory and The Critical Tradition. London: Oxford University Press. Rahimi, Atiq. 2010. The Patient Stone. London: Chatto&Windus.New Burke, Edmund. 1999. The social History of the Modern Middle East. Colorado:Westview Press. Millet, Kate. 1970. Sexual Politics, New York: Doubleday. Beauvoir, De. 1989. The Second Sex. New York: Vintage Books Shulamith, Firestone. 1972. The dialectic of sex, the case for feminist revolution. USA: William Morrow and company Inc. Gamble, Sarah. 2006. The Routlege Companion to Feminism and Post Feminism. New York. Routlege. Saadawi, El-Nawal. 2001. PerempuanDalamBudayaPatriarki. Yogyakarta: PustakaBelajar Mernissi, Fatima. 1999. PemberontakanWanita: PeranIntelektualKaumWanitaDalamSejarah Muslim. Yogyakarta: Mizan. Gorsky, Susan Robinov. 1992. Feminity to Feminism: Women and Literature in the Nineteenth Century, New York: Twayne Publisher. Tong, Putnam. 1998. Feminist Thought: A more Comprehensive Introduction. Colorado: Westview Press. Sumbulah, Umi. 2008. Spektrum Gender, KilasanInsklusi Gender di PerguruanTinggi. Malang: UIN. ARTICLE SOURCE MARRIAGE IN THE ARAB WORLD by Hoda Rashad, Magued Osman, and FarzanehRoudi-Fahimi INTERNET SOURCES www.mtholyoke.edu/-macne. www.Astyariah.com/godaan-dunia-dan-wanita.html.

Abstrak Patriarkiadalah salah satumasalahbesar bagisetiapwanita di dunia, masalah iniakhirnyadiwakilidengankarya sastra, dansalah satunya adalahAtiqRahimiBatuKesabaran.Terdapat Perempuan, sebagai karakter utamadiceritakandengan semuakesedihan, menikahdengan dipaksa, menikahdengan foto, sampai diaharus membuathamil dengantanpajalan dandia memilikibayi daripria laindia tidak pernahtahu. Berdasarkanfakta-fakta, ini memberikan dua pertanyaanutama sebagairespondarimasalah, adalah(1) GambaranbelenggupatriarkimelaluisuaradiamPerempuandiAtiqRahimiBatuKesabaran?(2) DampaksuaradiamPerempuandiAtiqRahimi, BatuKesabaran?Untuk mengatasi hal itudengan analisis, membutuhkanmetode yangmembaca, mengumpulkan data, dan interpretasi, teknik yang digunakanadalahinterpretasi, dan pendekatanmimesis. Sebagaihasil dariini, itu akanmenemukan sesuatu, suaradiamPerempuan, dan initerjadidi Afghanistan, oleh karena itu,dapat dikatakanbahwa sistempatriarkibisa mengambilhak-hak perempuan, dan apahal-hal yangdapat memberikanPerempuanadalahsuaradiam,suarayang dapat menjadigerakan feminisuntuk setiapsimpatiuntuknya. Ini mewakili, untukberkatadalam bisikanyang sangathalus yangmasih adaketimpanganyang disebabkan olehpatriarki, danWanitatidak dapatberbuat apa-apa. Kata Kunci: Patriarki, perempuan, suaradiam, danfeminisme. Abstract Patriarchy is one of the great problem for every women in the world, this problem finally is represented to a literary work, and one of it is AtiqRahimi'sThe Patience Stone. There, the Woman, as the main character is told with all sorrow, marrying by being forced, marrying with a photo, until she has to make pregnant with regardless the way and she has baby from another guy she never knows. Based on the facts, it delivers two main questions as the response of problems, they are (1) Depiction of patriarchy's handcuffthrough the Woman's Silent Voicein AtiqRahimi'sThe Patience Stone? (2) The impact ofthe Woman's Silent Voice in AtiqRahimi'sThe Patience Stone? To solve it by analysis, it requires a method that is reading, collecting data, and interpretation, the used technique is interpretation, and the approach is mimesis. As the result of this, it will find something, the silent voice of the Woman, and this is happen in Afghanistan, therefore, it can be said that patriarchy system can grab the rights of women, and what things that the Woman can deliver is the silent voice, the voice that can be a feminist movement for every sympathy to it. It represents, it says in very smooth whispers that there are still inequality caused by patriarchy, and the Woman cannot do anything. Keywords: Patriarchy, women, silent voice, and feminism. INTRODUCTION Human lives in the world are like corrosion on the ply of metal in the process of abrasion. What the core of this analogy is the way human wear their brain shell to think and find the solution of every problem they face to. Human are divided in to two genders normally, they are men and women. Men, a creature whose penis sticks strongly with dignity and power to dig every hole in front of it. Women, a creature whose vagina decorates beautifully with softness and warmness for everything that prepares for digging it. Based on the differences of the two, the conflicts arise. It starts when women begin realizing that what they think is their right, is grabbed by the creature, called men. In addition, this thought probably can be supposed as the basic thought of feminism movement. Before going further to the meant feminism, it is important to see what feminism fights to, and it is patriarchy system. Patriarchy system is a system that has been rooted in society generally. Erich From asserts that Patriarchy system is where men is fated to dictate/control women, and it rules to all part in the world. (Fromm, 2002: 177). To add it, to make the establishment of this system of men, chronologically there are some experts that give distance between men and women where men are supposed to be the better one. Classically, women are inequality creature, and it is added by Aristotle who views women as an imperfectness of nature (Beauvoir, 2003:ix). Francis Bacon comments that the more negative assertion that women are the jail of men because women give bad effect or influence to men (Arivia, 2002:40). Kant even says that women does not have any ability to use their cognitive ability therefore women should not be allowed to deliver what they think (Arivia, 2002:40). While, St. Thomas supposes women as "imperfect men", women are creature who are created not deliberately, and it is proven by the symbolic story where Eve is portrayed by Bossuet as a creature who is made of the "Adam's Rib" (Beauvoir, 2003:xi). According to Cixous, the term of men and women pinpoints to the difference of the two where the first term must posit the higher or better meaning, and it is placed by men. Therefore, men are self and women are the Liyan. Women live in men's world, therefore women are considered as the Liyan for men. (Tong, 2009: 292). Based on those facts, society finally construct a system where men dominate the whole contents of social life. J. Douglas (1976: 34) adds that many feminists use the term patriarchy as a generic term for male privilege, supremacy, and domination, referring to their current as well as past forms. The attraction of this usage is readily apparent: first, its rhetorical punch and strongly pejorative connotations; second, its reminder of the tenacity and continuity of male domination. Despite earth-shaking social changes, not the least of which are the women's Movements of the nineteenth and twentieth century, male power remains. Therefore, what the things that can be inferred into these facts are the problems between men and women. Feminism moves to throw everything that involves in men's domination because they dictate women, women seem to live in a coop. It means that what women fight is the system of men. In general, feminism is the theory of women's liberation since the intrinsic in all its approaches is the belief that women suffer injustice because of women's sex (Humm, 1989: 74). From the inequality that exists between both gender, women want to search equality in the society, they start to speak up their voices in the publicarena. Women themselves must articulate who they are and what role they play in the society. Most importantly, they must reject the patriarchal assumption that women are inferior to men. This started the feminist movement. It was started by the reality that male-female relations is a form of power structure in which men dominate women (Thebaud, 1994: 290). From this starting point the feminist believe that existing inequalities between dominant and marginalized groups can and should be removed. In the practive the feminist scholars attempt to examine beliefs and practices from the viewpoint of the "other", in this case women, treating them as subjects, not merely objects. Based on those views, it can be said that feminism simply is a thought that focuses on the equality between men and women, especially to talk about the rights of women. Therefore, what things that can be put into the main topic of this, is the all things relates to the inequality between men and women where men are supposed to be the superiority ones. Feminism itself is part of cultural studies in literature, which arises since women feel discredited and being treated unequal to men as human. Yet, what is not acceptable is the differentiation in position, that men are superior to women. That awareness prompts women to rise up and fight for their rights. Feminism deals with freedom, appreciation, and fair treatment for women. It is not women's disability to sit equal with men, but the systems in their social life discourage women to gain self-assertion to actualize themselves as well as men. Meanwhile, women want to grow as human beings who have equal role and opportunity in their own life and society. In the West and East alike, feminists were up against home-grown patriarchalist opponents who used sundry means to denigrate feminism and its supporters. In the West, detractors portrayed feminists as man-haters. In the East, enemies branded feminists as agents of cultural subversion and, ironically in so doing 'colluded' with westerners in declaring feminism western. (Kynsilehto, 2008: 26). Therefore, what can be integrated from this Islam feminism understanding is the way Islam see the equality between men and women, from the agents of truth about the equality between men and women, not creating women to hate men just to beg an equality as what west feminism says to. It is clear to see that this problem finally inspires some authors to write it down in beautiful work, and one of it is AtiqRahimi with his novel entitled The Patience Stone. The main thing that is hidden in AtiqRahimi'sThe Patience Stone is the way feminism is shown up. This novel, especially the main character, the woman, erodes the feeling of the readers to give sympathy and tears on what has happened to the woman. The woman cannot fight to the system of men he faces on, but she just can deliver it through a telling to her comate husband, which is not changing anything to her fair life. Specifically, in Atiq Rahimi's The Patience Stone, there is told a woman sits in front of his comate husband. She tells everything she never confesses before because of some reasons. She is the wife of a soldier who is lying unconscious with a bullet in his neck, and she calls her husband withThe Patience Stone or "Sang-e Saboor," it is a mythical stone accords to Persian folklore that absorbs the pain of those who confide in it, until it eventually explodes. When the novel opens, the man has been comatose for over two weeks, and shows no signs of recovery. Frustration and despair on the woman's part gradually turns to angry rebellion and, uncertain whether or not he can hear her words, she becomes ever more talkative and outgoing as she gathers over their ten-year marriage. The thing that is important to know is that the couple didn't meet before their wedding, nor even during it, since he was away fighting. Instead a ceremony was performed between the teen bride (the Woman) and a photograph, after which she spent three years as a married virgin. She is not allowed to be out of house of seeing friends and family. When the Husband returns, she discovers that she is married to a violent, because the Husband brutally detaches sex at the first sex time. It can be seen that the woman as main character reflects "handcuff" of women life against patriarchy in the social life of the novel. The Women uses her inability to comprehend and talk back to tell him things that she will not dare to say otherwise. With his disability she has been left to feed herself, her two children and continue buying medicine to keep her husband alive. The only job available for an Afghan woman in her desperate situation it seems is prostitution. It is an interested topic to explore because AtiqRahimi'sThe Patience Stone is part of a Persian myth about a stone that has this phenomenal strength to listen to stories of suffering and sorrow. What sorrow that is delivered is from the heart voice of a woman that lives in the unfair world. The unfair world is caused by the inequality. Thus, to respond it, the readers must have attention to give sympathy to the woman indirectly, and to call this feeling, it is not too naïve when it said as the feminist movement that calls everyone in talking the equality women should have. To classify it, this thought belongs to first wave, where women have voice to utter although it is not a fight directly. Then, the voice that is not changing anything significantly to what the Woman faces, is the silent voice. Silent voice is the voice that is not heard, listened, and sensed. However, this voice exists, and the existence gnaws sympathy to see how unequal the social system the Woman faces, the sympathy that dribbles to feminism thought indirectly to get the equal rights. Based on the reasons above, this thesis then conveys analysis on the life and some aspect of main characters thorough feminism approach accords to patriarchy concepts and understanding in AtiqRahimi'sThe Patience Stone. Finally, the planned title can be written as The Woman's Silent Voice toward Patriarchy's Handcuff Reflected in AtiqRahimi'sThe Patience. For more additional support that this thesis uses credible object, it is important to see that AtiqRahimi'sThe Patience Stone is the winner of Prix Goncourt Prize in 2008. Therefore, this thesis hopefully can be a great product and be great donation of literary critics and analysis. Indeed, the decision to select AtiqRahimi'sThe Patience Stone rather than the other works of him is caused by the main topic of the work. AtiqRahimi's The Patience Stone delivers more complex problem between men and women, that finally grabs the problem of Patriarchy and Feminism, while the feminism that is used is based on the glasses of Islam because the setting is in Afghan. In AtiqRahimi'sEarth and Ashes is told about the patriotic father that struggle with his blind son during the Russia invasion in Afghanistan, while in AtiqRahimi'sA Thousands Room of Dream and Fear delivers a student who exiles form his life because he is chased, he loves someone saves him. Based on the two reference, AtiqRahimi'sThe Patience Stone becomes the best one to analyze accords to men and women problem culturally. RESEARCH METHOD This study is taking one of the Atiq Rahimi's stories entitled The Patience Stone as the primary source. In case of analyzing this story, library research is used in order to find some theories, which are relevant to the topic. Finally, Mimesis approach will be used in analyzing this story because the topic that will be discussed about the main character's silent voice as a woman against patriarchy in her social life as the universal truth. In collecting data, this research focuses on analysis and citations. The first step is reading novel. In this step, novel becomes the object of the research. The novel is entitled The Patience Stone, written by Atiq Rahimi. This is to reach the understanding all contents completely with all possibilities both intrinsically and extrinsically. The second is inventorying data. This step is collecting data through noting the quotations related to the statement of the problems and objectives of the study, it is including in words, sentences, and discourse that can represent patriarchy and feminism in Atiq Rahimi's The Patience Stone. The third is classification data. This step to classify the data based on the statement of the problems including the portrayal patriarchy and the way the Woman posits herself against it. The fourth is tabling the data. It is to simplify reading the data and classify data that is used in the analysis for the readers. Those collected data are continuosly intrepreted to react the statement of the problems. The handling of a technique is a duty to do, it is to keep the analysis not jumping out of the limitation in order to solve the statement of the problems. Furthermore, it is significant to be on familiar terms with the data that it is from the novel entitled The Patience Stone, written in 136 pages plus 4 pages of brief introduction by KhaledHossaeni. It is written by AtiqRahimi with original title of SynguéSabour. Pierre de patience, published with ISBN: 9780701184102, and by Chatto&Windus. It is addressed at Random House, 20 Vauxhall Bridge Road, in London at 7wiv 25a. The book design is created Chatto and Windus group and translated by Polly McLean. On the dark cover, there is laid a stamp of Goncourt Winner 2008. CULTURAL APPROACH The term culture is a description of a particular way of life, which expresses certain meanings and values not only in art and learning but also in institutions and ordinary behavior (Frow, 1996: 8). Frow also states that culture is the way of life and is the meanings and values in that way of life. Therefore, basically a cultural approach is a way to think about a literary text based on the ideas or customs of certain society in which the text is made. According to Stanley Fish, J. Hillis, and Michael Foucault, language helps create what we call objective reality, thus reality is a social construct since it is created from language which is a product of customs produced by certain society. (Bressler, 1999: 264) Each society or culture contains in itself a dominant cultural group which determines that culture's ideology, its dominant values it sense of right and wrong, and its sense of personal self worth. (Bressler, 1999: 264) Culrural approach is divided into some theories. Those are: Marxism, post colonialism, new historicism, and feminism (Bressler, 1999: 178). As stated above, cultural approach investigates the domination and the dominated groups. Therefore, this approach will be used to analyze Atiq Rahimi's The Patience Stone and since the dominated group in this novel is women, the theory of feminism will be used for further analysis. Before going deeper to the feminism, it is important to see that feminism that will be used is the feminism from the glasses of Islam. In the West and East alike, feminists were up against home-grown patriarchalist opponents who used sundry means to denigrate feminism and its supporters. In the West, detractors portrayed feminists as man-haters. In the East, enemies branded feminists as agents of cultural subversion and, ironically in so doing 'colluded' with westerners in declaring feminism western. (Kynsilehto, 2008: 26). Therefore, what can be integrated from this Islam feminism understanding is the way Islam see the equality between men and women, from the agents of truth about the equality between men and women, not creating women to hate men just to beg an equality as what west feminism says to. This thought is also influence to the way of the culture move by times, Eastern as universal truth sees, is culturally have features of moral, politeness, differences, and those all shape a unity of eastern culture that is very cultural. While, in Western, thought, rationality, and will or dreams becomes the subjects that move them to be better, and it shapes their mind and finally becomes the culture of west, therefore, the freedom of women seems to be radical rather that to grab the equality. PATRIARCHY Patriarchy system is a system that has been rooted in society generally. Erich From asserts that Patriarchy system is where men is fated to dictate/control women, and it rules to all part in the world. (Fromm, 2002: 177). Engels gives different perspective that patriarchy system is begun when human have already understood about privacy owning, and it marks the birth of system of class. (Budiman, 1981: 21). What Engels means, must reflect to the birth of system of class of men and women. To add it, to make the establishment of this system of men, chronologically there are some experts that give distance between men and women where men are supposed to be the better one.Classically, women are inequality creature, and it is added by Aristotle who views women as an imperfectness of nature (Beauvoir, 2003:ix). Francis Bacon comments that the more negative assertion that women are the jail of men because women give bad effect or influence to men (Arivia, 2002:40). Kant even says that women does not have any ability to use their cognitive ability therefore women should not be allowed to deliver what they think (Arivia, 2002:40). While, St. Thomas supposes women as "imperfect men", women are creature who are created not deliberately, and it is proven by the symbolic story where Eve is portrayed by Bossuet as a creature who is made of the "Adam's Rib" (Beauvoir, 2003:xi). According to Cixous, the term of men and women pinpoints to the difference of the two where the first term must posit the higher or better meaning, and it is placed by men. Therefore, men are self and women are the Liyan. Women live in men's world, therefore women are considered as the Liyan for men. (Tong, 2009:292). Based on those facts, society finally construct a system where men dominate the whole contents of social life. J. Douglas (1976: 34) adds that many feminists use the term patriarchy as a generic term for male privilege, supremacy, and domination, referring to their current as well as past forms. The attraction of this usage is readily apparent: first, its rhetorical punch and strongly pejorative connotations; second, its reminder of the tenacity and continuity of male domination. Despite earth-shaking social changes, not the least of which are the women's Movements of the nineteenth and twentieth century, male power remains. These all continuously give a perspective that women are really controlled, handled, and dictated by men particularly in society. The representation of society can be found in family. Family is the crucial institution in society (Millet, 1972: 33) because it can represent to what happens in the society. In a family the women mostly being the victim of oppressed by their husband or brother. Furthermore, feminist knowledge develops and becomes more sophisticated throughout the 1970s; the family comes to be an important object of analysis. In many cases, it is the crucial site of women s oppression, the space where, unheeded by the world outside, women are at the mercy of fathers or husbands; where the law of patriarchy holds its most primitive form (Pilcher&Whelehan, 2004: 44). Engels as quoted by Millet explains that the ideal type of the patriarchal family and the ancestor is the Roman family, whence come both the term and the legal forms and precedents in the west. Engels informed the word familiaas follow: signify the composite ideal of sentimentality and domestic strife in the present day philistine mind. Among the Romans it did not even apply in the beginning to the leading couple and its children, but to the slave alone. Famulus means domestic slave, and familia is the aggregate number of slaves belonging to one man the expression [familia] was invented by the Romans in order to designate a new social organism the head of which had a wife, children and a number of slaves under his paternal authority and according to Roman law, the right of life and death over all of them(Millet, 1972: 123—124). In family, Gough as quoted by Jo, mentions that men and women cooperate through a division of labor based on gender. Child care, household tasks and crafts closely connect with the household, tend to be done by women; war, hunting, and government by men. Besides that, men in general have higher status and authority over the women of their families, although older women may have influence, even some authority, over junior men (Jo, 1984: 84). Therefore, what things can be inferred to those all understandings, are the problem that is faced by women in the society, the society is like the jail of women and it is sourced by thoughts where place men in a good position to control women. This is also what things reflected on AtiqRahimi'sThe Patience Stone that finally makes the main character, the woman, whispers something as the silent voice in the middle of patriarchy system. This reaction potentially can be said as the thing to get attention and sympathy about what happens to women in Afghanistan, and this can be said as the movement of feminism. FEMINISM In general, feminism is the theory of women's liberation since the intrinsic in all its approaches is the belief that women suffer injustice because of women's sex (Humm, 1989: 74). From the inequality that exists between both gender, women want to search equality in the society, they start to speak up their voices in the publicarena. Women themselves must articulate who they are and what role they play in the society. Most importantly, they must reject the patriarchal assumption that women are inferior to men. This started the feminist movement. It was started by the reality that male-female relations is a form of power structure in which men dominate women (Thebaud, 1994: 290). From this starting point the feminist believe that existing inequalities between dominant and marginalized groups can and should be removed. In the practive the feminist scholars attempt to examine beliefs and practices from the viewpoint of the "other", in this case women, treating them as subjects, not merely objects. Based on all general understanding, it is important to sharpen it into the good shape for not going out of the limitation and wasting buss of explanation of the theory. First of all, it is a long discussion of talking about feminism and its complex sources. To maintain the stability of this research that uses feminism as the knife to slice the discourse of patriarchy reflected in AtiqRahimi's The Patience Stone, thus the first feminism, the main slicer, continuously will be the main point of theory to discuss. The first wave of feminism appeared in the 19th and early 20th centuries, when women's suffrage was at the pole position of an industrializing world. In other word, it happened at the age of Victorian age. In 1800, women had little control over their lot in life. The average married female gave birth to seven children. Higher education was off-limits. Wealthier women could use limited authority in the domestic scope but possessed no property rights or economic autonomy. Lower-class women toiled alongside men, but the same social and legal restrictions applied to this stratum of society as well. Somewhat ironically, religion fueled some of the initial social advancements women made at the beginning of the 19th century. The Second Great Awakening, which started in 1790, emphasized emotional experience over dogma, allowing women more leadership opportunities outside of the home. Abolition and temperance movements that shared Protestant undercurrents activated women as well. It is like to what Stuurman, as quoted by Bryson, says that feminist theological arguments were further elaborated in the seventeenth century: for example, some writers used the creation story to argue that Eve was superior to Adam because she wascreated last, or because she was created out of Adam's rib rather than out of mud and slime (Bryson, 2003: 6). Thus, it can be seen, that in religion, or theologically, the inequality women have, has been rooting to put them down under the knee of men. That means, men are taking higher position in human life where men and women separate them. To talk about the theologically term about the inequality, then women want to get the equality, means that women have something different from the way theology thinks about it and the way of thought is Cartesian with all rationality to think. Bryson notes that the inspiration for these new ways of thinking (feminisms) was the revolution in western philosophy, which had been started in the first half of the seventeenth century by Descartes. According to Cartesian philosophy, all people possess reason, and true knowledge, which is based on experience and self-discovery rather than study of the classics or sacred texts, is in principle available to all. This means that traditional authority is rejected in favor of rational analysis and independent thought, and that customs and institutions which are not in accordance with reason should be rejected. (Bryson, 2003: 6). Therefore, what has been done by feminist is breaking the old thought that is sourced by the empirical way of theology. Moreover, what becomes the main point of this born is the equality that is thought as the right that has been robbed by men and their all system. The first-wave of feminism began in the United Kingdom and the United States around the nineteenth century and lasted until the early twentieth century. The focus of this movement at this time was on de jure inequalities, or officially mandated inequalities. There were many people during this time who were considered to be feminists, Mary Wollstonecraft, Susan B. Anthony, Lucy Stone, Olympia Brown, and Helen Pitts; there are countless more. The first-wave of feminism was monumental to the movement, however, without the continuing second-wave, there would be no hope for feminism in current times, for each wave is connected and dependent on the other's history. In simpler words, feminism is not some simple thing that people can generalize, like it is just an excuse for women to kick men in the balls, and not take care of themselves, or that men and women must be equal at all costs. Feminism is a movement, which has been incredibly important to the success and failures of this country and has been a necessary journey for the women in our country to travel upon so that they can discover and create their own unique place in society. First wave feminists spent hundreds of years in activism, writing, protesting and working for the betterment and equality of their sex and gender. First wave feminists worked not only for suffrage, or the right to vote, but also for the right to an education, the right to work, the right to work safely, the right to the money they earned when they worked, the right to a divorce, the right to their children and the right to themselves and their own bodies. Rights for women can be traced back to the Middle Ages in the Middle East when early reforms under Islam gave women greater rights in marriage, divorce and inheritance. Women in other cultures were not afforded such rights until centuries later. Further improvements of the status of Arab women included things such as the prohibition of female infanticide and recognizing women's full personhood. The things mentioned above are necessary and were necessary, and in some case, came at the end of long efforts. First wave feminists had to work against this impression, and they had to work against the society that allowed an unmarried woman to be property of her father and a married woman to be property of her husband. The first wave of feminism was the longest, and it is the most taken for granted. It is common now to speak with women who do not identify as feminists who think that feminism is a dirty word, who simultaneously pursue careers and an education, who exercise their right to vote, who own property and benefit from the fruits of their labor. Understanding the history and the efforts of feminism, understanding how much progress they made and how long it took them is important both to those who think they are not feminists, and those who identify as feminists and who live life trying to better the world by the feminist ideal. (Retrieved from uic.edu and pacificu.edu). Victorian feminism is a difficult concept to analyze. On the one hand, some of the greatest reforms of women's social and legal position before those of the late twentieth century occurred in a few decades of the nineteenth century; on the other, many of those women who were active campaigners—Caroline Norton, Florence Nightingale, Emily Davies, and Barbara Bodichon—were ambivalent about the extent of their own feminism, and over-anxious to distance themselves from unconventional lifestyles and behavior. Moreover, they seemed concerned mainly with the plight of intelligent middle-class single women. Their commitment to respectability gave them something of a timorous or half-hearted allegiance to a more wide-ranging kind of feminism; in any case, their contribution to the feminist cause was often narrowly specialized as they concentrated on a particular campaign—whether for women's colleges at Cambridge or child custody rights—to the exclusion of others, and many still relied on men to help them with the legal or parliamentary part of their activism. For some, however, it was impossible to avoid being drawn into a wider examination of women's rights, as happened with Caroline Norton and Harriet Martineau, for example, and by the end of the century, most of the major journals were carrying heated debates about the unsatisfied needs of the modern woman. Beginning initially with spasmodic bursts of activism, first wave feminism gathered pace through the work of specific individuals working for specific ends, until the momentum of events made concern for women's full participation in social and political life a matter of public interest across the whole political spectrum. This in itself was no mean achievement (Gamble, 2006: 24). According to those all explanations about first wave feminism, that is majorly from west, then it is continued to see this based on the glasses of Islam feminism reflected to AtiqRahimi'sThe Patience Stone. There is a woman that faces a fact of patriarchy system, she cannot do anything except confessing something about the inequality that indirectly getting sympathy for anyone who read to pay the pity about equality of thee Woman should have. The equality is something has been robbed by the patriarchy system, and the way the Woman acts, can be said as feminist movement. As Muslim, this thought can be clearly is seen as east feminist movement. It is like to what Kynsilheto says that it was in this context that some of us reported that Muslim women were subverting the patriarchal Islamist project through what appeared to be a new form of feminism-in-the-making which Muslim women in different parts of the world would soon call Islamic feminism. (Kynsilehto, 2008: 26). Therefore, the understanding of this feminism toward this research goes clearer to see as the relevant theory that will be used to slice the data just to become a good shape of analysis without going out of the limitation. STATUS WOMEN IN AFGHANISTAN The position of women in Afghanistan traditionally has been inferiorto that of men. This position has been continuing to age, socio-culturalnorms, and ethnicity. In fact, Afghan women, even until the beginning of 20thcentury are still being the slaves of their father, husband, father-in-law, and elder brother. Thus, it can be said that the status of women are silence and obedience. The essence of attitude towards women could be clearly seen in the relationshipof the family after the birth of a female baby.The birth of a female baby,particularly in those cases where the mother gives birth to several girls, is the main cause of contracting a second marriage, and it is still happened until nowadays. Girls areusually raised to be good mothers and tolerant housewives. Thus no one pays attention to their education, except in very rare cases in some well-to-do families. Furthermore, they are married to young and even to very old men, in most caseswealthy ones between the ages of 13 and 16, and in certain cases between the ages of 10 and 12, if their parents desire. They were exchanged for what is called "Toyana" or marriage price. Young girls had no right to choose theirfuture husbands, or question their engagement, which is arranged by theirparents. Early marriage is the main cause of suffering for girls in Afghansociety. Such marriages are both physically and psychologically unhealthy,and often resulted in sickness and psycho-neurotic diseases. Many youngmothers pass away during releasing it because of physiological reasons and earlymotherhood.Divorce is an easy act if the husband wants it. Afghan women do not have any right to ask for divorce. The man is the governor, the controller, the dictator, of every authorizing in divorcing. It is a slur for both families.Occasionally, wives were deprived of their rights and claims on their ownchildren. Traditional women refer to their husbands as "Sahib", the lord. Wives aregreatly trusted by their husbands. This great confidence rendered byhusbands has led Afghan wives towards great honesty, chastity, courage, andproper manners. Women are mainly occupied with rearing children, cooking,sewing, milking, weaving, spinning, and other similar house-works. For thosewho can pay for servants, their servants free them from the burden of home duties. Women take part in social occasions and family entertainments,but they separate from men. On all occasions where both sexes take part,they remainsto be separated. According to Scharmann (Kakar, 1971), thedivision of men and women into two separate worlds is pronounced inAfghan society. In entering the world outside their homes, women are toveil themselves. They usually try to hide their faces from men, calling them "Namahram", though the exception was for women in upper class families,the number of which was very small. Afghan women are patriotic. They love their native land. That is whyAfghan women in time of war helped Afghan warriors in the battle fields byproviding services such as carrying supplies, removing bodies, helpingwounded soldiers, etc. For example, in the second Afghan war with theBritish, Maiden Malalyis known as the symbol of courage at Maiwand war.At present, women take an active part in defending the revolution. They areorganized in committees for such defense. Based on the paraphrasing of Wali M. Rahimi in his book Status of Women: Afghanistan that is supported by UNESCO, therefore it can be accepted that what things happen to the Woman in AtiqRahimi'sThe Patience Stone, is not only a kind of play of the plots of a fiction, but it can be related to the reflection of the reality world, where women are still living in the jail, they live in the armpits of men that are very rotten. HOW AL-QURAN VIEWS PATRIARCHY As a religion that is always involved in patriarchy, Islam actually seems to be like a scapegoat religion. By the showing from the first creature of Adam, the duty of men of being a leader and women should follow their husband, until the greater rights of wealth heritage. Those all constantly strike Islam as a religion that gives privilege to men rather than to women. This all happen, potentially from the miss understanding toward the interpretation of Al Quran.In Al Quran, the holly book of all Muslim, there is told some reason of those wrong perceptions. In a verse from Surah An-NAhl. There is written, Anyone who works righteousness, male or female, while believing, we will surely grant them a happy life in this world, and we will surely pay them their full recompense (on the Day of Judgment) for their righteous works(16:97). This is what is said as the equality of Men and Women. Both men and women are treated with same treatment, and those all based on what they do in the world with regardless what sex they have. Additionally, there are some verses and Surah that show Islam give similar position between men and women, and the difference of the two is not a hierarchal system, but difference of patching each other. This is very different to what patriarchy understands about, therefore, there is no reason to call Islam as patriarchal religion. SILENT VOICE This is a new term that will be a source of question, what does it mean? How can this term raise among all problems that this thesis emerges up? And many questions follow to trace with no end. However, this term is actually taken from the basic problem of the Woman, as the main character, in AtiqRahimi'sThe Patience Stone. The Woman faces problems of patriarchy system, she cannot do anything except following that system. She is just woman, and she has no voice to demonstrate what she feels, but, when her husband comes back in comate condition, she finally can utter everything she feels. Based on this fact, it can be said that the Woman has a chance to say what she feels from the comate condition of her husband, with that moment she says. She voices something, something that is always hidden and repressed. This repressed voice, finally can be seen as the silent voice, because silent literally mean cannot be uttered directly, it exists but it is not heard and listened, even it cannot be heard nor listened. The voice symbolically shows the heart, the feel, and experience. Therefore, it is completely seen as the silent voice of the Woman, definitely. DEPICTION OF PATRIARCHY'S HANDCUFF THROUGH THE WOMAN'S SILENT VOICE IN ATIQ RAHIMI'S THE PATIENCE STONE The things become the crucial issue in Atiq Rahimi's The Patience Stone is the problem that is faced by the Woman. The Woman here is unnamed character, she has a comate husband after taking back from the war. Here, the Woman delivers everything she has kept, hid, and buried. These feelings are blown up by what she utters to the "dead" husband. Here the conflict emerges as long she delivers it. To start it, the conflict can be rushed to the conflict where the Woman has a sex with her husband at the first night, 'Oh yes bleeding…I was lying to him, of course.' She glances keenly at the man, more mischievous than submissive. 'Just as I've lied to you…more than once!' she pulls her legs up to her chest and wedges her chin between her knees. 'But there is something I'd better tell you…' (Rahimi, 2010: 28). There is something different going wrong in this case. On the quotation, the Woman admits to her comate husband that she has been lying to him. What she lies, is the thing happens when they firstly sleep in gathering. Pulling the plot before, the man comes after homing from war. He is as nervous as the woman in facing the first having sex. Then, they finally have a sex. The Husband feels happy because he thinks that the woman is still virgin. The proof is, the blood melts down while the Husband penetrates his penis down. It is accepted because, in oriental countries, culture, women are like the special things. Therefore, the virginity of women is the crucial thing every man should have got. It can be thought carefully when it is compared with western culture. In western culture, a man and a woman can live together although they have not been married, but it is not accepted in mostly eastern culture, moreover in Afghanistan. To get it, men's culture construct a jail where women are prohibited to be out of house in order to make them saves of being not virgin. However, the blood that melts on the Woman's vagina is the blood of menstruation. The Husband does not know, and he does not want to know. The way the Husband does it, the way the Husband treats his wife with regardless the condition of the wife appears something. It is a kind of a force, the insisting seems that the Husband, as a man, has a power and right to do everything to the wife. This authority can be belonged to an action of domination of a man to his wife. Further explanation, the way these two creatures marry, is not in a proper equal right. What is meant by this statement is, the Woman marries to her husband in a condition where she has to be sit with a photo because the Husband in on process of war. That is the pity thing for every woman to marry with someone she never sees directly and physically. This marriage happens because the Woman is believed as a woman who has been already of being married. With regardless the love, the feeling, and the desire to marry, the Woman is insisted to marry. This is harsh thing, the hard thing for women to neglect it. Women are poisoned by this system, because if women try to make a move of changing it means that women have not been ruling the law, and it is considered as fighting to God's rule. As it can be mirrored directly that, this system, this marriage gives something pleasant for the men because they (men) do not have to be so serious in facing the marriage because they can represent their appearance, their existence, in the ceremony. Another fact is, when the Husband has a sex with the Woman, actually the Woman is in the period that means she has menstruation. However, what thing that can stick to every eye is the fact that the Husband firstly meet the Woman, his wife, three years after they marry.'When you and I went to bed for the first time after three years of marriage, remember! Anyway, that night, I had my period.' (Rahimi, 2010: 28).From the quotation above, it can be read unmistakably that the Woman meets her husband firstly after three years passed. This is added the explanation above that the Woman is jailed in the system of patriarchy. The Woman cannot break the rule, she has to follow the rule, she has to be laid down on the feet of a man. It can be imagined, how can a marriage is not attended by one of the couple? It is really strange and seemed not to be a fair marriage. Additionally, the Woman marries to her husband is caused by the time she has to marry. Moreover, her sister has been sold to a man because her father cannot pay the debt after being lost in his bet. After having a sex, the days after, the Husband should go to the war again. It means that he has to leave his wife again. The Woman, as a woman generally in the world, must feel sad of being left by the husband. Therefore, the Husband looks to be a pride thing for everyone in Afghanistan, because he struggles for nation, for religion, for Afghanistan. Although, what the Husband does is sacrificing the happiness of the Woman. This is the voice of the Woman in front of the comate Husband. She utters everything she feels, what she utters means that she has been keeping, holding, and defending her emotion and anger because of the relation with her husband. She marries with a man, and during the marriage, for ten years, she never speaks, she never does something husband-wife does generally such a chit-chatting, joking, giving romantically action, and other actions. The coming of the Husband is only run out by drinking, partying, and laughing with all his friend, then he wants to have sex with his husband, the Woman. Therefore, it means that the woman is only an object of sexuality, object to deliver the Husband desire of sexuality, the object that is only for satisfying his ambition of the desire. Within this context, within this culture that asks every woman to fulfill the desire of the husband, becomes the thing that can be good and bad. Generally, it is good for a normal relation that has good husband and wife. For example, the filling what husband desires can strengthen the relation of the two, between the husband and the wife. However, the context that the Woman faces is different. She is very seldom of meeting with his husband, she never speaks, talks, and make conversations. Then the Husband comes home, and wants to have sex after drinking and partying. Can it be looked as a duty for every woman in the world to fill what the husband wants? This is unfair thing. This is the thing that can slice the feel of every woman. Women are also creature, they are human being, they also have feeling and desire. They want to be felt, they want to treated humanely. If the Husband just want to throw out his desire and after that he goes off again. It makes the impression of the Woman that she just a whore of the man, she is just a slut of the Husband, she is only a harlot of his husband. This s irony, but this is what happens to the Woman in Atiq Rahimi's The Patience Stone. Because the setting is in Afghanistan, it can be reflected that something happens to the Woman, is what the things happen to some women in Afghanistan. Talking about Afghanistan, it must relate to the system they use. Afghanistan is a complicated country. Therefore, what can be inferred from the explanation has been noted in the understanding before about the position women in Afghanistan, is the women have no freedom to move, to express something, to say something such as "Excuse me, I want to divorce you." Or something like "Um… Sorry we need to discuss it before." The fate of women seems to have been robbed out. They do not have anything in the world, everything they want to say, everything they want to deliver based on what they feel, based on what they think is unfair, is unsaid, and it is kept in heart. What else that has to be said that this system is called as patriarchy system. Indeed, it is Islam, but it is longer used as what equality in Islam has been written on the holy Koran. This is caused by the wrong interpretation of human, the wrong interpretations are finally used as the culture, and for the God's sake, it is inherited. The Quran makes it clear that Women and Men are equal in the eyes of God. This is the weakness of human, to see something they always see it by what they can accept, although God has different point of view. One of the most misunderstood areas in Islam is the position, the situation, and the condition of women in the religion. The universal view in the West is that Muslim women are subjugated and almost seen as property or the object of men. Although, not all Muslims deal with that statement that women as inferior, this is unfortunately true in some segments of the Muslim world and this treatment is supposedly reasonable thing by the religion. However, when it is looked at the basis of the religion, the Quran, it can be seen a different picture. In the Quran God makes it very clear that men and women are equal. Their Lord responded to them: "I never fail to reward any worker among you for any work you do, be you male or female - you are equal to one another. Thus, those who immigrate, and get evicted from their homes, and are persecuted because of Me, and fight and get killed, I will surely remit their sins and admit them into gardens with flowing streams." Such is the reward from GOD. GOD possesses the ultimate reward. (3: 195). The only criterion for distinguishing among the people. Based on what those show, it can be articulated that God seems to have no distinguishing, or special thing to differ between men and women. The two can have sins, the two can hbe living in the paradise, the promised place. If the God seems to say that, why men creates their own understanding to control women in their armpits, is that a kind of breaking the rule of God whereas God say that there is no difference between men and women, the two can live in paradise and have sins. If the paradise is for good human, and men try to be good by slaving women, and women try to be good women by being slaved by men, is that a kind of justice? Men can live freely by slaving women in the world, and slaving is kind of joyful action. They do not have to be pregnant, they do not have to be working at house, wiping the shits of the baby, feeding the baby, menstruation, and busy of massaging their husband. If they (women) have to do so as their duty, they should have the same result of what they have done, the same right of not being slaved. They should have similarity, because of what they do for men are rightfully consisted of rights. However, men, the culture of men, the system of men, the wrong interpretation, makes them fall to the disgusting thinking about women. How can that clear verses be ignored? Why are women treated so poorly in some Muslim communities? The answer lies in the fact that those communities take other sources besides the Quran as the basis of their religion. There are many Hadiths that degrade women. In addition, the pre-Islamic cultures of much of the Muslim world do not value women and have little use for them. The following verses demonstrate this fact: Long and complicated, the tradition that brings and leads the system of men to mostly Muslim nations, here is Afghanistan. However, it can be traced that what makes this becomes the intimate problems of Afghanistan is their condition. Their variety of religion and the territorial that is surrounded by West and East culture makes them are easy to be got down, especially in their rule. Islam, where the verses are delivered beautifully, but it is interpreted wrongly, and makes the wrong system of men. There are difference between men and women, but the difference does not mean they are not equal. They have same duty and right, the same means to the effect rather than the direct meaning of duty, so does the right. However, this right does not longer exist for many women, and it can be represented by the Woman in AtiqRahimi. Again, she has to admit that to be married with the Husband is not what she wants. 'Your mother, with her enormous bust, coming to our place to ask for the hand of my younger sister. It wasn't her turn to get married. It was my turn. So your mother simply said, "no problem, we'll take her instead!", pointing her fleshy finger at me as I poured the tea. I panicked and knocked the pot over.' She hides her face in her hands.in shame, or to dispel the image of a mocking mother in law. 'as for you, you didn't even know this was happening. My father, who wanted nothing more, accepted without the slightest hesitation. He didn't give a damn that you weren't around! Who were you, really? No one knew. To all of us, you were just a title: the hero! And, like every hero, far away. Engagement to a hero was a lovely thing, for a seventeen year old girl. I said to myself. (Rahimi, 2010: 53—54). Here is told that the Woman does not have any right to choose which man she wants to be married to, because her mother selects the man for her. It shows that the power of parents is strongly grabbing the children, and the children that gets the bigger grab is woman. Women are considered as slow, weak, and brittle. Thus, it is not right if women are given a chance to choose men. Furthermore, the Women does not love the man she marries. It is a kind of insisting. Why should be woman? This is the patriarchy system, the system that control women. The more ironical thing happens to the Woman in Atiq Rahimi's The Patience Stone is, she marries with a man she never knows, and even in the marriage ceremony, she marries to a photo. '… they celebrated our engagement without the fiancé. Your mother said. "don't worry, victory is coming! It will soon be the end of the war, we will be free and my son will return!" Nearly a year later, your mother came back. Victory was still a long way off. "It's dangerous to leave a young, engagement woman with her parents for such a long time!" she said. And so I had to be married, despite your absence. At the ceremony, you were present in the form of photo and that wretched khanjar, which they put next to me in place of you. (Rahimi, 2010: 54). Based on the quotation above, it can be read obviously that the Woman marries to a man she never knows and during the marriage ceremony, she just sits next to a photo, not the man she marries to. This is an irony fact, the Woman must feel sad, besides the force of marrying the man she never knows, she must also feel sad of this moment. This is an unfair thing for woman, and can it be said that this is the fair thing for woman to marry with a photo? Furthermore, for years the Woman is not allowed to jostle, to join with a group, with neighbors, and friends. She has to be in home, doing everything in home. The home is like the jail of her, she is prohibited of talking to anyone. And I had to wait another three years. Three years! For three years I wasn't allowed to see my friends, or my family…it was not considered proper for a young married virgin to spend time with other married women. Such rubbish1 I had to sleep in the same room as your mother, who kept watch over me, or rather my chastity. And it all seemed so normal, so natural to everyone. To me, too! I didn't even know how lonely I was.' (Rahimi, 2010: 54). The way her mother in law treats her can be analogized that the Woman seems like a prisoner. She is forbidden to interact with the other side of the house, she has to sleep with her mother in law while the Husband is in war. The mother always keeps watching on her, and it is like a guard in the jail, and the woman is the prisoner. She is like a creature who is born to be kept watching, with no right to do, every move she makes is something her mother in law catches.When she is like a prisoner, she must be the fault one whether she is fine or doing a mistake. It is portrayed to this below quotation. Those all are what the Woman feels and it is portrayed in a conclusion where patriarchy system in Atiq Rahimi's The Patience Stone is drawn. The Woman is the representation of this portrayal, she feels in jail, she feels like a prisoner, no right and no freedom to move. She marries to a man she never knows, her sister becomes the stake of her father's bet, and she forced to be pregnant although the Husband is the unfertile one. She is insisted to meet someone like a priest to consult the pregnant, and the priest is actually a procurer. She is asked to get in a room, and a man with blindfolded penetrates her until she gets pregnant. The way her mother insists her to get pregnant with not knowing the condition of her son, makes the Woman has a baby from a man she does not know. This the cruel of the patriarchy, when women do not have any right to speak something, they are jailed, and the only one thing the Woman in the story can do is, delivering everything she feels to her comate husband. With a silent voice, she utters and posits herself. THE IMPACT OF THE WOMAN'S SILENT VOICE IN ATIQ RAHIMI'S THE PATIENCE STONE As the response of facing this problem, the Woman cannot do anything except telling the truth of what she feels, what she hides, what she wants to deliver, because she does not want to hurt anyone. Therefore, she wants to tell it to no one, besides that she must be afraid of telling what she feels because what she faces is the culture, the misunderstood religion, and social truth. This problem is delivered through this below quotation, she thinks that it is better to keep silent and to tell to no one. 'I never wanted anyone to know that. Never! Not even my sisters!' she leaves the room, upset. Her fears echo down the passage. 'He's driving me mad. Sapping my strength.Forcing me to speak.To confess my sins, my mistakes.He's listening to me. Hearing me.I'm sure of it. He wants to get to me…to destroy me!' (Rahimi, 2010: 60—61). This is what happens to the Woman's sister. Her sister is forced to marry, her father sells her sister because her father defeats in bet. However, what can the Woman do? She is just a woman, she has no voice, her voice is not to be heard or listened, she is just a creature that is created by not deliberation, therefore, woman should be in room, cooking, bearing baby, feeding baby, and doing "female" activity. She does not have to have something like man, like voicing voice. This shows that the Woman posits herself in a mute, in silence, and in the broken heart with no fight back. The culture has constructed them t be like this, silence and mute. This is the best position the Woman can replace because if she wants to break the rule, she must be destroyed, tortured, and punished by the law the men create. One of the best way, besides keeping silence, is telling the truth to God. When her husband is comate, the Woman always prays on her Husband. Her Husband is just comate, cannot respond, cannot do anything. A hand, a woman hand, is resting on his chest, rising and falling in time with his breath. The woman is seated. Knees pulled into her chest. Head sunk between her knees. In the other hand, the left, she holds a long string of black prayer beads. She moves them between her fingers, telling them. Silently.Slowly.In time with her shoulders. In time with the man's breath. Within reach, open at the flyleaf and placed on a velvet pillow, is a book, the Koran. Her plump, dry, pale lips are softly and slowly repeating the same word of prayer. (Rahimi, 2010: 2—3). This is what the Woman does, he prays for the Husband, although everyday it seems no worth, no use, and it even seems to be in vain. However, as a Good wife, she always prays, and never quits for stopping praying. This is the way the Woman posits herself, although she gets unfair life, although her life is grabbed by the system of men, although her happiness is robbed by the injustice, she just tries and keeps trying to be a good wife fro her evil Husband. The way the Husband keeps silence and receives all things the Woman tells, is analogized as the Patience Stone. It is the mythical stone for Muslim in Hajj, the stone that is very soft and can release all burden. Probably, this is why the Woman tells it to her comate Husband. There are so many internal conflicts the Woman faces, and she almost has a plan to leave her comate Husband. However, she is a god wife, and she is so sorry of having it. It is reflected on this below quotation. 'Forgive me', as she strokes his arm. 'I'm tired. At breaking point. Don't abandon me, you're all I have left.' She raises her voice : 'Without you, I have nothing. Think your daughters! What will I do with them? They're so young…' She stops stroking him. 'The Mullah won't come today,' she says with some relief (Rahimi, 2010: 14—15). In this quotation, it shown and portrayed that the Woman is almost surrendered, she almost quits, she is almost getting tiring. Her frustration is caused by the condition of the Husband that is not different days by days. However, she remembers about her daughter, and it adds something in her heart not to leave the Husband. Based on this fact it can be seen that the Woman is trying to posit herself in a god way, she is just trying to be a good wife, a good Muslim who works the rule of not leaving the Husband and doing everything for the Husband, although the Husband is in comate condition. This portrayal, is the form of faith, the Woman is really special woman, by the condition that can strike her, the situation that can make her angry, the experience that can make her has a revenge for the injustice, she keeps having a feeling to take care of her Husband. Then, the reflection of the Woman to posit herself is clearly seen b this quotation. As a good mother, the Woman also treats her children with lovely treatments. It is shown by this quotation below that shows that the children are not allowed to disturb the comate father. 'Don't be frightened, darling. I'm here.' The mother reassures her : 'I wasn't shouting. I was talking to your father.' They walk away from the door. 'Why are you calling my father Al-Qahhar? Is he cross?' 'No, but he will be if we disturb him.' The little girl falls silent (Rahimi, 2010: 17). The way the Woman asks to her children not to disturb their father who is comate shows that the Woman keeps the Husband, she does not want her Husband gets worse by the disturbing. This is showing the Woman posits herself in treating her Husband. Based on the experience when she has to marry with a photo, the experience where she has to be penetrated while she has menstruation, until her Husband's brothers who always spy the Woman while she takes a bath, she does not have any revenge. If she has, she must kill the Husband easily because the Husband is between the condition of dead and alive. He is comate, and it is very easy for everybody to kill him, no exce

The College Mefcufy. VOL. IV. GETTYSBURG, PA., DECEMBER, 1896. No. 8. THE COLLEGE MEftClPRY, Published each month during the college year by the Students of Pennsylvania (Gettysburg) College. STAFF. Editor: ROBBIN B. WOLF, '97. Associate Editors : LEWIS C. MANGES, '97. ED. W. MEISEN H ELDER, SAMUEL J. MILLER '97. CHARLES T. LARK '98. JOHN W. OTT, '97. CHARLES H. TILP, '98. E. L. KOLLER, '98. Alumni Association Editor: REV. D. FRANK GARLAND, A. M., Baltimore, Md. Business Manager: HARRY R, SMITH, '97. Assistant Business Manager: JOHN E. MEISENHELDER, '97. ".". jOne volume (ten months). . . . $l.no iMiMS-\Siuglecoples, . . .15 Payable in advance All Students are requested to hand us matter for publication The Alumni and ex-members or the College will favor us by-sending Information concerning their whereabouts or any Items they may think would be Interesting for publication. All subscriptions and business matters should be addressed to the business manager. Matter intended for publication should be addressed to the Editor. Address, THE COLLEGE MEHCUKY, Gettysburg, Pa. CONTENTS. EDITORIAL, 114 DE ORATORE, - --. --- 117 AN ADVENTURE (Poetry), --- 118 AN APPEAL, "9 A LULL FROM THE HIVE (Poetry), --- 120 COLLEGE LOCALS, 120 ALUMNI NOTES, -- 122 ATHLETIC NOTES, 125 TOWN AND SEMINARY NOTES, 127 FRATERNITY NOTES, - --- '--128 SUBJECTS FOR "ROMAN LAW" THESES, 129 LITERARY SOCIETIES, --- . - - 129 EXCHANGES, --- 129 EDITORIAL. REVIEWS ! Examinations ! ! Vacation ! ! ! The stereot3rped program is about to be ren-dered. The term, on the whole, has been un-usually pleasant. Seldom has there been a fall session of so much charming weather. This has been conducive to good spirits with the professors as well as with the bo}rs. Sev-eral interruptions broke the monotony of col-lege work—the foot-ball games, the visit of the Columbian Club, Election day, Thanksgiving day, Institute week and several others. The work in the class-room has been very good, and this is somewhat surprising in the face of the great temptation to stay out-of-doors. The moral and spiritual work of the term is shown in the excellent results in the Y. M. C. A., alike in the meeetings, in the efforts among the non-members, and in the continu-ation of the week of prayer during the second week. Neither has athletic activity been neglected. The "gridiron," bowling alleys, gymnasium and tennis courts have been well patronized. After all comes vacation, especially desired by the Freshmen. The MERCURY extends to all its heartiest wishes for a Merry Christmas and a Prosperous New Year. ' + * * INTER-COLLEGIATE ORATORICAL CONTEST TO BE HELD AT GETTYSBURG.—The annual meeting of the delegates composing the Com-mittee of Arrangements of the State Inter-collegiate Oratorical Union was held at the Windsor Hotel, Philadelphia, on Saturday, Nov. 21st. Fourteen representatives were present from the seven following colleges : Lafayette, Lehigh, Muhlenberg, Franklin and Marshal, Ursinus, Swarthmore and Gettys- "S THE COLLEGE MERCURY. burg. Our delegates were G. F. Abel, '97, from Philo, and R. B. Woll, '97, from Phrena. President Yetter, late of Muhlenberg, called the meeting to order. The unfinished business was then taken up and completed. The re-quest of Susquehanna University for admission was refused on the grounds that the Union is large enough and the University very young. After hearing the delegates, it was decided to hold the contest at Gettysburg on March 27th, 1897. Hon. John Stuart, of Chambers-burg; Hon. J. B. McPherson, of Harrisburg, and Hon. Rob't E. Pattison, of Philadelphia, were chosen to act as judges of the contest. The officers elected are: Pres., R. N. Hood, of Lehigh ; Vice Pres., W. E. Stoeckel, of Muhlenberg; Treas., G. F. Abel, of Get-tysburg; Sec, \V. H. Kready, of Franklin and Marshal ; Executive Committee, Blair, of Swarthmore; Shenk, of Lafayette; Wolf, of Gettysburg, and the Pres. and Sec. ex officio. A rotation system was adopted so as to have the contest held once in every seven years at each college. The contest will be held at Gettysburg, 1897; Lafayette, 1898; Lehigh, 1899; Muhlenberg, 1900; Ursinus, 1901; Franklin and Marshal, 1902, and Swarthmore, 1903. A communication has just been received from Muhlenberg asking Gettysburg to ex-change with her. The following considera-tions make such an exchange desirable : the expense and trouble attending the contest and the fact that our oratorical talent does not promise us the prize. The expense will be from sixty to one hundred dollars, even if we can overcome the trouble; but when Gettys-burg has the contest, she should have a fair prospect of the prize. The only objection to the exchange is that Muhlenburg has already had the contest there, while Gettysburg has never had it. No action has yet been taken on the matter. * * * IT is to be hoped that the article in our last issue, on the Gettysburg Club at New Haven, by Wm. J. Gies, has been thoughtfully read and pondered by the different Alumni. This is at present the only Gettysburg Alumni Club in existence, outside of the general associa-tion. There should be other clubs of this kind at such centres as York, Philadelphia, Balti-more, Harrisburg, Altooua and other places. Such organizations are not only pleasant for the members, but are beneficent to the institu-tion. One of the chief objects of the clubs should be to furnish recruits for the college. No doubt the motive which prompted the New Haven men to form a Gettysburg Club was their interest in their Alma Mater. There are few better ways of showing your interest in the college, than by the formation of such clubs. The New Haven men have already had let-ter heads printed. At the top of the page in large characters are the words, The Yale Get-tysburg Club, while to the left in small type is a list of the officers for i896-'g7. Pres., Wm. J. Gies, '93; Vice Pres., C. F. Kloss, '94; Historian, H. L. M. Hoffman, '95; Sec, A. H. Brown, '96; Treas., D. F. Culler, '93, * * * OUR RELATIONS WITH DICKINSON.—There has been considerable talk, throughout the present term, in favor of contracting friendly relations with Dickinson. Our neighbor has intimated that we ought to come on bended knees and uncovered heads and apologize for all the defeats which she has suffered at the hands of the Gettysburg athletic teams. Get-tysburg has too much dignity to submit to such conditions, but being eager to renew the annual games with Dickinson and desirous of being on friendty terms with her neighbors, the Gettysburg boys held a mass meeting and selected one of the professors to meet with rep-resentatives from Dickinson. So much for Gettysburg. What has been the response of Dickinson ? She sent fifty of her boys to Harrisburg on the day of our game with Swarthmore, who did their utmost to have Gettysburg defeated. The Dickinsonian in their issue of Nov. 7th, recog-nizing the disgraceful character of such be-havior, offers the following by way of apology: THE COLLEGE MERCURY. 116 "There were some men whose behavior at Har-risburg, had they been college men, would have disgraced Dickinson. The}7 were town boys and not students of the college, yet Dick-inson will, in all probability, get a bad repu-tation on account of the incident.'' This sounds plausible. But the facts are in evidence against it. Several of the Gettysburg boys, being fraternity men, went up and spoke with the Dickinson men belonging to their respect-ive fraternities and thus found out that the students had been doing all the mean work for which their Weekly blames the town men. But in glancing over the Dickinsonian, a second article is noticed. This was probably written by one of the associate editors, who was ignorant of the scheme to get out of the trouble. This article says : "Dickinson rooted lustilv for Swarthmore and we do not consider this in any degree objectionable. We do, however, think that the ungentlemanly con-duct and disgraceful language of a few of the students is deserving of the harshest censure. Just such actions as these are the cause of so much talk about college rowdyism." Let the readers form their own conclusions, from the two quotations, as to the attitude of Dickinson towards Gettysburg. * * * WE take pleasure in calling the attention of the readers to the publication of the '98 Spec-trum. The work is being pushed vigorously by the class, and judging from the present prospects, it will be an unusually interesting one. The men on the Staff are the leading members of the class and are exerting all their powers to make it a success. The Alumni department of which Win. J. Gies, '93, has been elected editor, will be one of the import-ant new features. The artist's corps is also very good as was seen in their work on the '97 Spectrum. Many new cuts will supplant the old ones which have been reproduced in nearly all the preceding issues. These and several other features point to a good book, one which deserves support. It comes only once a year. It need not be paid for till May, '96. Send in your subscriptions now and thus give them encouragement in their task. All suggestions which may tend to improve the publication will be very thankfully received by the Staff. * * * EVERYONE desires to enter the coming new year with a clean record for the past year. To this end, kindly pay your subscription fee to the MERCURY. Our treasury is very low and we, .too, would like to enter the new year with everything squared up for the old. If you are in doubt as to the amount of your ar-rears, consult the Business Manager. ' * * * FEVERISH HASTE.—Americans are always in a hurry. Proverbs on the foolishness of haste seem to have no influence. We work with one eye on the clock. Trains move too slow for us. Steamers are regular snails. We can "do" Europe in a month and he is a poor sight-seeing traveler who cannot see Rome in three days. We "run" down to the city. We "run" out west. We "rush" to conventions and "rush" through them as well. Every-thing must have the electric movement, in seeking wealth, in seeking pleasure, in ac-quiring an education and even in prayer and praise. We have gotten beyond the "long" sermon and there is no place in the liturgy of devotion for practical men and women for the "long" prayer. We sympathize with John Foster who longed for the power of touching men and women with the spell of "be quiet." No thorough work can be done in a hurry. No great picture was ever painted by contract against time. The author who writes the book that lives must have leisure, quiet and the seclusion of his stud}7, away from the rush-ing tide of busy life. The old "A B C" method may be slow but it is sensible. He is wise who takes time for thorough preparation for his life-work, who is willing to work and to wait. Feverish haste to get into college, feverish haste to get through and into the business or profession of one's choice is all a mistake, a costly blunder. The old proverb can be wisely applied to one seeking an edu-cation, "Make haste slowly." G. THE COLLEGE MERCURY. WILLING WORKERS.—There is always work awaiting the willing worker. He who puts his whole heart into his work will be success- ! Inl in it. He will always be wanted in his business or his profession. He who goes grumbling to his task will soon find himself going backward in his work until finally he may be "out of a job" altogether. In every business and in every profession we are told there is always "room at the top." Here at the top is where you find the willing worker. What an army of unwilling workers then there must be in the world. There are far too many workmen who throw down their tools where they stand on the instant the bell announces '•quit work" and who will wait next day. patiently for the signal to begin again. Where you find one man who magnifies his office, by throwing his whole soul in his work, and bending every energy to success in it, you must find nine or perhaps ninety-nine who work mechanically. Even in the ministry there are men who are forever haunted with the fear of doing unrewarded work. I sup-pose it is true in every profession that the few willingly work for the work's sake, and the many struggle along merely as a matter of business necessity. This characteristic of will-ingness to work is to be seen in student-life, where habits of work are formed and fixed. Many boys, and girls, too, for that matter, are in college merely to "finish" their education, as if that were a thing possible of achievement, or to get a diploma, to be graduated. The result is they "finish" when they get their diploma. They are at the end of advancement then, and have reached the limit of progress. For the remainder of life, as up to that time work pushes theni, they belong to the great army of Unwilling workers. But he, who comes to col-lege not to "finish," but to fit himself for life work, not to get a diploma, but to get a basis lor future growth and development, will prove himself in all his college work to be a willing worker. When he leaves the college halls he will join the army of willing workers who adorn their profession or their business, and who are a power in the world. May the army of willing workers inc. ease ! G. DE ORATORE. [In anticipation of the coming oratorical contest and in order to arouse more spirit in the society work, we publish in this issue an article, entitled "De Oratore," by Morris W. Croll, '89, Professor in the University School, Cleveland, Ohio. The article was taken from the University School Record^ There has recently been a noticeable revival of public speaking as an art. While we were deploring the decay of oratory, we suddenly found that we had a number of public men be-fore us who, whatever their failings, are at least successful students of eloquence. The platform, with its pine table and its semi-circle of influential citizens, has again become a feature of political campaigns, and the square-jawed orator once more receives, with his hand thrust between the first and second buttons of his frock-coat, the wild greetings of his fellow-citizens. There has been, moreover, whether it is or is not due to the revival of oratory in politics, a similar revival in some of the largest col-leges. Everyone who has read the news-papers must have noticed that the debating clubs of Princeton, Harvard, Yale and "the Tech" have taken a prominent position among the student organizations of their respective institutions. In most large colleges there are now two rival societies, which command the respect and enthusiastic support of the student-body by the direct, simple and convincing ex-temporaneous speaking of their members. In short, it is evident that the old-fashioned de-bate has become popular. This is a consummation which many of us have devoutedly wished. The debating-club was the school in which Americans of the last generation learned statecraft. And they learned not only that, but two yet more desir-able things—the power, namely, of thinking at once rapidly and logically, and the power of putting .thought readily into consecutive language. The=e ends are as desirable, surely, for us as they were for our fathers. It is useless, however, to insist upon the THE COLLEGE MERCURY. 118 profitableness of debating. That is obvious. It is as a form of amusement, as a sport, that debating I think, is not appreciated. "The spice of life," says Stevenson, "is battle." Who would compare the enjoyment of seeing the best horse in the world run against an invisible record with that of seeing six raw-boned trotters striving toward the line at a country fair ? And who would not go further to hear a subject tossed about between affirma-tive and negative than to hear the same sub-ject expounded by its most learned advocate ? There may be some pleasures of which rivalry is not an element, but the sum and substance of all that which we call sport is eager compe-tition. And, with this definition in mind, I venture to say that there is greater striving, closer application of the powers of a man to a desired object, a narrower watch for advantage, and a quicker grasp of opportunity in a lively debate than in a foot-ball match. Consider, for one thing, how much depends upon the manner of marshalling facts. When you have ended you know whether or not each one has fitted into its place and helped to strengthen the whole. You know whether or not they are real, significant facts, and whether, if they are not significant, you have made them seem so. You know, too, if it is a good, fair-and-square extemporaneous debate, what you have forgotten and where you lost your grasp and failed to make your point; and you squirm with eagerness to try again. But it is all over with you. You have had your chance and either won or lost with it. You must await patiently the decision of the judges, who sit, like the fair ladies in the tournaments of old, ready to award the prize to the better combat-ants. Here is sport enough in all conscience, and nothing said of the hundred details of the game—of the skill in anticipating the oppo-nents' plan of attack, of the incidents that oc-cur, so unexpectedly, diverting the fight to this issue and to that, of the fine fencing with the swords of rebuttal and rejoinder which be-gins after the opening speech. Is it not clear that success in the art—or, let us say the sport—of debating requires rare qualities ? Finally, like all good sports, debating demands a fine balance of temper, equal parts of spirit and good humor; and he will be most success-ful and win most judges who is "eager to fight, yet not averse to quarrel." M. W. C. AN ADVENTURE. While the western sun was sinking On that feast-day of the Fall, Through the corridors we wandered Of old "recitation hall." On Professor Bikle's blackboard, As through his room we did pass, We had written our initials For to morrow's I^atin class. We had viewed the halls where students Oft orating, raise their voice, "Phrenakosmian" was quite nice, but "Philomatheau" was our choice. On the walls the shadows, deepening. Plainly marked the close of day. Warning us we'd miss our supper, Should we longer dare to stay. Dearer joys there are than supper, (Leastways on Thanksgiving Day) So we tarried in the "Sweat-box" •Singing, "When I'm far away,'' "Sometimes you may think of me dear." And the old familiar song Had, to me, peculiar meaning As we sang it, lingering long. Groping then adowu the stairway, We were one and all quite shocked, On arriving at the entrance, There to find the door fast locked. We might shout from out a window To some passing boy or man, But, for several obvious reasons, We objected to this plan. In our minds there was strange mixture Of amusement and dismay, When we found to leave this prison There was but one other way. We must stumble up that stairway To the gloomy upper floors, Down the fire escape and exit Through two swinging iron doors. In this pleasant manner, took we, Down through tower dark and tall, Unconventional departure From the recitation hall. I will ne'er forget that visit, Neither do I think will you, To that building of the college Of the "orange and the blue." M. G. IK) THE COLLEGE MERCURY, AN APPEAL TO THE ALUMNI AND FRIENDS OF THE COL-LEGE FOR SUPPORT OF THE "SPECTRUM." The Junior class would respectfully call the attention of the alumni and friends of the col-lege to the Annual soon to be issued by its representatives, the '98 "Spectrum" Board. The "Spectrum" idea has always been cordi-ally endorsed by the Faculty ; the students in college are enthusiastically co-operating in the consummation of the special plans designed for the forthcoming Annual ; the class of '98 is unanimously as well as heartily supporting the work now devolving upon its chosen rep-resentatives, and the Staff of editors and man-agers itself is using every endeavor to publish a "Spectrum" that will be a lasting credit to the college and the class. That the Staff will be able to accomplish this desideratum, with the co-operation of the student body and the alumni, it feels entirely confident. Numerous decided improvements over former Annuals have been devised and several entirely new features will be presented. Sta-tistics and historical data in regard to college events of the past year and with reference to the classes, fraternities, societies, athletics, as-sociations, etc., etc., will receive special at-trition. Original literary contributions, of a character suitable for the "Spectrum," will be given the prominence they deserve. ' In order to make the '98 "Spectrum" of particular interest to the Gettysburg graduates a large section of the book will be devoted en-tirely to the alumni. This department will comprise all of the statistics, etc., given in the '93 "Spectrum," revised to date, and, besides, will comprehend many new and additional lads and features of interest and value to all who are in any way interested in the affairs of Gettysburg College. The Staff, in the arrange-ment and compilation of this department, have been fortunate in securing the kind assistance of an able and enthusiastic Gettysburg Alum-nus. The Staff feels assured that this part of the volume will be generally considered of special importance and no labor will be spared to make it the most complete and valuable alumni record issued within recent years. Suggestions in regard to this department as well as to any other matter relating to the book will be very thankfully received. General communications should be addressed to the Editor, E. W. Meisenhelder. The Staff earnestly appeals to the alumni for financial support of the "Spectrum." Prac-tically every student at Gettysburg has favor-ably responded to our solicitation for subscrip-tions and we respectfully urge every alumnus to do likewise. Many graduates have already placed their names on our subscription lists, but we hope to receive many more before the next term opens. Subscriptions given to any of the students during vacation will be promptly transmitted to the Staff. Business communications should be addressed to the Manager, S. M. Lutz. We hope to make the '98 "Spectrum" the very best annual ever published at Gettysburg. To do so, however, it is quite obvious that we must have the united support of the alumni. The student-body is doing its full share to aid us in every way. May we not hope that the alumni will freely give us the material assist-ance we need in order to publish an Annual that will be received by every friend of the college with a feeling of real pride and pro-nounced gratification? We mean to leave nothing undone to perform completely the part expected of us. Will the alumni do theirs ? We make an earnest appeal for unanimous support. May this sentiment now, and al-ways, receive universal approval and adop-tion—" Every Gettysburgian for the 'Spec-trum' and the 'Spectrum' for Gettysburg." THE STAFF. Why don't we have a few class games of foot-ball. Last year these were among the most interesting we had. Surely there is good material in all the classes—especially, the Freshman. THE COLLEGE MERCURY. 120 A LULL FROM THE HIVE. Be earnest forever ! Be this our endeavor ! Be honest, be cheerful, be kind ! Making the spirit the test of our merit, To outward appearance blind. Our memory Will cherished be By teachers and class mates and friends If efforts are made towards these ends- Whenever you roam from the pales of your home In the bright sunny days of a spring, You see the bees gather from forest, from heather, Golden stores while they buzz and they sing. They nectar sip From lilies' lip Which gives to them food and good cheer When days become cold, lone, and drear. In the spring of our life, when earth's joyous and rife, And all things are happy and gay, When song birds are filling the air with their trilling, Your honey, O store, while you may ! When days of gloom And sadness come. The heart and the memory will hold Its treasures more precious than gold. W. H. B. C, '99. COLLEGE LOCALS. EbMUND W. MEiSE.NHEi.niiR and E t,. ROLLER, Editors. Dr. N. (to 190b Cadet who is verj' much in-teiested in something between himself and the board)—Mr. K., you had better take that to the window where you have better light. Mr. S., '99, recently went out after turkeys. After a walk of about four miles and a half, he arrived at the desired place. Cautiously walk-ing along a fence, he is surprised by the owner of the property who immediately begins to shoot. Walton now held up his hands and said, "I surrender." But when three men strive to tie him he makes a brave fight and finally succeeds in gaining his freedom. Now knocking two of the men down he makes a bold dash for the road. The men follow in hot pursuit and Walton falls over a plow. Never losing his presence of mind, he immedi-ately jumps up and runs into a brook. Hav-ing thrown the pursuers from his track by this piece of strategy he proceeds to a neighboring woods where he lies behind a log. till late at night. Finally he makes his way home where he is received with open arms by his worried com-panions. The MERCURY extends its sympathy to Mr. S. for injuries received. Dr. N. (to Mr. D., 1900, who is up at the board and holding a book under his coat), "You might injure your arm.by holding things so tightly under your coat." Mr. E., '99, tells us "many of our presi-dents had a very humble beginning, for in-stance, George Washington the rail-splitter." Prof. Van O., in Prep. Greek, to Mr. M.— "Have you Kelsey's edition?" Mr. M.—"No, sir." Prof. Van O.—"Who's have you?" Mr. M.—"Anabasis'." Mr. D., 1900, says that "James II, of Eng-land, w7as of a weak character because he chewed tobacco." Dr. B.—"Mr. M., what was the Koran ?" Mr. M., '97.—"An officer appointed by—" Class laughs and Mr. M. stops short in his explanation. Mr. R., '99, would like to know who Mr. Hastings is and what position Mr. Hastings is holding in Penn'a. Mr. K., '98, (translating German),—"My hat fell down confused." Prof. K. (to Mr. B., '98, who has been sleeping and has been rudely awakened to re-cite)—" Mr. B. you ought to feel refreshed after your little nap." Dr. B.—"If your eyes were shut how would you recognize Br." Mr. F., '98.—"By its color." Mr. B., '99, (in gymnasium and talking to Mr. L., 1900)—"M. L,. don't get on those mats with your feet." William Harrison Winfield R., of Prep., re-cently jewed a town storekeeper five cents on a broom. After a vain effort to jew him more he asked him, "Wouldn't you just wrap it up since I don't like to carry a broom along the streets ? " Mr. M., '99, (explaining the habitability of the moon)—"The moon revolves around the sun and has its own moon and is inhabited and the inhabitants revolve on their axes. Mr. G. 1900, wishes to borrow a horn, on which he wishes to increase his breathing ca-pacity ; Dr. S. having marked him minus. Every evening, about dark, G. will stick his head out of the window and look around to see if any one is near. If no one is near, he will blow a feeble blast on the horn and quickly withdraw, appreciating the joke hugely. We wish Mr. G. all success in his efforts. Mr. E., 1900, recites with great feeling and with good effect, "God bless the man who first invented sleep." I .'I THE COLLEGE MERCURY. Prof. K (to Mr. B., who is reading an es-say)—" The last sentence is not correct. Can you tell me why ? " Mr. B., 1900—"It is too much like a Soph-omore's writing." Prof. K.—"That's right. Quite a number of pretty words which mean nothing." Overheard at the W. M. R. R. depot from the lips of a young lady : "Well, Mr. A., I think you are the nicest man on earth." Ernie, '97, is strictly in it. Several bright Sophs intending to have some fun paid a visit to "Jess" K. the other night. Cayenne pepper was wafted about the room and burnt in the flame of the lamp. "Jesse" stood the test very well and . the "Sophs," after a short while, were compelled to leave. A more crestfallen crowd would, with difficulty, have been found. It was plainly a case of "the hunter hunted." Josey K., '99, who is a remarkable wit, said that "T., '99, received a ten for night work." Joe had reference to the Prep. fire. "Stocky" recently asked on what date New Year came last year. Mr. F., '98, has a new way of getting off from reciting Greek—he hides his book when the recitation period comes. Prof. Klinger is on to it, however. Prof. K. (in Greek, to Mr. B., '98, who has just flunked)—"Mr. B., I supposed you would have been better prepared to recite after your pleasant little nap." The back row in Lab. of the Classical Jun-iors have suddenly been deprived of the sober-ing effects of the presence of Mr. A. B. B. V. O., who departed for more peaceable climes about a week ago. "How can a fellow do sat-isfactory work, Mr. Stover, when there are a lot of bums banging around ? " The standard of the college is surely being raised, at least the standard of the Sophomore class, when a '99 man discourses fluently upon the Darwin theory—as was heard a few days ago. Truly we have "all sorts and conditions of men" around here, Darwinites, Silverites, Atheists and Preps. Mr. H., 1900, received quite a "moist" re-ception at the rear door of middle division lately. It always pays for a Freshman to "look aloft," especially when he has his Sunday clothes on, for the more moisture greens re-ceive the longer they will retain their verd-ancy. Mr. S., 1900, was lately giving his opinion about a certain "dramist." We suppose he meant "dramatist," but then he's only a Freshman and will learn. Prof. H., in teaching Anglo Saxon, has at last succeeded in impressing upon the mind of Mr. L-, of the Dummies, '98, that we get from the old English gumena our word grootn. "You may have occasion to use it some time." Mr. F., '98, (in Anglo Saxon)—"And he hastened about an ell.'' Prof. H.—"Mr. F., he wouldn't have has-tened very far in that case, would he?" A word about the College Musical Clubs. The very creditable manner in which they fur-nished the music for the recent Adams County Institute has again brought them before the people. The music this year, both of the Glee Club and of the Violin Quartet, has been very much better than any before given— simply the result of diligent and frequent prac-tice. The Glee Club has been rather unfort-unate in losing temporarily its second bass, Mr. Manges, whose larynx was injured in foot-ball practice, but his active and neces-sary work as manager has still continued. The clubs are in good condition now and the stu-dents in general will lose nothing by taking an interest in them—for they represent the col-lege musically, as the foot-ball and base-ball teams represent it in the capacity of athletics. The Juniors are writing plays for Prof. Himes. The whole college is awaiting the re-sult anxiously, for they will no doubt revolu-tionize the whole dramatic science. They range all the way from Adam and Eve to the Judgment Day. One of the sources of pleasure of the last month, was Dr. Everett's lecture on "Our Girls." A fair sized audience greeted him, which, however, should have been considera-bly larger, in view of the frequent announce-ments. The lecture was very entertaining, brim full of humor and anecdotes. We all , want to hear the Dr. again. Overheard in the Shakespeare recitation : T., '98—Say, Nick, what does "Gervinus" mean in the notes to the plays ? Nick, '98—"Why, that's the German for the author of the notes.'' S., 1900, seems to take quite an interest in the establishment of the Battlefield Photo-grapher. If he wants his pictures taken free, he is certainly going to lots of trouble. There i may be other reasons. THE COLLEGE MERCURY. This is about the time when the Sophomores ; are beginning to put on a little dignity. How- ' ever, they cannot overcome their little habit of giving their class yell every time they see a Freshman walk across the campus—just to show him how brave they are. Our society reading rooms are being mis-used by some of the fellows—especially by non-society men. They ought to realize that the rooms are for "reading," and that for this absolute quiet is needed. They were not fitted up for club rooms or places to play foot-ball. If everyone would individually realize this fact and respect the rights of his fellow student, it would certainly be better for all concerned. "Bobby" W., '98, has lately been quite at-tentive to the fair sex—one of them. This is quite surprising, viewed from our past knowl-edge of W., but then it must happen to them all, and Bobby has been captured. Congrat- | illations. During the recent convention of the Adams County Teachers' Institute some of the college fellows—especially those of the musical clubs— had the pleasure of associating with Prof. Park-er, of Binghampton, N. Y., and who conducted the music. He is a jovial good fellow, and took quite an interest in the boys, as did the boys in him. He sang several solos at the In-stitute. "Herbie" F., '98, recently in chapel one morning uttered quite a feminine shriek. It is said he "saw snakes" —one, anyway. The latest capture that the girls of Gettys-burg have made is "Albertus." Well, well, will wonders never cease ? We thought he was hardened. It is said, too, that the young ladies have been also inquiring earnestly after Fv '98. One of the fellows recently in German used the word "compar-able," accenting the second syllable. Dr. M.—"I would pronounce that 'com-par-able.' " "Since when ? Thats the first time I ever heard it pronounced that way." Dr. M.—"Well, you are not so old that you can't learn a few new things. There are many things happening continu-ally in and about college that would make very interesting items among the locals, but which never get there because they never reach the ears of the editors. It is the duty of the fellows, and to the interest of them all, that they hand such things in to the local de-partment, and thus increase its interest. Very few items are handed in and the editors have to do entirely personal work in getting such as do appear. We ask your assistance. The skillful investigation of scientific intel-lect, expanding in every direction, will ever bring to light new and wonderful discoveries. Following close on the disclosures made by the now famous Roentgen, which prove that cer-tain rays of light can be made to pass through even the obtuse head of a Sophomore, the an-nouncement now issues from the Chemical Lab. Dept., that the fruit of the genus Dios-pysos Virginiana of the natural order Ebena-ceae, commonly called "persimmons," may be obtained from the Platanus Occidentalis or syc-amore tree. This startling fact, like so many others in the scientific world, was chanced upon by the "Professor" quite accidentally, but that makes it none the less interesting. Samples of the delicious fruit recently secured, and a full explanation showing with what ease and rapidity it is digested, may be obtained upon application. Be sure that vou are not faked. ALUMNI-I. C. MANGES and CHARLES H. TILP, Editars. '41. St. Paul's Lutheran church, of Steel-ton, Pa., and the new church at High Spire, Pa., are to be formed into one charge. Rev. E. Miller, D. D., will be the pastor. '44. Rev. Peter Anstadt, D. D., of York, Pa., is considering the question of publishing a biography of the Rev. Doctor Ezra Keller, '35- '45. Rev. J. F. Probst has left Asbury Park, and will spend part of the winter at Ashville, N. C. His health has not improved to such an extent that he is able to resume the active work of the ministry. '46. Rev. Conrad Kuhl, D. D., prepared the history of the Central Illinois Synod for the 50 years of its existence, that was read by Dr. Rhodes, at the convention held at Hills-boro, 111., in October. '48. Many requests have come to Rev. P. Born, D. D., especially from former Theolog-ical students, to have his Inductive Bible Study ot the Old and New Testament issued in book form. Now that he has retired from active work as professor the call comes louder than l-?l THE COLLEGE MERCURY. ever. The work will compose a volume of about 300 pages. '50. Dr. M. H. Valentine's new book on "Ethics," will be out before Jan. 1st. The work will be used as a text-book in our col-lege. '52. Rev. Prof. John J. Scherer, of Marion, Va., has returned from a trip to Texas. '54. Rev. John Tomlinson, Dixonville, Pa., has compiled some valuable statistics, which appear in the Lutheran World of Nov. 26th. They are worthy to be read and pondered. '55. Rev. P. Bergstresser, D. D., of Rock-wood, Pa., spent vSunday, Nov. 22, in Alle-gheny City and filled the pulpit of his son, Rev. Fuller Bergstresser. '57. Rev. H. L. Baugher, D. D., has been elected Managing Editor of The Lutheran Wo//,/. The Doctor will give his undivided attention to this arduous and responsible work. This excellent paper is indeed fortunate in se-curing the services of so learned a man. '58. The Lutheran Observer of Nov. 20, con-tains a poem entitled, "Nearer Home," by Rev. B. H. Hunt, that was written and pub-lished in the Observer while the author was a student at college. The song is found in many song books. '59. After nineteen yearsof editorial service, Rev. J. H. Sieker has transferred the editor-ship of Zeuge die Wahrheit, to pastor Stack- In^/., of Paterson, N. J. '60. Rev. Prof. M. H. Richards, D. D., de-livered the first of a series of lectures at the Moravian College, Bethlehem, Pa. His sub-ject was, "An Excursion to Eden." The lec-ture was highly praised and the students and friends are looking forward with pleasure to the second lecture, soon to be delivered. '61. Rev. L. Grab has accepted the call of St. Mark's church, Omaha, Neb., and is at work in his new field. '62. Rev J. B. Keller, late pastor at Smiths-burg, Md., will spend the winter in Georgia. '62. The corner stone for the new Lutheran church at Vandergrift, Pa., was laid on Thurs-day November 12th. The sermon was preached by Rev. M. I,. Culler, president of the Pitts-burg Synod, and the cornerstone was laid by Rev. J. W. Poffinberger, '72 of Leechburg, Pa. '62 Prof. H. E. Jacobs, D. D., LL- D., president of Mt. Airy Theological Seminary, Philadelphia, filled the pulpit of College church, Sunday, Nov. 15. '63. Rev. J. L. Smith, D. D., of Pittsburg, Pa., on Sunday, November 29, organized the St. Paul's Evangelical Lutheran church of Wilkinsburg, Pa. This is the first Lutheran congregation organized in that thriving town, and was brought about through the untiring efforts of Dr. Smith. '63. The November number of The Luth-eran contains an obituary and cut of the late Prof. Davis Garber, Ph. D. Muhlenberg Col-lege, where he labored for 26 years, has sus-tained a great loss in his death. '63. Rev. E. J. Wolf, D. D., recently at-tended a meeting of the Common Service Com-mittee at Alleutown, which is now preparing a Liturgy. '64. Friday evening, October 30th, the Rev. J. G. Griffith, pastor of the English Lutheran church, Lawrence, Kansas, by request, deliv-ered an address on the Reformation of the 16th century to about 400 Indians at Haskell Insti-tute. '64. The Zanesville, (O.,) Times Recorder of Nov. 30th, contains an account of the 20th anniversary service held in St. John's Evan-gelical Lutheran church of that city. It gives a review of the work done by the pastor, Rev. Frank Richard, D. D., during his long service in this church, and shows that the work has prospered in his hands, during the past fifth of of a century. The ladies of the church gave an elegant reception and reunion at the par-sonage, on Nov. 26, in honor of the occason. '65. Rev. Joseph Hillpot died on October 30th at Quakertown, Pa. He was a member of the Pennsylvania Ministerium. '69. Dr. J. A. Clutz and Rev. H. L. Yar-ger, '83, assisted at the dedication of the First church of St. Joseph, Mo., on November 15. '73. Rev. T. J. Yost, of Cumberland, Md., preached the sermon at the opening of the State Convention of the West Virginia C. E. Union held at Clarkesburg, W. Va. '73. Rev. J. A. Singmaster, D. D., Allen-town, preached the sermon at the dedication of St. Matthew's English Lutheran church, Brooklyn, on Nov. 12. He also presented the chancel windows given by Hon. and Mrs. Schieren. THK COLLEGE MERCURY. 124 '73. Rev. Chester H. Traver, late of Rhine-beck, New York, has taken charge of the Lutheran church at Churchtown, New York, and thus succeeds the late Doctor Marcus Empie. '77. Rev. J. A. West has taken charge of the Lutheran church at Londonville, O. He has been warmly received by the people of his I charge. '77. The congregation of Christ Lutheran | church, of Los Angeles, Cal., of which Rev. j M. H. Stine, Ph. D., is pastor, dedicated a new j pipe organ on Sunday, Nov. 15. Rev. Stine has been very successful as pastor of this church, j '78. The good Lutheran people of Palo, 111., are arranging to care for their pastor, Rev. Holmes Dysinger, right royally. The founda-tion is already laid for a fine $3000 parsonage, to be built of dressed stone in harmony with the church itself. '78. Rev. O. C. Roth, pastor of Grace Eng- ! lish Lutheran church, Broadway and Gough street, Baltimore, Md., commemorated his seventh year as pastor on November 2nd. He preached two sermons on the event. '79. The new Lutheran church in Benders-ville, Rev. U. A. Hankey, pastor, is to be dedicated on the second Sunday in December. Dr. E. J. Wolf and Rev. H. H. Weber will have charge of the services. '80. Rev. M. F. Troxell, D. D., of Spring-field, Ills., preached an eloquent sermon on the Reformation, in Grace Lutheran church of that city. '81. Rev. J. W. Byers, D. D., of Nevada, 0., and the people of his congregation royally entertained the Eastern Conference of Witten-berg Synod, during its 97th convention, which was held in Nevada, O. 82. Rev. Chas. R. Trowbridge will spend the winter in Easton, Pa., where he has taken up work in his new charge. '82. Frank E. Colom, Esq., is one of the best and most active lawyers at the Bedford Bar, and a worthy son of his Alma Mate). He was elected president of the Bedford County Sunday School Association, at its 15th annual convention, held at St. Clairsville, Pa. '83. Rev. W. W. Anstadt has accepted the call to Hollidaysburgh, Pa. He will take charge of his new field on the first Saturday in December. '83. Rev. L. M. Kuhns, of Omaha, Neb., laid the corner-stone for his new church a few weeks ago. Rev. H. W. Kuhns, D. D., '56, was present and participated in the services. '83. Rev. H. L. Yarger assisted Rev. W. F. Rentz, of Atchison, Kansas, in a series of special services, and proved himself a valuable assistant. '84. Rev. L. M. Zimmerman, Baltimore, Md., is preaching a series of sermons on "Pil-grim's Progress." One of the subjects was, "The Pitfalls to Young Men." '85. Rev. A. F. Richardson, of Grafton, Wt Va., was unanimously elected president, for his third term, of the West Virginia C. E. Union, which convened in Clarkesburg, W. Va., Nov. 18. '87. Rev. Herbert C. Alleman will be in-stalled pastor of College Church December 6, Rev. Alleman, D. D., of Lancaster, Pa., and Rev. J. C. Kohler, D. D., of Hanover, Pa., are the committee on installation. '90. On Nov. 8th, the cornerstone of Beth-any English Lutheran church, New York City, was laid by the pastor, Rev. J. Fred. W. Kitzmeyer. '90. Rev. Oscar H. Gruver has resigned as pastor of the First English Lutheran church, San Francisco, California. 91. Rev. Stanley Billheimer, Washington, D. C., was in Gettysburg Thanksgiving Day, visiting his parents, Dr. and Mrs. Billheimer, '91. Rev. S. Gring Heffelbower has been called to Mauheim, Pa. '92. Rev. George Beiswanger, pastor of Calvary Lutheran church, Baltimore, Md., en-tertained the members of the present and retir-ing church councils at the parsonage, Thurs-day night, October 22nd. '92. Rev. Edward O. Keen completed his studies in the Reformed Theological Seminary, Lancaster, Pa., in May last, and is now pastor of St. Paul's Reformed church of Waynesboro, Pa., having begun his work there Aug. 1, '92. Rev. D. P. Drawbaugh, McConnells-burg, Pa., has been doing faithful and thorough work in his field and his efforts have been crowned with excellent results. '93. Rev. Marion J. Kline preached the first of a series of four sermons on "The Life of Joseph" in Bethlehem Lutheran Tabernacle, Harrisburg, Pa., on Nov. 15th. The audience was large and the discourse was exceptionally fine. I •■■ THK COLLEGE MERCURY. •93. Rev. \V. S. Oberholtzer has changed his address from MifBjntown, Pa., to Harbin, Indiana. '93. Rev. F. II. Knubie, of New York city, has accepted a call to begin a new English Lutheran church on the west side of New York city. '93. The English Evangelical Lutheran church, Jersey City, Rev. E. E. Neudewitz, pastor, was the recipient of a very costly pul-pit Bible recently. It was given by a member of the same. '93! Rev. John C. Rowers was installed as pastor of St.'Mark's Lutheran church, Wash-ington, I). C, 011 Sunday, November 15th. The charge to the pastor was delivered by Rev. M. L. Beard, '75. of Middletown, Md., and that to the people by Rev. Geo. S. Bow-ers, of Hagetstown, Md. '93. Rev. G. W, haulers, Jr., of Argusville, N. Y., delivered a lecture on "Normal Train-ing in the Sunday School," before the Sharon Institute, at I.ecsville, N. Y., on November 17th. His address was instructive and well received. '93. On Sunday, Nov. 29th, Rev. Wm. C. 1U finer formally began work in his new field at Fayetteville, Pa. '93, The examining committee of the York Bar'met Nov. 20, to examine P. M. Bortner, who has been reading law with Niles ec Neff. Mr. Bortner passed a very creditable examina-tion, and on the motion of J. E. Vandersloot, Esq., a member of the committee, was admit-ted to practice at the York County Courts. '93. Rev. A. A. Kelley was installed pastor Of the Trindle Springs church, Sunday, Nov. 8. Since he has been pastor of this church the membership has been doubled. Rev. and Mrs. Kelley were visiting friends in Gettysburg, Thanksgiving Day. • '94. Herbert A. Allison is a member of the faculty of Susquehanna University. The Oc-tober "number of The Susquehanna contained a good cut of him. His department is the Greek language. '94. Prank E. Pickinger, principal of Cham-bersburg schools, was manager of the foot-ball team, composed of ex-college players, that played our team Nov. 21, on the new athletic held. '96. W. H. Mengcs was captain of the York V. M. C. A. foot-ball team tins fall. ATHLETICS. CHARLES T. LARK, Editor. Gettysburg, 6—Maryland University, o. Gettysburg, 58—Chambersburg ex-college plavers, o. Gettysburg, 64—Western Maryland Col-lege, o. Maryland University having 700 student from whom to select, as a matter of course, has a strong foot-ball team. This eleven, by its excellency on the gridiron, has won for itself the championship of Maryland. It is com-posed of a set of big fellows, almost all of whom have had years of experience in their respective positions. In spite of the fact that our grounds were wet and soggy, the game between Gettysburg and the above mentioned team, on Nov. 14th, was one of unusual inter-est. The players were about evenly matched as regards weight. The playing was so sharp and close that almost through the entire game it looked very much as though neither side would score. Deuson, the left half-back and Capt. of M. U., although the lightest man oh the team, played a most brilliant game. His three years experience on the University of North Carolina eleven, showed up to a good advantage and his work received merited ap-plause. Too much can not be said in praise of Capt. White and Lawyer for their magnificent play-ing. They always play a good game but in this particular one they excelled themselves. Their runs and tackles were the feature of the daw Had our team made more preparation for this game than it did, we would have won by a larger margin. M. U. kicked off and the ball was downed on our 30-yard line. By an elegant exhibition of team work," our fel-lows took the leather from this point to our opponents' 10-yard line, where it was lost on downs. Through the successful use of a quar-terback kick, and their quarter proved himself an adept at this, they captured the hall on their 30-yard line. The ball changed hands ofteu but we finally forced it to their 2-yard line where, on an account of an unfortunate I fumble, they obtained possession of it and again advanced it somewhat down the field, it being on their 20-yard line when the first half ended. The second half was marked by many fine plays. The ball was kept entirely within the territory of M. U., nevertheless it changed hands frequently. . During the last five min- THE COLLEGE MERCURY. [26 utes' play our men summoned all their strength for one mighty effort and after a series of de-termined, desperate rushes, the ball was taken across the line by Capt. White after a 25-yard run. The crowd yelled itself hoarse. Dale added two more points by kicking the goal— 6 to o. Time was called a few minutes after the ball was again put in play. Among the distinguished spectators present were Congressman-elect Benner and Judge Swope. This was one of the most exciting games of the year and we take great pride in placing it under our list of victories. The line-up follows : MARYLAND UNIVERSITY. POSITIONS. GETTYSBURG. Allen left end Moser Steele left tackle Byers Gauss left guard Koppenhaver Riley centre Stifel McCain right guard Hagerman Lewis right tackle Nicholas Dawson right end (Kite) Doty Riddington right half back Dale Barrow quarter back Lawyer Armstrong full back Sheely Touchdown—White. Goal—Dale. Refree—Kump. Umpire— Kuendig. Linesmen—Steward and Leisenring Time of halves—25 and 20 minutes. Our students had anticipated a closer con-test than that which took place on Nov. 21st, between Gettysburg and an eleven from Cham-bersburg, composed of ex-college players. Although somewhat heavier than the oppos-ing team we should by no means have had the walk-over we had. Fine individual playing but lack of team work tells the tale for Cham-bersburg. Our fellows made gains wherever and whenever they desired. "Willie" Burns, 1901, played the star game and seems to be as much at home on the foot-ball field as in the box. We scored 32 points in the first half and 26 iu the second, making the total 58-0. Dale, 1900, missed but one goal out of ten. ■ The following was the line- up : GETTYSBURG. POSITIONS, CHAMBERSBURG. Stifel centre Sherrod Koppenhaver left guard Plank Hagerman right guard Shaefer Ott left tackle Brown Nicholas right tackle Parrott Doty right end Wragg Young (Loudon) left end Pierson Lawyer quarter Orr Burns left half back Smith Dale right half-back G. Fletcher Sheely fullback F. Fletcher Touchdowns—Burns, 3; Dale, 3; Nicholas, 1; Stifel, 1; Sheely, 2. Goals—Dale, 9, Referee—White. Umpire—Kuendig. Lines-men— Leisenring and Lark. Timekeeper—Wheeler. As a matter of course interest on Thanks-giving Day centers around the turkey, but foot-ball comes in as a very close second. This is the first time for a number of years that our team has played at home on this holi-day, and, as the day was pleasant, an enthusi-astic crowd of 500 people turned out to see us line up against Western Maryland College. This was the best game of the year, at least in one respect —in point of attendance. Western Maryland started the game with a dash, and for the first ten minutes' play held our eleven very nicely. They then lost confi-dence and their playing during the remainder of the game looked to the foot-ballist like the first attempts of a lot of novices, while to the referee it looked like 64 to o. Lawyer, 1900, was, unfortunately, physically unable to be in the game, and his position, quarter-back, was ably filled by Capt. White, whose place at left-half was filled by Burns, 1901. Dale, igoo, did excellent work in kicking ten goals out of eleven. In short each player played his position well. Line up: WESTERN MARYLAND. POSITION. GETTYSBURG.' Stiaugh. Reckford left half-back Burns Johnson left end Fite Joice left tackle Nicholas Little left guard Ott Satlerwight '. center Stifel Warfield right guard Hagerman Baker right tackle Manges Edwards right end Doty Zepp right half back Dale Patton quarter back (Capt.) White Crockett full back Sheely Touchdowns —Dale, 7; Burns, 2; Manges, 1; Hagerman, I-Gials— Dale, 10. Time of halves—25 minutes. Referee— Kuendig Umpire—Murphy. Linesmen—Wolf and Whalen. The feelings of a Gettysburg man, in look-ing over our record in foot-ball for the season which is just now past, can be but those of gratification and pleasure. We have indeed been eminently successful, having won six games out of nine, and to-day stand higher iu the foot-ball world than we have ever stood before. In spite of the fact that we contested with some of the strongest elevens in the coun-try, we have to our credit an even hundred more points than have been scored against us, as is shown by the following: State College, 40—Gettysburg, University of Penn'a, - 32—Gettysburg, F. & M., - 24—Gettysburg, Baltimore City College, o—Gettysburg,' F. &. M., Swarthmore, University of Maryland, Chamb'sbg ex-Col. pl'ys, o- Western Maryland Col., o-o— Gettysburg, 4—Gettysburg, o—Gettysburg, -Gettysburg, -Gettysburg, o. o. o. 50. 10. 12. 6. 58. 64. Totals, 100 200 127 THE COLLEGE MERCURY. Certainly this happy result of a seasons work demonstrates most clearly the value of a coach. We were very fortunate in securing the services of Mr. Best and our success is largely due to his efforts. He did remarkably well iii developing such a team from so many inexperienced players. Koppenhaver, 1900, Stifel, 1900, and Hag-erman, 1901, at left guard, center and right guard respectively formed a center which held like a brick wall against all our opponents. Each member of this trio, averaging 195 pounds of solid muscle, at the beginning of the season was new at at the game, but their de-velopment has been remarkable. They broke through constantly and opened up well for the barks. Ott, '97, Manges, '97, and Nicholas, '98, are the men who efficiently filled the tackle positions. "Pop" Ott is one of our old relia- ' bles and always played an aggressive game. The reputation of Manges as a ground gainer is thoroughly established, while "Nick," be-sides taking ample care of his man and mak-ing gams when called on, kept things lively by his seemingly inexhaustible supply of jokes. Doty, '99, Fite, '98, Young, 1900, and Lou-don, 1901, at the end positions, upheld the orange and blue. Although this is their first year on the team, they played like veterans. Doty, after having been tackled, is fond of shaking the man from him and going on. He is a hard man to down. Eite, besides being a good tackier, is a snappy player and runs well. Young and London each played a steady game and made their presence felt. Lawyer, 1900, as this is his second year at the position, has become quite proficient as a quarter-back. He keeps his wits about him and gets into the interference well. Sheely, '97, made many fine tackles and struck the line hard, besides kicking very cleverly. burns, 1901, Dale, 1900, and White, '97, played at half. The first one mentioned kicks well and runs fast. Dale is adroit at kicking, is a swift runner, a fine tackier and an all around good player. Capt. White seems to be entirely at home in the game. It is quite unnecessary to enumer-ate liis achievements and abilities as a foot-ball player, as he is a heady player, was always in the game, and was a source of encouragement to his men. Perhaps the secret of his ground-gaining, is the fact that he sticks like a leech to his interference. We must not overlook the second team which, under the leadership of Kuendig, '98, turned out so faithfully. Their services were of great value to the first eleven, as they there-by were given sharp, hard practice. The scrub contains many players of promise, among whom are : '98, Kephardt, Tholan, Briner, Kuendig; '99, Herman, Brumbaugh, Trimble, Roehner; 1900, Good, Wisotzki, Brandt, Kohler. As we lose but a very few men, the prospects for next season's team are of the brightest. Our players may now retire from the grid-iron and take merited satisfaction in looking over a season well spent. TOWN AND SEWJINARY NOTES. S. J. MILLER, Editor. TOWN. It seems as if improvement has become the ' adopted watchword of the town. Telephone wires by the dozen have been stretched across the diamond, thus to communicate with all the important neighboring towns in the county. The Water Company has enlarged the water supply by replacing the old pipes with larger ones. Several new and costly buildidgs have been erected, among which is the new school building, known as the Meade High School, and which in all probability will be occupied at the beginning of the New Year. The association of the survivors of the Twenty-first Regiment of Pennsylvania' Cav-alry recently held its seventh annual reunion in this place. About seventy-five members were in attendance. At a business meeting the following officers were elected: President, Major Robert Bell, Adams county; Vice-Pres-ident, Captain E. McMillan, Lancaster; Secre-tary, J. Harvey Cobean. Gettysburg; Treas-urer, Captain Long, Gettysburg. The anniversary exercises of the Women's Bible Society were held on Sunday evening, Nov. 15th, in Christ Lutheran church. Rev. Dr. Huber presided. Prayer was offered by Rev. Dr. Richards, of Gettysburg, and ad-dresses were made by Rev. Dr. Jacobs, of Philadelphia, and Rev. Dr. Morrow, Secretary of the Pennsylvania Bible Society, after which a very creditable report of the society was read by Rev. A. R. Steck, pastor of the St. James Lutheran church, this place. THE COLLEGE MERCURY. 128 The semi-annual convention of the Adams County C. E. Union was held in the St. James Lutheran church, this place, on Friday and Saturday, Nov. 20th and 21st. The conven-tion opened on Friday at 2 P. M. The ad-dress of Welcome was delivered by Rev. A. R. Steck and the response was made by Presi-dent Longanecker. The sessions were very interesting and were largely attended through-out the whole convention. Rev. C. H. Rockey, of Shepherdstown, W. Va., preached in Christ Lutheran church on .Sunday, Nov. 22. The Christian Endeavor Society of St. James Lutheran church held their eighth anniversary exercises on Sunday, Nov. 22. In the morn-ing Rev. E. F. Jeffers, D. D., Principal of the York Collegiate Institute, preached the anni-versary sermon. At the evening service Rev. A. R. Steck presided. An excellent program was rendered. Rev. Rockey offered prayer and Rev. Dr. Jeffers delivered the address of the evening, his subject being, "Spiritual Power.'' The old tin roof on the Methodist church has been removed and a slate one put on. The St. James and Christ Lutheran congre-gations held a union Thanksgiving service in St. James Lutheran church on Thursday morn-ing, Nov. 26, at 10 o'clock. Services were also held in the Presbyterian and Reformed churches in the morning. SEMINARY. Rev. J. E. Byers preached at Williamsport, Md., on Sunday, November 1. Rev. J. H. Harmes filled the pulpit of St. John's Lutheran church, Hagerstown, Md., on Sunday, Nov. 8th. Rev.' Paul Koller preached at Hagerstown, Md., Shepherdstown, W. Va., on Nov. 15th and 22nd respectively. Rev. W. H. Feldman was sent as a delegate to attend the Inter-Seminary Missionary Al-liance at Chicago, on Nov. 12- 15th. While there he also had the pleasure of attending the Luther League Convention. The pulpit of the Second Lutheran church, Carlisle, Pa., was filled by Rev. Brady on Sunday, Nov. 22. Rev. M. S. Kump preached in Christ Luth-eran church on Sunday evening, Nov. 29. Prof. J. H. W. Stuckenberg will deliver the following lectures in Brua Chapel, beginning with Monday evening, Dec. 7th: Monday—"The Importance and the Method of of the Deeper Study of the Age." Tuesday—"Characteristics of the Age." Wednesday—"The Dominant Ideas." Thursday—"Social Trend." Friday—The New Social Era." Saturday—"Higher Education in Germany." This is a new course of lectures prepared es-pecially for Gettysburg, and we are indebted to the Seminary students for his coming. FRATERNITY NOTES. PHI KAPPA PSI. A. J. Smith, '83, a Professor of the Univer-sity of Texas, recently suffered the loss of his wife. We were pleased to meet Dr. Philips, Presi-dent of West Chester Normal School, who de-livered a lecture before the Teachers' Institute convened in this city last week. J. C. Bowers, '93, made a business trip here a few days since. W. F. Lutz, '94, is engaged in journalistic work at his home in Bedford. A. C. Carty, '96, attended the New York City rally on Dec. 4th. . PHI GAMMA DELTA. Bro. Jacobs, '62, preached in the College church recently. Bro. Knubel, '93, has started a mission in upper New York City. We wish him success in his undertaking. Bro. Roth, '95, of Bucknell, spent a few days in town recently. We were glad to have with us during the past month Bros. Brewer, '83, Garland, '85, Fickinger, '94. Bros. Fite, '98, and Albers, '99, spent a few days with Bro. Stahler, of Norristown, Pa. Bro. Kolb, 1900, spent Thanksgiving at Mechauicsburg. SIGMA CHI. Bruce Trimmer, Kappa, '98, of Bucknell, made us a visit several weeks ago. Leisenring spent Thanksgiving with his parents at Chambersburg. I2CJ THK COLLEGE MERCURY. Win. Hersh, '92, was elected District At-torney of Adams Co., by the largest majority ever given a candidate. Rosensteel was called to his home in Altoona several weeks ago on account of the death of his grandfather. Edwards, Alpha Psi, Vanderbilt University, played end on the Western Maryland College foot-ball team in the game here on Thanks-giving. Munro and Fredericks were at their homes in Lock Haven over Thanksgiving. Frank Hersh, '92, who was home for several weeks, has returned to his work in Braddock, Pa. Keith, '99, paid a flying visit to the Chapter at Dickinson several days ago. Fredericks stopped at Bucknell on his way home on Thanksgiving, and visited the Chap-ter there. Lawyer spent Thanksgiving at his home in Westminster. PHI DELTA THETA. J. A. Singmaster, '98, was initiated Novem-ber 23d. Kain, '97; Meisenhelder, '97, and Beerits, '99, attended the 24th Biennial Convention of the fraternity held in Philadelphia Nov. 25th to 30th. M. F. Holloway, '84, and A. S. Cook, '95, were also in attendance. Chas. Reinewald, '88, spent a few days in town recently. J. C. Moore, Jr., Pa Zeta, paid the Chapter a visit the beginning of the month. ALPHA TAU OMEGO. Saturday night, Nov. 21, the Chapter held a banquet in the meeting hall, which was pro-nounced by those present to have been a very enjoyable affair. Edward Gaines, a member of the U. of Md. foot-ball team, spent Sunday, Nov. 15, with the Chapter. William O. Nicklas, '93, has been admitted to the Chambersburg bar. William H. Menges, '96, visited the Chapter during Institute. Dr. Franklin Menges, '86, was with us In-stitute week. James P. Michler, '97, is at present a stu-dent at Washington and Lee. SUBJECTS FOR "ROMAN LAW" THESES. ABEL—Spread of the Roman Law Through Barharic Invasions. ARMSTRONG—Marriage and Divorce Among the Romans. HIKLE—Influence of the Laws and Organization of the Roman Empire on the Laws and Organization of the Early Church. CLUTE—The Extent and Limitations of the Patria Potestas. COBLE, Sr.—Slavery Among the Romans. DUCK—The Indebtedness of Modern States to Roman Juris-prudence. FRIDAY—The Roman Law of Succession. HUTTON—Roman Citizenship-Different Kinds, How Acquired and How Lost. Miss KEITH—The Nature and Authority of the Jus Respon-dendi. MILLER—The Functions of the Roman Praetor. Miss SIEBER—The Roman Method of Legal Procedure in a Province as Illustrated by the Trial of Christ in Pal-estine. SMITH—The Roman Judiciary System. WHEELER—The Change from Republic to Empire in Rome, a Change to nu Autocracy. WOLF—Influence of Christianity on Roman Legislation. LITERARY SOCIETIES. JOHN W. OTT, Editor. PHILO. Messrs. Baker and Markel were initiated during the past month. On Friday night, Dec. nth, Philo will render her last special program of the term. The program promises to eclipse all others. PHRENA. Messrs. Gilbert and Hitchner. both of 1900, were elected members last Friday evening. On account of the various interruptions 011 the several past Friday evenings, Phrena will not render.her next special program till next term. EXCHANGES. The MERCURY is at present receiving a very large number of exchanges. We mention some of them as follows: The Lafayette, Ursinus College Bulletin, Bucknell Mirror, F. and M. Weekly, College Folio, Phoenix, Wittenburg, Midland, Mer-cersburg Monthly, Roanoke Collegian, Dela-ware College Review, Dickinsoniau, Monthly and Weekly, Occident, Mielensian, Lutheran Ensign, National Educator, Muhlenberg, Ora-cle, Lutheran Observer, Perkiomen Seminary Bulletin, Free Lance, Susquehanna, Western Maryland College, Augustana Journal, George-town College Journal, The Reflector, The Mountaineer, The Crescent, Orange and White. ADVERTISEMENTS. Yale annually buys $7,000 worth of books for her library. Harvard expends $15,000 for the same purpose. Columbia expends$43,000 in the same way. A National University, under government control, is to be established in China. The faculty will consist of foreigners. The first president will be a former tutor of Li Hung Chang. "Age comes to every man, hut fate Is kind to women fair ; For when she reaches twenty-eight, She stops right then and there." FPU. H. WIlNNlCrl at onfeetionmj I OYSTERS Manufacturer, Wholesale and Retail Dealer in peam. ] SEASON. NEWS DEPOT & SUBSCRIPTION AGENGY. IVIaln street, - - Gettysburg, F=a. SOLE MANUFACTURER OF DR. TYLERS COUGH DROPS TIMNTCODORT DEALER IN BEEF, PORK, LAMB, VEAL, SAUSAGE, York Street, Gettysburg. a-Speclal Ratesto Clubs."a R. A WONDERS^ Corner Cigar tParlors. ,.A FULL LINE OF. CIGARS, TOBACCOS, PIPES, &C, Scott's Cor. Opp. Eagle Hotel, Gettysburg, Pa. T« F. HBNSTXG utn\.tR \u BREAD, ROILS, PRETZELS & CRACKERS YORK STREET, GETTYSBURG. 8@TReasonable Rates to Clubs. L. Dm lf|ILLLl\j GETTYSBURG, Qrocer, (^onfeotioneT and fruiterer. Ice Cream and Oysters in season. /,. Foot Ball Supplies. EVERYTHING FOR THE PLAYER, Jackets, SHoos, Stockings, Jerseys, Shin Guards, Etc. Spalding's Official Intercol- A^cj 'Mffift legiate Foot Ball, '*^^F^. Officially adopted by the Intercollegiate Association. COMPLETE CATALOGUE FALL AND WINTER SPORTS FREE. A. G. Spalding: & Bros. NEW YORK, PHILADELPHIA, CHICAGO. 1108 CHESTNUT STREET, PHILADELPHIA Xl/righi's Qngraving jfeouse 'AS become tile recognized leader in unique styles of COLLEGE and FRATERNITY EN-GRAVINGS and STATIONERY. College and Class-Day Invitations, engraved and printed from steel plates;. Programmes, Menus, Wedding and Reception Invitations, Announcements, etc., etc. Examine prices and styles before ordering elsewhere. 50 Visiting Cards from New Engraved Plate for $1.00. ERNEST A. WRIGHT, 1108 Chestnut Street, PHILADELPHIA Visitors to Settysburg College, Settj/sburg, !Penn'a, Will find the CUMBERLAND VALLEY RAILROAD running in a South-Westerly direction from Harrisbnrg, Pa., through Carlisle. Chambersburg, Hagerstown an I Martinsburg to Winchester, Va., a direct and available route from the North, East and West to Gettysburg, Pa., via. Harrisburg and Carlisle. Through tickets via, I his route on sale at all P. R. R. offices, and baggage checked through to destination. Also, a popular route to the South via. Carlisle. AsK for your tickets via. Cumberland Valley Railroad and Carlisle, Pa. J. F. BOYD, Superintendent. H. A. RIDDLE, Gen. Passenger Agent. ADVERTISEMENTS L M, BUEHLER, SUCOKSSOU TO A. D. BUEHLEK & CO., -HllBoofig st£giS —.A_isr:D— (gO TO ->M0TEL GETTYSBURG* -XBA'RBER SIIOPX-Centre Square. ^^B. M. SEFTON. 2/ou will find a full line of SPure 'Drugs dc J'ine Stationery ^People'a *Druff Store. {Prescriptions a Speci'ctity. Elliott & HOUSGP. H. B.—Stiff Hits mads to Fit the Head is two minutes. (Z>, B. KlTMpLEfJ, HATS, CAPS, —^ ^rr BOOTS* SHOES. CS^3=S=»tisfaiotion GSuara nteed.ii3 No. 6 S. Baltimore Street, GETTYSBURG. PA. por all the latest styles in Suitings and-Trousers, AND FULL LINE OP Cents' Furnishing Goods, CallonD. H. WELSH, York, F>a. ADVKRTISKMKNTS. DURING VACATION GO TO CHAUTAUQUA F~ F? El El FULL INSTRUCTIONS. NO EXPERIENCE REQUIRED H. B. WILLIAMS, Secretary, Geneva, N. Y. YOU CAN KAKN Sill To SUM) MONTHLY AND KXPKNSICS IF YOU WORK FOR THE NURSERY CO. Stock sold with a guarantee and replaced. ~R.$H.$REMINGER,~ MERCHANT TAILOR. fH?e Best Work at tJye Lowest Wees. NEXT DOOFJ TO POST OFFICE, UPSTAIRS. Suits from $121 to $40,00, Pants from $4,00 to $12,00, G^Centre Square, gQLLEGE OF PHYSIC&NS 1 SlTftGEONS, -BALTIMORE, W|D.-^ The College of Physicians and Surgeons of Balti-more, Maryland, is a well-equipped school. Four ses-sions are required for graduation. For full informa-tion send for the annual catalogue, or write to THOMAS OPIE. M. D. Dean, Cor. Calvert and Saratoga Sts. <_g^Established 1876.5^^—3 ^iPBNfiOSR MYBfiSjfe- WATGHMAKEE AND JEWELER, Gettysburg Souvenir Spoons, College Souvenir Spoons, No. 10 Baltimore Street, GETTYSBURG, PENN'A. J. A. TAWNEY Is ready to furnish clubs and boarding houses BREAD, ROLLS, &G., at short notice and reasonable rates. Cor.Washington and Middle Sts., Gettysburg. fiSSSS^Si^ m*w^i^^jid^wo^^*a WEiWIilHoNJflS DEALERS IN Fresh Beef, Veal, Lamb, PorkLJ Pudding, Sausage, HAMS, LARD, &c-., GETTYSBURG, l\jr\J'A. JOEKL. SHERDS. NEW CIGAR STORE Next door to W. M. Depot, Gettysburg,

Issue 67.4 of the Review for Religious, 2008. ; Personal Witness Heart -Knowledge, .Spiritual Reflection QUARTERLY 67.4 2008 Review for Religious fosters dialogue with God, dialogue with ourselves, and dialogue with one another about the holiness we try to live according to charisms of Catholic religious life. As Pope Paul Vl said, our way of being church is today the way of dialogue. Review for Religious (ISSN 0034-639X) is published quarterly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393 Telephone: 314-633-4610 ¯ Fax: 314-633-4611 E-Maih review@slu.edu ¯ Web site: www.reviewforreligious.org Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard - St. Louis, MO 63108-3393 Correspondence about the Canonical Counsel department: Elizabeth McDonough OP ¯ Pontifical College Josephinum 7625 North High Street ¯ Columbus, Ohio 43235 POSTMASTER Send address changes to Review for Religious ¯ P.O. Box 6070 ¯ Duluth, MN 5.5806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back cover for information on subscription rates. ©2008 Review for Religious Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission is NOT extended to copying for commercial distribution, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be considered on written application to the Editor, Review for Religious. ~ gournal of Catholic ~pir~ual~ for 0 religious Editor Associate Editor Canonical Counsel Scripture Scop~ Editorial Staff Advisory Board David L. Fleming sJ Philip C. Fischer sJ Elizabeth McDonough OP Eugene Hensell OSB Mary Ann Foppe Tracy Gramm Judy Sharp Paul Coutinho SJ Martin Erspamer OSB Margaret Guider OSF Kathleen Hughes RSCJ Louis and Angela Menard Bishop Terry Steib SVD QUARTERLY 67.4 2008 contents 340 prisms Prisms 342 personal witness Thomas Merton's Legacy: A Personal Reflection Richard Hauser SJ gives personal witness to Thomas Merton's influence in five areas of spirituality: models of spirituality, personal prayer, the sacred and the secular, nonviolence, and interreligious understanding. Personal Reflection / Group Discussion 358 Our Ethnicity.en Route to God Ruth Bolarte IHM, recalling her early religious formation as a Peruvian woman in the United States, points out the need for everyone's ethnic cultural roots to be recognized and made good use of in spiritual direction and in faith and religious-life education. 366 heart knowledge Constitutions and Heart Knowledge Beatrice Eichten OSF proposes that women and men religious may ~ell review their ¢onstitntions and question how they live out in practice their co ,mmunity life and governance today. Personal Reflection / Group Discussion Revie~ for Religious 380 Can New Life Arise from the Rule Book? 386 Nestor Gregoire OMI suggests ways that the Rule Book of a religious congregation can become user friendly and be a part of the community's prayer life. Monasticism's Rooted Adaptations Joel Rippinger OSB paints a picture of the contemporary demands on the monastic community and the adaptation required to remain true to monastic life. 392 4O4 413 Revisiting Hope William P. Clark OMI ruminates on all the richness that the virtue of hope gives to our daily living and to our witness-ing to our Christian faith. Becoming All Fire: Thoughts on Religious Identity Hedwig Lewis SJ offers reflections on the Jesuit as "a man on fire" in the light of Decree 2 of General Congregation 35. Though applied here to the Society of Jesus, the ideas have relevance for all women and men religious and for others who desire greater commitment to the Lord. A Source for Prayer Undreamt Of A. Paul Dominic SJ proposes ways that we might find content for our prayer in the dreams that God may use in speaking to us. 425 Scripture Scope: The New Perspective on St. Paul 430 Canonical Counsel: The Lacuna Canon: Common and Constant Opinion 435 Book Reviews 443 2008 Index 339 67.4 2008 prisms 3401 Nvember is the month in the Catholic liturgical tradition devoted to a commemoration of the faithful departed. We remember, those who have died and now have a different role to exercise in the communion of the saints. We remind ourselves that death is not an end, but rather a door passed through to life forever. Some years ago the Jesuit theologian Karl Rahner wrote a long essay in the Quaestiones Disputatae series entitled On the Theology of Death. One of the challenges that Rahner pre-sented was for us to view death as a beginning. Obviously in our Christian faith in the resur-rection of the body we acknowledge that in dying we rise to new life. Although physical death can be seen as an end, that same death can be seen as a beginning. Rahner, however, was drawing our atten-tion to how we prepare for our Christian death by how we live. If we truly 7want to enter into living our Christian faith, we should spend our lives learning how to die. All the little dying opportunities in our life allow for this growth. Something so simple as the physical act of fall-ing asleep at night and waking to a new day can be an exercise in dying. We can't make ourselves sleep, but we can give ourselves over Review for Religious to its possibility. And that attitude/action of "giving our-selves over" is what makes death a beginning. In our everyday life, there can be a lot of bringing things to a completion or to an end (a dying), and then we find ourselves giving ourselves over to a new project. Every time we face an ending or a dying, we are learning how to die by giving ourselves over to something new. As Christians, then, we truly can be said to be peo-ple who spend their lives learning how to die. In fol-lowing Jesus, we are his disciples even up to his death on a cross. Even suffering an unjust and cruel death by crucifixion, Jesus saw and freely accepted his death as a giving over of himself to God and to us--his own gift of self in love. This is the gift God makes present to us in every Eucharist--the eternal stance of Jesus giving himself over to the Father and to us, and inviting us to be with him in this gift. So as we enter into every Eucharist, we again are exercising our learning how to die--a giving of ourselves over to new life. November is also the end of the church's liturgical year. We begin anew our liturgical year with the sea-son of Advent. Just as in the secular ending of a year and then the beginning of a new year, we find ourselves challenged to acknowledge that this year we are one year closer to dying, no matter our age. It seems to be a good time to ask ourselves; as Rahner would remind us, how we accept death as a beginning and how each day we are learning how to die. David L. Fleming SJ The Review for Religious advisory board members and editorial staff pray for a blessed Advent and Christmas sea-son for all of you, our readers. 341 67.4 2008 prayer RICHARD J. HAUSER Thomas Merton's Legacy: A Personal Reflection 342 The Newsweek cover of 19 November 2007 proclaimed 1968 as "The Year That Made Us Who We Are." Prominent among the events recalled were the deaths of Martin Luther King Jr. on 4 April and Robert Kennedy on 6 June. For me the year recalled another death, Thomas Merton's, on 10 December, and Newsweek's title led me to reflect on how Merton had made me and many of my genera-tion who we are as Christians. This surprised me. I had never explicitly assessed Merton's contribution either to 20th-century spiritual-ity or to my own. Then I received and accepted an invitation from St. Mary's College, South Bend, to speak about Merton's legacy to contemporary spiritu-ality. I began delving back into spiritual devel-opments after the Second Vatican Council. Richard J. Hauser SJ writes from Creighton University; 2500 California Plaza; Omaha, Nebraska 68178. Review for Religious To be safe I narrowed my topic to Merton's influence on me, but I soon felt that Merton had influenced my entire generation, affecting major writers such as Henri Nouwen and Thomas Keating. From 1969 to 1972 I studied in the Department of Religion and Religious Education at Catholic University in Washington, D.C. There I became fascinated by Abraham Maslow's self-actualizationpsychology, espe-cially his approach to peak "religious" experience. Deciding for my dissertation to compare Maslow, an agnostic, with a Christian spiritual writer, I did not take the suggestion to use Ignatius Loyola. I had read Seven Storey Mountain in high school; as a young Jesuit I had not become further acquainted; but I would become familiar with him. I chose Merton. Looking back now, I am aware that Merton signifi-cantly altered my approach to spirituality in at least five areas: models of spirituality, personal prayer, the sacred and the secular, nonviolence, and interreligious under-standing. Models of Spirituality Merton transformed my understanding of not only spirituality but also human nature. He moved me from a behavior-centered approach to a contemplative, heart-centered approach. And for the first time I began under-standing the role of grace. In my Jesuit formation from 1955 to 1968, we strove to do God's will as indicated in the daily order. Our day included Mass, meditation, examinations of conscience, the rosary, and other prayers. It included times for work, study, play, eating, and sleeping. Our, day was spent doing things for God. Holiness, as I understood it throughout my Jesuit formation, was in fidelity in doing God's will 343 67.4 2008 Hauser * Thomas Merton's Legacy: .4 Personal Reflection by observing the daily order and keeping the rules: "Keep the rules and the rules will keep you." I frequently failed in observance. I was a perfectionist and experienced guilt. I had migraine headaches during my early years. During my studies at Catholic University, I began rethinking my model of spirituality and of human nature. Though I had never formally articulated it, my understanding of human nature throughout my forma-tion was Freudian: Human nature cannot be trusted because it is dominated by the strong self-centered instinctual impulses of the Id, and so spirituality strives to repress and control this unruly nature. Abraham Maslow's personality theory challenged this model. Maslow describes human nature in a posi-tive series of needs leading to full self-actualization. This actualization occurs as we recognize and respond to our nature's promptings. For my dissertation I sought a theological perspec-tive on human nature that would complement Maslow's psychological one. Merton's theory of the True Self pro-vided that perspective. He stresses that the True Self is the self in an existential union with God. This union is capable of transforming the self if we live in tune with it: "The secret of my identity is hidden in Him. He alone can make me who I am, or rather who I will be when at last I fully begin to be. But, unless I desire this identity and work to find it with him and in him, the work will never be done." Also: "There is only one problem on which all my existence, my peace, and my happiness depend: to discover myself in discovering God. If I find him I will find myself, and if I find my true self I will find him.''1 For the first time in my life I was exposed to a Christian approach to the self that stressed not sinful- Review for Religious ness but grace. For me, Merton was describing grace as it worked transforming the various levels of Maslow's series of needs. Merton's "self-realization in Christ" was the perfect complement to Maslow's agnostic "self-actu-alization.'~ But Merton's approach to the self was not naive. He realized that discovering our True Self is difficult because we are shadowed by a False Self. This False Self is a product of our secular, materialistic culture; it leads to an understand- ¯ ing of the self that does not include God: "Every one of us is shadowed by an illusory person: a false self. My false and pri-vate self is the one who wants to exist outside the reach of God's will and God's love--outside of reality and outside of life. And such a self can-not help but be an illusion .A.ll sin starts from the assumption that my false self, the self that exists only in my own egocentric desires, is the fundamental reality of life to which everything else in the universe is ordered" (Seeds, 34-35). Merton's approach to spirituality focuses not on behavior but on the habitual consciousness underlying actions. Spirituality seeks to recognize and respond to God's presence at the center of our self, our True Self. This includes recognizing and rejecting the patterns of our False Self that separate us from God. It is not unlike Paul's contrast between following Christ by faith-ful observance of the external law and following Christ Merton's approach to spirituality focuses not on behavior but on the habitual consciousness underlying actions. 67.4 2008 Hauser * Thonms Merton'~ Legacy: .4 Per~onM Reflection 346 by responding to the law of the Holy Spirit written upon our hearts. This insight illumined my spirituality. When I began my university teaching, I was asked to teach a graduate course called Approaches to Mysticism. Merton's contemplative spirituality became my guide. Personal Prayer Merton transformed my personal prayer, helping me experience prayer as an authentic and fulfilling expres-sion of myself before God and not only as a prescribed religious obligation. He helped me recognize the Spirit's role and become aware of actual contemplation in my life and prayer. I believe that contemplation is the key to Merton's spirituality. ' Daily personal prayer was a regular part of our Jesuit formation. We were given Jesuit-authored meditation books that presented scriptural passages for each day of the year. We were taught the Ignatian methods of meditation and contemplation presented in his Spiritual Exercises. We were instructed to reflect on those passages using memory, understanding, will, and imagination. We prayed for fifty minutes each morning beginning at 5:30. I found these prayer hours difficult and did not look forward to them. They seemed irrelevant; I often experienced distraction, boredom, and sleep. I was faith-ful to this regimen for the first nine years of my Jeslait formation. As part of my formation I taught at a Jesuit mis-sion in South Dakota. Life at the mission was difficult, both in community life and in ministry. The students showed little enthusiasm for the courses I taught or the activities I ran. Discouraged, I wondered if I had fol-lowed the right vocation. I began taking walks alone late at night down the country road. I poured out my Review for Religious discouragement to the Lord. The walks stabilized me; in the stillness I often found peace. I looked forward to these walks and would not miss them if I could help it. I determined to continue serving the Lord. But I did not consider these walks personal prayer-- they were not the Ignatian prayer I was trained in. Needing sleep, I soon was sleeping through the morning prayer hour and getting up in time for the 6:30 Mass. I felt guilty, but one day I realized I was not skipping prayer--I was doing it at night. From that moment my personal prayer changed. I felt that prayer does not have to be a strenuous concentration of mem-ory, understanding, will, and imagination. Simply being with the Lord anywhere--in chapel or outside--was prayer. Theologians might not agree with me, and this was not the Ignatian prayer I was taught--so I kept my ideas to myself. In graduate school Merton gave me a theological foundation for my prayer. He helped me realize I was holding on to a Pelagian understanding of prayer. He showed me that prayer is really more the work of the Holy Spirit than my work: "It can therefore be said that the aim of mental prayer is to awaken the Holy Spirit within us, and to bring our hearts into harmony with his voice, so that we allow the Holy Spirit to speak and pray within us, and lend him our voice and our affec-tions that we may become, as far as possible, conscious of his prayer in our hearts.''2 Merton showed me that prayer can actually be easy and that we can pray from wherever we are in our lives. It does not have to be a strenuous effort to forget our daily lives and to concentrate on Scripture using mem-ory, understanding, and will. "In prayer we discover what we already have. You start where you are and you 347 67.4 2008 Hauser ¯ Thomas Merton's Legacy: .4 Personal R~ection Merton gave me the theology and language to explain and justify what had become my regular practice of personal prayer. 348 deepen what you already have, and you realize that you are already there. We already have everything; but we don't know it and we don't experience it. Everything has been given to us in Christ. All we need is to experience what we already possess.''3 Finally, and unbelievably, I learned that my prayer sometimes fulfilled Merton's description of contem-plation- being touched by God in a way transcending words. What I had considered merely natural human expe-riences-- Maslow's peak experiences-- were actually encoun-ters with the divine: "Contemplation is a sudden gift of aware-ness, an awakening to the Real within all that is real. A vivid - ¯ - awareness of infinite Being at the roots of our own limited being. An awareness of our contingent reality as received, as a present from God, as a free gift of love. This is the existential contact of which we speak when we use the metaphor of being 'touched by God'" (Seeds, 3). I realized these experiences happened most frequendy for me--and for Merton--in nature, and they happened most frequently outside of formal prayer times. He showed me that contemplation is not merely the preserve of cloistered monks and nuns, but that we are all called to it by our baptism. In short, Merton gave me the theology and language to explain and justify what had become my regular prac-tice of personal prayer. This had several enduring effects Review for Religious on my rhythm of personal prayer. I moved toward more and more silence in prayer, allowing the Holy Spirit to pray within me. I began daily prayer with my personal concerns rather than Scripture. I arranged my place of prayer to ensure I could always view God's creation. I altered my annual eight-day retreats: I stopped going to retreat houses and went to places of great natural beauty near a mountain or an ocean--and I began looking for-ward to these retreats. The Sacred and the Secular Merton's ideas had many ramifications in my life. He helped me transcend an artificial distinction I had made between the sacred and the secular. He helped me recognize that daily life is sacred. Before the Second Vatican Council and throughout my formation, I had lived with a basic misunderstand-ing about spirituality and holiness. I believed that spiri-tuality is primarily faithful performance of devotional practices aimed directly at worshiping God, such as Mass and visits to chapel, and that holiness is measured by fidelity to these practices. I did acknowledge other things as important, such as doing God's will and charity toward others, especially toward the most needy. These things, however, seemed not as central to holiness as the explicitly religious activities. When the council came, I was deeply influenced by the document "The Church in the Modern World" (Gaudium et spes). The council clearly taught that being a good Catholic is more than simply performing reli-gious obligations faithfully. A good Catholic must also be actively involved in serving the kingdom of God by living in love in ordinary daily life, and especially by working for justice in the world and working for the poor. 349 67.4 2008 Hauser ¯Tbomas Merton's Legaiy: A Personal Reflection This call occasioned a crisis in my life. I began to feel there had been too much emphasis on religious activities and not enough on service to others. I questioned my commitment to daily Mass and meditation. For a while I dropped daily personal prayer. I had set up a dichotomy between sacred activities and secular activities. Merton helped me overcome this dichotomy. His understand-ing of the True Self was key. The True Self exists in an existential union not only with God but also with the entire human family. There is no true union with God without union with one another, and so the Holy Spirit moves our hearts not only to love God in religious activ-ities but also to love one another in our daily activities: "Christ prayed that all men might become One as He was One with his Father, in the Unity of the Holy Spirit. Therefore when you and I become what we are really meant to be, we will discover not only that we love one another perfectly but that we are both living in Christ and Christ in us, and we are all One Christ. We will see that it is he who loves in us" (Seeds, 65). Living a life of service to others is not a distrac-tion from union with God but actually a condition for reaching this union: "One of the paradoxes of the mys-tical life is this: that a man cannot enter into the deep-est center of himself, and pass through that center into God, unless he is able to pass entirely out of himself and empty himself and give himself to other people in the purity of a selfless love" (Seeds, 64). Merton emphasizes that the quality of prayer affects the quality of our action. The more deeply we are united to God in prayer, the more energy we have to serve our neighbor. "Action and contemplation now grow together into one life and one unity. They become two aspects of the same thing. Action is charity looking out- Review for Religious ward to other men, and contemplation is charity drawn inward to its own divine source. Action is the stream, and contemplation is the spring. The spring remains more important than the stream, for the only thing that really matters is for love to spring up inexhaustibly from the infinite abyss of Christ and of God.''4 Merton gave me the theology to dedicate myself to both prayer and service. Since both flow from the Holy Spirit, both are sacred. This theology impelled me to social action. Soon after I began my university teaching, I initiated a campus boycott of iceberg lettuce to sup-port the farm workers' union. I encouraged nonviolent picketing of the food service lines. The boycott took more than a year but was ultimately successful. Nonviolence Before reflecting on Merton's spirituality, I had a lim-ited understanding of nonviolence. I thought of it sim-ply as conscientiously objecting to the war in Vietnam and, influenced by Martin Luther King's civil rights movement, as not retaliating physically when attacked. Though I admired these positions, I saw those who took them as rare, highly idealistic, and a bit naive. Merton revolutionized my understanding. His description of the True Self showed me that an attitude of nonviolence is an integral part of living the gospel and following Christ. Since God dwells within every human being, this com-munion has radical consequences for how we think and how we act. When we are in tune with God at our center, in our True Self, we experience our oneness with others, even with our "enemies." Our behavior changes. Merton helped me realize that Western understand-ings of the person foster secularism, individualism, materialism, competition, and a sense of superiority. 67.4 2008 Hauser ¯ Thomas Merton's Legacy: A Personal R~leaion Merton helped me.realize that Western understandings of the person foster secularism, individualism, materialism, competition, and a sense of superiority. This False Self has the illusion that our existence is not connected with God or with others, and this illusion leads to violence: "People who know nothing of God, and whose lives are centered on themselves, imagine that they can only find themselves by asserting their own desires and ambi-tions and appetites in a struggle with the rest of the world. They try to become real by imposing themselves on other people, by appro-priating for them-selves some share of the limited supply of created goods and thus emphasizing the difference between themselves and other men who have less than they, or nothing at all" (Seeds, 47). Merton concludes simply: "I must look for my identity, somehow, not only in God but in other men. I will never be able to find myself if I isolate myself from the rest of mankind as if I were a different kind of being" (Seeds, 51). The transformation Merton calls for happens most profoundly in contemplation. In a busy Kentucky city, Merton experienced his most well-known contemplative awakening: "In Louisville, at the corner of Fourth and Walnut, in the center of the shopping district, I was suddenly overwhelmed with the realization that I loved all those people, that they were mine and I theirs, that we could not be alien to one another even though we were total strangers. It was like waking from a dream of Review for Religious separateness, of spurious self-isolation in a special world, the world of renunciation and supposed holiness.''s Such consciousness is the foundation for Merton's understanding of nonviolence. It can move us to deal with our neighbors always with compassion and love, not violence. We seek nonviolent ways to show our neigh-bors the divine within them as it has been shown joyfully to ourselves. This is the way Merton was leading me to radical implications of being a Christian. How inad-equate my understanding of nonviolence had been! Merton lived during the turbulent 1960s and applied nonviolent principles to social movements. He became the prophetic voice for many involved in these movements. While studying in Washington, I attended many mass demonstrations against the Vietnam War. I remember a group of marchers on Pennsylvania Avenue carrying a ban-ner slandering President Nixon. Merton helped me realize that this was not true nonviolence. Without compassion and love, it was merely a redirection of hatred. Truly non-violent social movements exclude hatred, because we are all members of one human family with God as our Father. I began applying nonviolent principles to personal con-flicts. I realized how often I sought to resolve conflicts by some sort of psychological intimidation. I saw anew the need for prayer. And I began teaching a course titled Faith and Nonviolence. We read the New Testament, Gandhi, Martin Luther King, Cesar Chavez, Daniel Berrigan, and Merton. The course applied nonviolent principles to both societal and personal conflicts. Interreligious Understanding Although I had taken several courses on world reli-gions during my theology studies, I understood these religions mainly as institutions with distinctive creeds, 67.4 2008 Hauser * Thomas Merton's Legacy: .4 Personal Reflection codes, and cults. Through his approach to contem-plation, Merton led me toward an empathetic under-standing of them. Key to this deeper understanding was Merton's insistence that the contemplative experi-ence of the divine is beyond words: "Contemplation is always beyond our own knowledge, beyond our own light, beyond systems, beyond explanations, beyond discourse, beyond dialogue, beyond our own self." "It cannot even be clearly explained. It can only be hinted at, suggested, pointed to, symbolized. The more objec-tively and scientifically one tries to analyze it, the more one empties it of its real content, for this experience is beyond the reach of verbalization and rationalization" (Seeds, 2 & 6). Since all human beings share the same human nature, and since the same God dwells within us all, we may indeed share similar experiences of God. Reading Merton's Inner Experience confirmed this idea for me. Buddhist descriptions of satori are not unlike Merton's descriptions of contemplation. Merton presents a poem. Devoid of thought, I sat quietly by the desk in my official room, With my fountain-mind undisturbed, as serene as water; A sudden crash of thunder, the mind doors burst open, And lo, there sits the old man in all his homeliness. Merton comments: "There sits Chao-pien himself, the same and yet utterly different, for it is the eternal Chao-pien, one with no familiar name, at once humble and mighty., utterly beyond description or comparison because he is beyond yes and no, subject and object, self and not-self. It is like the wonderful, devastating, and unutterable awe of humble joy with which a Christian realizes: 'I and the Lord are One.'''6 Review for Religious This was a major breakthrough in my understand-ing. After my own experiences of contemplation, I could now allow Merton's books and essays on Zen Buddhism, Taoism, Sufism, Judaism, and Hinduism to lead me to deeper understanding of these religions. Since I wanted my students to understand the centrality of prayer and contemplation for every world religion, I began adding these readings to my courses. We all mourned Merton's untimely death in Bangkok on 10 December 1968, during his three-month trip to Asia. This death was especially sad because his firsthand Asian experiences would have given him further data on similarities between Eastern and Western mysticism. My Debt to Merton I realize that many today take for granted the five areas of spirituality that I have described. But Merton's insights were presented before the council and offi-cial Catholicism accepted them. Indeed, his own abbot general censored his 1961 antiwar writings. Merton's writing became foundational for a new generation of Christians and spiritual writers. This fortieth anni-versary of his death is the first time I have stopped to acknowledge my debt. I do not consider it an exaggera-tion to say that Merton was a prophet heralding a new age of spirituality. Merton paved the way for my own understanding of the council's teaching on the Holy Spirit in Christian spirituality. Merton's insistence that the True Self is ontologically united both to God and to all humanity and that the Holy Spirit is the source of this communion transformed my previously unrecognized American indi-vidualism. I had never grasped that the indwelling of the Spirit has actual effects in daily life and daily prayer. The 67.4 2008 Hauser * Thomas Merton's Legacy: .4 Personal Reflection combination of Merton's description of the True Self and the council's message on the Holy Spirit revolution-ized my spirituality. I was so energized by these insights that I wrote three books and dozens of articles. I am indebted to Merton for "bringing me home" to Ignatian prayer. Merton's descriptions of prayer flow-ing spontaneously from daily life led me to reconsider my understanding of it. I realized that Ignatian prayer is not simply to be identified with intense concentra-tion on scripture texts as found in the meditations and contemplations of the Spiritual Exercises. Prayer more characteristic of Ignatius is found in his Contemplation for Obtaining Divine Love and flows from daily life. Observations of Ignatius at prayer, like the following recollection from one of Ignatius's first companions, assure me that I am on the right track: At night he would go up on the roof of the house, with the sky there up above him. He would sit there quietly, absolutely quietly. He would take his hat off and look up for a long time at the sky. Then he would fall on his knees, bowing profoundly to God. Then he would sit on a little bench because the weakness of his body did not allow him to take any other posi-tion. He would stay there bareheaded and without moving. And the tears would begin to flow down his cheeks like a stream, but so quietly and so gently that you heard not a sob nor a sigh nor the least possible movement of his body.7 Merton helped me internalize that hallmark of Ignatian spirituality "Finding God in all things." He also paved the way.for my understanding of Ignatius's discernment of spirits, but that is another article. I have asked myself why my journey into Ignatian spirituality took so long. I recognize now that Iowas blocked by invalid False Self assumptions. I needed Review for Religious someone to address them directly. In God's providence Thomas Merton was that person--the person who with God's grace most made me who I am today as a Catholic Christian. Notes 1 Thomas Merton, New Seeds of Contemplation (New York: New Directions, 1961), pp. 33 & 36. Hereafter, in the text, Seeds. 2 Thomas Merton, Spiritual Direction and Meditation (Collegeville: Liturgical Press, 1960), p. 67. 3 David Steindl-Rast OSB, "Recollections of Thomas Merton's Last Day in the West," Monastic Studies, Vol. 7, pp. 1-10. 4 Thomas Merton, No Man Is an Island (New York: Doubleday Image, 1955), p. 65. 5 Thomas Merton, Conjectures of a Guilty Bystander (New York: Doubleday Image, 1989), p. 156. 6 Inner Experience, pp. 300-301, taken from L.S. Cunningham, Thomas Merton: Spiritual Master (New York: Paulist Press, 1992). 7 W.W. Meissner SJ, Ignatius of Loyola: The Psychology of a Saint (New Haven: Yale University Press, 1992), p. 280. Personal Reflection / Group Discussion Has Thomas Merton or another spiritual writer influenced my practices of the spiritual life? Like Hauser, how would I describe the change? 67.4 2008 RUTH BOLARTE Our Ethnicity en Route to God ~ elonging and "distinctness" are both .signifi- ~ cant dimensions of my life. Years ago I left my country of origin, Peru, and began religious life in the United States. During those first years, away from fam-ily and friends and the emotional and material support they had been for me, my desire and need to belong and be one of.the group made me conceal a part of myself, my Peruvian culture. My initial years of religious for-mation did not acknowledge my Hispanic heritage and the spiritual treasure it was. My being Hispanic was only a curious novelty, something to be asked a few questions about. Without any intentional fault of those guiding me on the spiritual journey, I neverthe-less received the unspoken message that I should abide by the new codes and values that were presented to me and somehow forget what I had learned in Peru Ruth Bolarte IHM, a member of the Sisters, Servants of the Immaculate Heart of Mary, is director of the Catholic Institute for Evangelization; 4404 North 5th Street; Philadelphia, Pennsylvania 19140. Review for Religious about God, life, and people. Eventually, little by little, my God-friend became the God of rules and formality. Spontaneity, touching, and initiative disappeared, and a "prove yourself" attitude emerged. I believed in my heart that hard work, silence, and distance were the key to my religious life in the United States. In order to be recognized as one of the group, I adapted myself to the mainstream culture and disre-garded my images of God, of prayer, of life and death. When the opportunity presented itself, I limited my "ethnic sharing" to external aspects of culture: food, music, stories, and dance. These were safe issues and did not upset anyone. People, consciously or not, were simply not interested in listening with open hearts to the heart of my culture: my experiences of God through family, nature, joy, and suffering; my views on authority, poverty, power, or church. I was not raised with a code of beliefs and rules to obey. We.entrusted ourselves to a loving God who walked, ate, laughed, and cried with us throughout the events of our day. Church was not the only place where we could worship God. We gave glory and praise to God through our family celebrations, our processions, and our dead. In later years I would find out that my traditions of religion were what theologians and the church named "popular religigsity." Pope Paul vI explains this concept in his apostolic exhortation Evangelii nuntiandi: " One finds among the people particular expressions of the search for God and for faith, both in the regions where the church has been established for centuries and where she is in the course of becoming established. These expressions were for a long time regarded as less pure and were sometimes despised, but today they are almost everywhere being redis-covered. l 67.4 2008 Bolarte ¯ Our Etbnicity en Route to God The Holy Father explains that these religious expres-sions are susceptible to many misinterpretations. If, however, they are well oriented through the pedagogy of evangelization, they are rich in value since they reflect the thirst for God that 0nly the poor and simple can know. Popular religiosity is a major part of the spiritual life of Hispanic people. Hispanic spirituality is divine and human at the same time; it is incarnated spiritual-ity. 2 God is perceived as all-powerful, sovereign, and superior to all human beings, but also as a member of the family--someone who sits at the table and does not need a special invitation. God is not a far distant image in heaven; God is Emmanuel, always at our side, accom-panying us all day every step of the way. Since these expressions of faith were not acknowl-edged during my formation years, my cultural identity became dim. I only became aware of this only when I visited Peru after having lived in the United States for five years. I began to feel this tension between two seemingly opposite forces, my Pei'uvian culture and my adopted American one, between my yearning to "belong" and my efforts to hold on to my "distinctness." What a surprise it was to find that I did not "belong" anymore to the place where I had lived most of my life! Two cultures, American and Peruvian, had shaped me into a new person I only pardy understood. Returning to my homeland made me conscious that somehow my identity and personhood were rooted in both the American and Peruvian cultures. Once I became aware of this, I felt a need to inte-grate both cultures in my life, whether I resided in Peru or in the United States. The questions for ~e were, How do I do that? and who will understand? Many questions arose, 'and there was no one to talk to about Review for Religious them. Even though I had spiritual directors, I did not feel comfortable bringing up these "cultural" issues. For ten more years I lived with the questions and the ten-sions of being different and trying to belong to a com-munity, a parish, a church that was at the same time borne and foreign. During this time I learned to assert myself and prove to others that I was as capable and prepared as any other religious in the United States. I have come to believe that wholeness in our lives is a process of becoming,, something we undertake each day. Tension is an opportunity for growth and devel-opment. Becoming conscious of my longing to "belong" while also recogniz-ing my "uniqueness" and sense of inde-pendence marked the beginning of a long road borne. Only when I started to ask myself questions about my Latina identity, reading the works of various Hispanic theologians and reflecting critically on my experiences in the United States, was I able to be at borne with the tension of being part of two worlds. I had the opportunity for this reflection while doing the research for my thesis. After so many years living in the United States, I was finally able to name struggles and hurts, and more than anything I could identify, cel-ebrate, and rejoice in my cultural heritage. The tension I had felt became a source of wealth and fulfillment Becoming conscious of my longing to "belong" while also recognizing my "uniqueness" and sense of independence marked the beginning of a long road home. 361 67.4 2008 Bolarte ¯ Our Etbnicity en Route to God As my own "true self" was gradually revealed to me and then to others, a new person emerged, one that was freer to relate to God and others. rather than being a barrier to my social and personal development. The cultural wealth of our various ethnic groups, yours and mine, is a main component in our human and spiritual development. It is crucial that those involved in religious formation, spiritual direction, and ministry consider the cultural factors in people's spir-itual journeys. People need a sense of belong-ing and historical con-tinuity. If we deny our family origins and his-tory, we deny ourselves. 0nly when we feel affirmed in our identity can we be free, open, and welcoming to other cultural groups. On the other hand, people often develop a sense of inferiority, a poor self-image, when they feel minimized or attacked in their ethnic identity. In many cases these feelings become a defen-sive or aggressive attitude toward the dominant ethnic group or toward other minority ethnic groups. Since spirituality involves all aspects of life--psy-chological, physical, social, and political--we need to recognize that all cultural groups have distinctive ways of facing life, sickness, family, power, pain, and death. An inte, grated spirituality recognizes that all of our lives must be subjected to the transformative power of the Holy Spirit. We hear and appropriate the Good News of Jesus from our various cultural perspectives. Those perspectives influence how we understand the message Review for Religious and how we respond to it. Vgho can be sure of a univer-sal description that is the norm for all? The ministry of Jesus is to reveal the meaning of life and offer humanity an opportunity to enter freely into a loving relationship with God as adult daughters and sons. Because an important root of spirituality is found in the self, we must integrate the psychological value of self-affirmation, self-fulfillment, or self-realization with the Christian tradition of self-denial, self-emptying, or self-surrender. From the moment of birth we seek in our human development a proper balance, the right connectedness with others and the right separateness from others. The challenge for everyone is to achieve relatedness without symbiotic engulfment and indepen-dence without alienation and emptiness. As my own "true self" was gradually revealed to me and then to others, a new person emerged, one that was freer to relate to God and others. In faith I had the power to respond to the gift of my being and abandon the "false self" of pretenses; concealments, and fears. It was this "false self" that I was called to deny, the self that hid my ethnicity. Thomas Merton summarizes this dynamic when he affirms that if we find God we find ourselves and if we find our own selves we find God.3 For Merton, maturing in the spiritual life is a discov-ery journey, the discovery of oneself and of God. One of the tasks of those involved in faith formation is to search for and reveal the seed of God that is already there in her and her culture. They must lead her to recognize Christ in herself and challenge those aspects of her which need purification so the complete image of God can be revealed. All through human development, critical reflection is required. As people grow in maturity, there is a shift 363 67.4 2008 Bolarte * Our Etbnicity en Route to God from being acted on by the world to acting on the world. In my experience of tension between two worlds, it was only when I internalized and reflected on being a part of two cultures that I could incorporate the tension into who I was. Duringthis internalization, I needed to grieve my cultural losses, experience the pain of the hurts, and forgive those who purposely or not had discriminated against me. Sometimes people do not perceive that ignoring cultural differences is a form of discrimination: it deprives someone of her distinctive cultural identity, the unique person she was created to be. Our spiritual journey in Christ requires accepting that our worth, our value, our selfhood as children of God is given to us as our birthright. It means knowing deeply that we are known, loved, and invited to partnership in being with the God who from all eternity intended us and who desires our love. To answer the question "Who am I?" we need to incorporate all our past--including the past of our family, culture, religion, and national group. Only this person can be the subject of our own destiny. Knowing that I am loved by God, I need not live in anxi-ety, or seek affirmation through achievement or some other form of power, for I learn to accept imperfections and strengths, my own and others'. God's grace invites us to become the persons we were created to be. God's love does not absorb, anni-hilate, or force itself upon the beloved. Instead it longs for the beloved to become more and more "other" or differentiated. Without such "letting be" of the beloved, the dialogical intimacy essential to a loving relation-ship would be impossible. God allows unique persons to emerge and become capable of deep relationships because, God, "how could you give yourself to me unless you had fii'st given me to myself?.''4 Review for Religious By no means is my endeavor to integrate cultures within myself and my religious life a finished task. It is a process that every day makes use of the newness I encounter in the many kinds of relationship in my life. Sometimes I long for the support of my Anglo friends because they can understand my experience; other times I look for my Latino support group because they can feel forme. There are times when I feel alienated from one or both of the cultures, like a fish out of water; at other times I am tired of the tension of the two worlds and I just want to run and hide. Being a "bridge per-son"-- gente puente--is dangerous business. One takes the risk of being hurt or judged--becoming the scape-goat for one of the cultural groups. At these times I remember Who called me to be a Latina woman reli-gious evangelizing in the United States. God is the one who gifts me with the ability to interact with two ethnic groups. Yes, the gift entails pain and suffering--dying to my "false self." But in Jesus' resurrection I find the hope and joy of new life and the courage to continue living in a tension that is a source of new life for many, including me. Notes ~ Pablo VI, Evangelii nuntiandi (On Evangelization in the Modern World), §48. 2 Rosa Marfa Icaza, "Prayer, Worship, and Liturgy in a United States Hispanic Key," in Frontiers of Hispanic Theology in the United States, ed. Allan Figueroa Deck (Maryknoll: Orbis Books, 1995), p. 136. 3 Thomas Merton, Seeds of Contemplation (New York: Dell, 1960), p. 53. 4 Cited by Nicholas of Cusa as quoted in John Haught, God aj%r Darwin (Boulder, Colo.: Westview Press, 2000), p. 40. 67.4 2008 heart BEATRICE EICHTEN Constitutions and Heart Knowledge knowledge 366 In this article I suggest that religious--you and I, wherever we are--reflect on our vari-ous constitutions, on what we say about our life together and on how we live what we say. For most congregations the original con-stitutions antedate all the members. They were written to carry the inspiration and hopes of founders, foundresses, and early members regarding the possibility of living the gospel with charismatic idealism and practical action. They contain many elements--identity, vowed life, community, mission, prayer, membership, governance, and stewardship--all matters of relationship. After Vatican Council II ~any members were involved in adapting to the changing times. This called for re-visioning and revising the constitutions and having them Beatrice Eichten OSF here offers an adaptation of words to a Franciscan Sister's community. Her address is/577 Huff Street, #1; Winona, Minnesota 55987. eichten.consuldng@gmail.com Review for Religious approved. Now, many years later, it may be helpful to review our constitutions and ask (possibly in a second-ary document) how our community life and governance are lived today. This would be a practical effort, not an academic one. In the fast pace of life today, with many calls on our attention, have we lost touch with the heart of who we are and why we are here? Few members entered their community because they read compelling statements in their congregation's con-stitution, and it is surely the same today. Women enter a community because they are drawn to members who embody its charism, who have been claimed as God's own and who love and live for, hope and work for, God's kingdom on earth. Such women have the energy and spirit of the founders and the early members. They may not be able to quote the constitution, but they know its values and challenges. They have "heart knowledge" of their constitution, from their experience in the presence of God and their community. One could say that they know their constitution "by heart." Their lives express their constitution, the dreams and hopes and challenges it contains. We all know persons like this--we may even be one! How do people acquire that "heart knowledge"? By persistence. I am reminded of my training as apastoral psychotherapist. We were told that only after we learned the training center's theory well would we know when to adapt or depart from it. I remember the foundational text--it was like reading a foreign language! I read it diligently, paragraph by paragraph. Some sentences were a paragraph long! I would read them several times silently, and then out loud. I even underlined the sub-ject, verb, and object as I tried to figure out what they meant. Bit by bit, as I studied the text and saw it used 367 67.4 2008 Eicbten ¯ Constitutions and Heart Knowledge by skillful practitioners, I came to know and understand the theory very well. The text became a practical work-ing document for me, one that was useful and which I felt comfortable adapting as needed. Your constitution is like that. It captures the funda-mentals of your way of life--who you say you are as a congregation and how you will live your life together. As you study it and live it, you begin to live it "by heart." You make some adaptations that are, hopefully, faithful to the intent of the original document. After a while you live your life without conscious reference to your constitution--and you may have lost some of the motivation and challenge it carries. A wise Sufi teacher said of the Koran that'it is like a map. If it is used well, if you follow the rivers of life it charts out for you, it helps you make progress in living a faithful life. If you do not use it, why have it? But, he added, it is important to remember that, unlike maps, rivers change course over time. If you insist on follow-ing the river as it is mapped, you will miss the flow of life. Our constitutions are like that map, and charism, vows, and mission are rivers of our lives. Vghen maps are used wisely, they help. Ernie Larkin OCarm offers another image for our constitutions. He says we "emphasize the presence of God in all things, but may tend to forget the envelope that contains it." Our constitutions are the envelope that contains the essentials of our community way of life, essentials that are "the medium through which God comes." Our constitutions contain our "Now," which is "the only place where one can meet God." Fundamentally, then, constitutions exist to articu-late "heart knowledge," and are not the mere sets of rules and laws that a legalistic mindset too easily makes Review for Religious them. St. Clare of Assisi was aware of this. She insisted that her Rule, the guideline for the Poor Ladies' reli-gious life, express clearly her sisters' impulse in coming together. Essential to her vision was the privilege of poverty, a privilege and obli-gation which she insisted be written into their official Rule. It contained inspiration or poetry along with obliga-t_ ion or requirement. It became a living document when its followers lived by it. C.S. Lewis expresses the idea: "poetry replaces grammar, gospel replaces law, longing transforms obedience." Constitutions contain both inspiration and require-ments. Congregations sometimes register only the inspi-ration while bypassing the requirements. Sometimes they bypass the inspiration and register only the require-ments-- and chafe at them. So how do we make our constitutions truly living documents that honor both poetry and obligation? In our relationships with God and one another, do we "mind the music and the step"? Are joyful inspiration and gracefully disciplined foot-work changing us into Jesus' disciples? Fundamentally, then, constitutions exist to articulate "heart knowledge," and are not the mere sets of rules and laws that a legalistic mindset too easily makes them. Conversion Religious constitutions come from our relationship with God, from our desire to let God be the center of our life. There are different ways to do this. Franciscan 369 67.4 2008 Eicbten ¯ Constitutions and Heart Knowledge constitutions seek conversion of life. The Third Order Regular Rule of St. Francis says this: "With all., who wish to serve the Lord; the brothers and sisters of this order are to persevere in true faith and penance. They wish to live this evangelical conversion of life in a spirit of prayer, of poverty, and of humility." You and I know that conversion is not a comfortable experience, nor is it one you can program for yourself: "I think that this year I will be converted to poverty, or nonviolence, or . " Typically, conversion comes to us unbidden, in ways that surprise and perturb us. Dr. Ann Ulanov, a Jungian psychoanalyst, says: "Being truth-ful with ourselves can be messy business. [We think] the illusions we have created . . . will be more readily received than our true self." She goes on to say that we all have protective armor which can look like virtue or competence or generosity. Nonetheless, it is armor designed to hide our wounds and messiness and keep us safe and protected. The human reality is that those very wounds create chinks in our armor. Conversion occurs because God will always find the chinks and slip through them to unsettle us and invite us to make "soul decisions," decisions to recommit our hearts to a pilgrim's journey in witness to the gospel. Soul decisions open us to be changed by God's abundant love into true disciples. Sister Helen Prejean resisted the gospel's social-justice dimension until, at a presentation by Sister Maria Augusta Neal, she heard the phrase "integral to the Good News was that they would be poor no lon-ger." Helen adds, "And I got it. She cracked me open." Perhaps her very resistance was the source of that con-version moment. She moved a year later from a suburb to a housing project that was "less than five miles . . . Review for Religious but it was galaxies away." She could not have done that without a profound soul decision. How do our relationships in community open us to "soul decisions" or conversion moments? I see four movements. Relationship with God We all entered a communal life of prayer and con-templation, of working relationships, and of minis-try that fulfills and stretches us. Communal life, lived fully, offers ample opportunities for conversion. Parker Palmer says we enter religious life with the illusion that outside there is jealousy, compe-tition, resentment, power struggle, status difference, and more, but in religious life there will be only love, sharing, working together, generosity, equality, and so forth. We find, however, after living in a religious community for a while, that people are the same both inside and outside religious life. We pour effort into learning to commu-nicate, to deal with conflict, to share our faith, to do many other things, hoping thereby to have the perfect community. Guess what? Even if we do learn all these things, there is still iealousy, resentment, and failure. We learn that there is no perfect community. We have to face, says Palmer, our "illusion of salva-tion by interaction." In the face of contradictions and In our constitutions and in our living of them we are called to center our lives on God, realizing that God longs for us and desires our love. 371 67.4 2008 , Eicbten ¯ Constitutions and Heart Knowledge differences, we are called to "go deep inside [ourselves] beyond the polarities to a place of unity where every-thing holds together." We know that place as God. Etty Hillesum says of this place: "There is a really deep well inside me. And in it dwells God. Sometimes I am there too." In the midst of our real relationships, in our prayer and letting go and giving over to God, we move to the awareness that salvation is from God. We only come to know that when we come to know the mystery of God--that God is for us and is given to us. In our constitutions and in our living of them we are called to center our lives on God, realizing that God longs for us and desires our love. Coming to believe this leads us to have room for others, seeing.in them the face of Jesus, accepting, lov-ing, and receiving them because God loves them and receives them. This leads me to the second interper-sonal movement. Relationship with Others in Community Our commitment to life in community is not some-thing casual or optional. It is a lifelong commitment to our congregation, to its shared life in the Spirit, and to its members rights and responsibilities. As members we are interdependent financially, structurally, and relation-ally. Sandra Schneiders says that a constitutive element of communitarian life is "a permanent acceptance of the community itself as the primary and determining rela-tional context of one's life." It means loving, and living today at this particular time, in this particular commu-nity, with these particular women--with all our gifts, limitations, and idiosyncrasies. Our diversity is "authored and authorized by the Source of all life, in whose Mystery diversity poses no Review for Religious threat to unity." When we become aware that the very diversity that delights God troubles and disturbs us, we have stepped into a special moment for conversation and conversion. We realize that diversity need not be a threat to unity. Rather, in our diversity, we realize the need to make "a commitment to sustained and deliber-ate conversation for the purpose of achieving a common ground." Michael Blastic OFMConv points to St. Francis as a prime example of relationships with the other: Francis allows the other to be other. His sense of self is an openness to and for the other. Francis continu-ously looks to the Other, Jesus Christ, as the content of his self. By definition. Francis's self was room for the other. Francis was "a person in full possession of him-self, but [was] never by himself. In order to be an example for others, Francis needed to work at being himself---it did not come naturally., for him. Fran-cis did not nor could he accomplish this identity for himself by himself. One cannot become a self with room for others by oneself for oneself. In our constitutions we call ourselves to this kind of awareness of the other, challenging ourselves to embrace diversity within the congregation as a sign of the Spirit and, by doing so, to proclaim the possibility of harmony on earth. Accepting diversity, however, does not mean that individualism reigns, even though we remain differ-ent and retain our unique characteristics (the only way we each have to express our humanity). Accepting our diversity enables us to give a countercultural witness to a new kind relationship, a relationship based on unity, on a mutuality where there is no "other." This witness of community, says John Allen, a Catholic newspaper cor- 373 67.4 2008 Eicbten ¯ Constitutions and Heart Knowledge respondent in Rome, is the most powerful gift we have to offer our fragmented and troubled world today. Relationship for Mission We are in our religious community not simply for ourselves. Our vowed commitment "does not exist within the individual alone, but within the context of community . . . a community fully engaged in con-versation about its life." The mission statement in my community's constitution challenges us to "be a com-munity of compassion, reconciliation, and reverence for all creation, to rebuild our own society, and to reach out in solidarity to our sisters and brothers throughout the world." Becoming part of the spirit and flow of energy that is our religious community stretches us and opens us to God's great energy working in the world today. As reli-gious we have a great responsibility. We need to know and to claim that we are the face of God to those around us, and we need to open our eyes and hearts to see the face of God in creation and in every creature. How we live that responsibility is a challenge. Marie Chin RSM, in a presentation to my Franciscan community, said that we are challenged to take a crucial step in recognizing that we can no longer equate community with mere group living or, to put it more blundy, simply living under the same roof for expediency or convenience. Community has to be for a greater project than self. Somehow we have to change our root image of community as a place of security where we have all our needs met and instead begin to explore the chal-lenges of justice, the challenges of forming relation-ships that are right and just and which are potentially present in community. Review for Religious Her challenge confronts our tendency to become, as Laurie Brink OP says "settled religious, [who have] lost sight of the power and passion of our original covenant with God." It is not that we are not involved in commu-nity life or engaged in a valued ministry, but rather that we are settling for comfort and "good enough"--which in turn means liv-ing with little zest and passion for life and ministry. It means not being willing to take risks or make changes that might unset-tle. Ron Rolheiser OMI says that the problem for reli-gious today is not that we are not good people, doing good things, but that we are not great people. We have settled for giving ninety percent of ourselves and held on to the ten percent that would give witness to the pas-sion and energy of God alive in us. When we entered, I would guess, we wanted to give ourselves a hundred percent. Avis Clendenen offers an interesting reflection on how we may have adapted Jeremiah's response to God "from 'too young' to 'too old'; Ah, Lord God! I am weary from speaking the truth in love. Our best days are behind us. I am too old." And God says, "Do not say 'I am too old,' for even now to all to whom I send you you will go; be not afraid, for I am with you to deliver you." Are we holding back? Can we live more fully every moment of our life today and on into the future? The problem for religious today is not that we are not good people, doing good things, but that we are not great people. 67.4 2008 Eicbten * Constitutions and Heart Knowledge 376 Relationship with Structure and Authority Our constitutions are about holding with care the relationships that shape our life together. They assume and emphasize our relationship with God, which in turn is expressed in relationships with other members and associates and with the church and society. Treating these relationships with care can only happen when both members and leaders take seriously their responsibility as part of community. As individuals, you bring your personal power to the community, ideally making it a force for growth, bridge building, and healing, rather than a force for negativ-ity, divisiveness, and controlling behavior. Together you affirm that your congregation is there to facilitate your religious way of life and your ministry, and you accept responsibility as members to participate in defining and working towards the purpose of your community. The goal of your congregation's governance is to exemplify and facilitate the living of your congregation's charism, weaving "the organizational elements of shared values, mission, and vision and translating tl~em into reality, into a course of action." In the governance of our religious congregations, we have various indications of history and personality. Rigid authority structures have left many with scars and cautions, and efforts towards new models of communal living have not always been successful. Leadership functions amid our practice and expec-tations of ourselves as members of our communities. Patricia Wittberg SC offers three models of relation-ships of community and authority. Hierarchical/Bureaucratic Model: This model offers an organized way to carry out the purpose and mission of the congregation. The value it emphasizes is effi- Review for Religious ciency; the mode of operation is dependency. Power and authority are concentrated at the top and flow downward, as does communication. There is little individual responsibility. The young are mentored, and the model can continue without changing. Every congregation has some elements of hierarchy/bureau-cracy which are needed for effective functioning of an organization. Associational Modek This model values individual fulfill-ment; the individual "I" is at the center of the model. Relationships are one-on-one and dependent on the individual's choice of persons to whom s/he wishes to relate, both within'the organization and outside it. Persons live as if this were a professional organiza-tion where membership is equated with paying one's dues or meeting basic requirements and participating as one wishes. Leadership is often not acknowledged or is reluctant to call for difficult actions on the part of members. This model is not likely to reproduce into the next generation. Communitarian/Relational/Intentional Modek The value for this model is the common good; interdependence is the desired mode of operation. Relationships and communication are mutual and are focused around a sense of common identity--"we" with members and leaders working together for common goals. In this model, individual members are willing to sacrifice or limit some personal goals for the common good. There is a mutual shaping of the future. Wittberg says today'~ congregations have their ¯ Toe in the Hierarchical/Bureaucratic model; ¯ Torso in the Association model; ¯ Hand reaching out to the Communitarian model, but fearful of sacrifice or of retreat to the Hierarchical model. She offers this reflection: Religious congregations, precariously balanced between the competing commitment models of 67.4 2008 Eichten ¯ Constitutions and Heart Knowledge 378 ] bureaucracies and intentional communities, may. ¯ have mutually contradictory expectations of their leadership or of their members . Congregatio.ns which refrain from addressing the ambiguous roles of leadership [I would add membership] may miss discov-ering creative and psychologically healthy new ways of filling them. Most communities, I wager, create goals based on the Communitarian model while denying or not acknowledging that the other models exist and may even predominate. There is no right/wrong, good/bad to any model; each has good elements. It might be worthwhile to reflect together on the blessings and challenges of each model as you experience them in your community. The challenge may be to identify and implement the best elements in each as we move into the future. Governance is part of the process of communal transformation. It invites members to a continual com-munal effort toward conversion of heart, mind, and spirit. We bring together our individual selves with our dreams, passions, idiosyncrasies, and personal power. Through the design of our constitution, we seek together the common good for the sake of the gospel. We are one with many, experiencing a range of relation-ships that offer the possibility of transformations into people mutually empowering and accountable. All of these relationships--with God, with one another, with authority, and in mission--are what constitutes your religious congregation and mine. Relationship calls for risk, trust, hope, and moments of conversion, moments to be followed up with firm "soul decisions" to give our all to God's grand dream "that all may be one." Review for Religious Personal Reflection / Group Discussion "Fundamentally constitutions exist to articulate 'heart knowledge,' and are not the mere sets of rules and laws that a legalistic mindset too easily makes them." Have I experienced a "heart knowledge" approach to the reading and study of the constitutions of my congrega-tion? What are some necessary steps for me to take in order to read the constitutions in such a way? What happens to me when I approach the constitutions of my congregation in terms of relationship~to God, to community, and to mission? How do I understand my relationship to structure and authority? Dark Matter It should not surprise us that we encounter darkness and unknowingness within; two-thirds of the cosmos is dark energy and we are offspring of that unfolding mystery, pregnant with possibilities, gestating, incubating in our wombs. The shapeless masses and undeveloped forms lie clogged in a fathomless morass, yet the Potter takes the no-thingness, gently birthing it into a new creation. Barbara Mayer OSB 379 67.4 2008 NESTOR GREGOIRE Can New Life Arise from the Rule Book? 380 ~iin every religious congregation the religious Rule s the distillation of the community's spirit, ideals, goals, and governance. It is the result of years of reflec-tion and prayer, revisions and constitutional changes. It is meant to be the mission statement (long before the term was ever developed) of all the members of the religious congregation: novices, newly professed, and those with perpetual vows. But have the rules become too much a document of doctrinal values and governance procedures in too nar-row a sense? While they are read and studied, reflected upon and taught in many conferences, are they a source of nourishment at the grass roots? Do we consult the Rule Book about what to do, or do we use it for prayer and as inspiration for our prayer, our liturgy, and the community's day-to-day life? Is it more reference book than prayer book? Nestor Gregoire OMI lives at 504 - 3rd Avenue East; Meadow Lake, Saskatchewan; S9X 1H5 Canada. olppastor@sasktel.net Review for Religious How do the Rule Book and the constitutions serve your congregation? Is it very directive, constricting the community's life and spirit, or does it improve vision and expand the horizons of community members? Does the text go beyond expressing doctrinal correctness and touch the community's lived experience? How does the Rule actually fit in the day-to-day living of the local community? Do particular rules have noticeable par-ticular effects? Are there unintended consequences? The Rule Book must be more than a reference book that the novices study, consult, and know parts of from memory. It must become user friendly and be a living part of the community's prayer life. A good indicator of this would be how worn the pages of our personal copy of the Rule Book are. Are they library fresh, or do they have fingerprints, personal notations, and other signs of frequent use? Does the book appear to be one that is close to the heart of a community member? User Friendly Each community can work to make the Rule user friendly in its own way. There are many ways that indi-viduals and communities can find to do this and thereby nourish their own and the community's spiritual life. No one size fits all. Be creative. In the publishing world there have always been meditation books to serve our prayer and reflection, often with a page containing one thought or insight for each day of the year. The reader need not delve into a developed chapter. Often religious congregations will prepare a book of meditations for each day of Lent and Advent and send it out to their members. One of the best ways to make the Rule Book user friendly is to ask members of the community to develop 381 67.4 2008 Gregoire * Can New Life Arise from the Rule Book? 382 a series of meditations and prayers that arise from the values, the vision, and the actual words of the rules. What themes recur frequently throughout the rules? What resources are there available to assist reflecting and praying about the meaning and implications of indi-vidual rules and their contexts? With the Rule Book as our source document, it is possible-to develop a series of meditations which incor-porate the values and teachings of general chapters, writings of our congregation's past and present spiri-tual teachers, and stories of members who served well, lived the charism with joy, and even may have given the congregation its particular tone. Bring the character and flair of these members to the meditations. The stories and the experience of members who have preceded us can help us discover in the Rule mean-ings that are new to us. Each congregation's Rule Book did take on flesh, in joy and tears, in earlier members. What possibilities does the same Rule challenge us to try and perhaps fulfill today? By preparing a series of meditations on the rules and constitutions of my own congregation, the Oblates of Mary Immaculate, I discovered new connections being made between the documents of the past four general chapters, the talks of our superior general, and the text of the Rule. New depths appeared in my own under-standing of our "mission statement." The Founder's Writings There are many opportunities to take bite-size quo-tations and insights from the talks and writings of the founder to flesh out the meaning of particular state-ments in the Rule: We can parallel today's text with passages which ring with the conviction of the founding Review for Religious members. The writings of the founder and founding members can help us appreciate and integrate the offi-cial text into our daily lives. Using the actual words of our congregation's founder can develop a fuller understanding and application of this particular rule. Our understanding of the present text must not be based only on its meaning on the page. It must be broadened to the possibilities that are given to it through the insights of our foundation documents and the firstmissionary endeavors. Allow the writings of the founder and the early members to give new flesh to our understanding of our community charism, the religious values and idealism of our institute. When we try to broaden the possibilities for new insights into and understanding of the Rule, we can find togetherness and nourishment in our foun-dational days and in our church's mission in our mod-ern world. Not only must we seek the contributions of the past to our living the Rule today, but we must be receptive to the new insights and challenges that our situation brings to the Rule. The Rule must always be in dialogue, giving to and receiving from our current mission work, our reflections, and our prayer. Daily Prayer The words of the Rule can be used in composing prayers for the community's daily life. Take individual statements of our rules and constitutions and adapt them into prayers of intercession for the daily office. A little editing can bring the rules' clear and concise statements into our prayer with God. Here are two examples, from our Oblate Constitutions and Rules. The text is not just read but becomes a living part of our prayer. 67.4 2008 Gregoire ¯ Can New Life Arise from the Rule Book? Leader: Lord Jesus, may we always work in cooperation with you, our Savior, and imitate your example-- Response: --by committing ourselves principally to evan-gelizing the poor (Constitution #1). Leader: We pray that the community of the Apostles may with you, our Jesus, be the model of our life (Constitution #3). Response: May we come together in apostolic communi-ties of priests and brothers, united to God by the vows of religion, cooperating with you, our Savior (Constitution #1). We must search for other places in the Rule that can be used in composing new prayers for various community gatherings: at the beginning of meet-ings, on renewal days, at funeral prayer services, and so forth. 384 Poetry and Song Our Rules are meant to be user friendly, to be alive in us, to be at home in our emotions and in our heartfelt prayers. They must touch us in order to move us, to energize us tolive the religious values and the charism our Rule expresses. In her classroom a good teacher makes sure that her students not only pay attention and read the lesson on the board, but also write it, sing it, recite it, and put it .into bodily motion whenever possi-ble. There are so mgny ways that lessons can and should become part of her students' minds and hearts and lives. Too often our religious Rule has been limited to the printed text. Can we express it in new ways? One of the most underused possibilities for our Rule to become more user friendly is to turn it into poetry and song. Where are the gems of religious thought that are seeking to get off official printed pages and be sung Review for Religious as proof of our willing service of Christ and as ways to bring joy and love to the poor? Has the text of our Rule ever become a hymn or a refrain? Have we asked the poets in our midst to look at the Rule and allow the poetic muse to bring forth through them new pic-tures for our imaginations, fresh words that touch our hearts? And what of the photographers, the painters, and those who can sketch? Can they create visual expres-sions of the valued teachings in our Rule? Can the text evoke in them color, pattern, and depth that they can share? For the next community gathering, can one of our photographers bring together a collection of sym-bolic photos and significant texts to help us see our Rule in new and vibrant ways? Let the imagination within your community enable your Rule to be absorbed by your community through all five senses. How else? Let me draw a picture from many a childhood. Will your community's Rule Book be like an encyclopedia that was bought years ago to give the children a learning atmosphere but was hardly ever used? Or will it be like your mother's cookbook, tat-tered, pages falling out or sticking together, scribblings in the margin, flour stains, memories of mother calling us or fragrances inviting us to just-baked cinnamon rolls or to supper? Cookbook, prayer book, rule book--all redolent of love and devotion and sharing. How differ-ent are they? 67.4 2008 JOEL RIPPINGER Monasticism' s Rooted Adaptations ~f~irtainlmg oass ta f porrotyfe ysseeadr sm ionn ak cwohmom hausn liitvye odf Benedictines, I am aware of the reality that, at the beginning of the third millennium, monasteries of men and women living according to the Benedictine Rule constitute an endangered species. We run the risk of becoming an exotic form of religious expression, with our communities acquiring the character of religious theme parks and our spiritual tradition being taken over by increasing numbers of nonprofessed laypersons intensely attracted to the monastic charism. Several developments have been part of this phe-nomenon. Vocations to vowed monasticism have been in decline for some years, especially in North America and Europe, and that course seems to be continuing. With this decline there has been a marked increase of lay oblates and affiliates to monastic communities. Joel Rippinger OSB writes again from Marmion Abbey; 850 Butterfield Road; Aurora, Illinois 60504. Religious Many of those bringing with them this new interest in monastic life have adopted and are putting into prac-tice much of this ancient heritage. Indeed, one of the remarkable aspects of the recent rise in popularity of all things monastic has been the spate of books and articles by such non-Catholic and nonprofessed writers as Kathleen Norris. Norris and others have brought to monastic life both an inherent sympathy for its spiritual character and an outsider's insights into its distinctive charism. They have brought to wide circles of believers their insights into monastic common life and liturgical prayer. The contemporary phrase "family values" has a spiritual counterpart in what book publishers have pro-moted as monastic values. In fact, it seems that attaching the very word Benedictine or monastic to any book can assure many readers. The number expands when it takes in American and British television productions chroni-cling life inside monasteries for visitors from outside the cloister. The recent surprise hit from the Grande Chartreuse in the French Alps, "Into Great Silence," was an exploration of the most austere monastic order, the Carthusians. All of this has generated some striking spiritual scenarios. Increasing numbers of the laity are seeking retreats and spiritual direction at monastic houses, even as the professed monastic men and women struggle to maintain sufficient staff to care for their visitors' needs. Diocesan priests, who once were sent unwillingly to monasteries as a place to be disciplined and do pen-ance, now willingly sacrifice time and personal comfort to make personal retreats in the solitude and silence of monastic guest rooms. A cottage industry has arisen to publish material on St. Benedict's Rule as a model for corporate management, ecological balance, and family 67.4 2008 Rippinger ¯ Monasticism's Rooted Adaptations The hospitality called for in the monastic tradition trumps demands for orthodoxy or religious conversion, life. And, as we have said, programs of spirituality are likely to attract sincere searchers if they use the terms Benedictine or monastic in their publicity. At one level, all of this is cause for rejoicing. An ancient and revered tradition of spiritual formation and communal observance has been retrieved. What only a few decades ago many considered an arcane and irrelevant current of church life is now prized as a source from which to draw the gospel's living waters. Nor does it hurt that monasticism repre-sents a strain of tra-dition that antedates the Reformation and the more polemi-cal and controver-sial categories of the Catholic Church's public profile. Protestants and other non-Catholics come to pray and to dialogue in monastic settings, and they feel at home. The hospitality called for in the monastic tradition trumps demands for orthodoxy or religious con-version. Moreover, the sacred space of monastic cloisters attracts an intriguing variety of searchers. There are those seeking the soundness and insights of spiritual direction, pursuing like Tony Hendra the wisdom of the "Father Joes." There are those drawn by the aesthetic appeal of Gregorian chant and the spare beauty, not of bare ruined choirs, but of natural landscape and architecture that inte-grates silence and a life shared in community. There are those who, caught in the frenzy and rootlessness of what passes for contemporary culture, see in the deep-rooted witness of monastic communities a safe haven. Review for Religious At another level, there is cause for concern. The fact that some monastic communities are dying is a reminder that this is part of a historical cycle that has been in place for well over 1500 years. The dying also alerts us to an unsettling prospect for the near term. There will be fewer and smaller communities of pro-fessed monastic men and women in North America and in first-world countries generally, along with the emer-gence of an ever larger number of nonprofessed devo-tees of all things monastic. The irony here has already been referred to. Devout "outsiders" come to a monas-tery today for the experience of leisure and for restful rhythms of prayer, but they also expect to encounter monastics, whose own time for spiritual direction and holy leisure is now much eroded from what it was in an era of bulging novitiates. It may in fact be a blessing that the outsiders look-ing over the cloister wall are now faced with the real-ity of human struggle and imperfection that is always present in monastic enclosure, but too often in the past has been disguised by various romantic views of monas-tic life. The economy of monasteries is of a piece with its marginal status in society--always a bit parlous and never capable of assuring a comfort zone for those who are committed to it. At the same time the interface with a nonmonastic public has changed. The services pro-vided by the larger monastic communities have evolved with the passage of time. No longer anchored exclu-sively in such institutional ministry as education or pas-toral care, many of the more contemplative houses now emphasize the signature monastic marker of hospital-ity. Monasteries that were once remote in both a physi-cal and a psychological sense now have accessible Web sites and accommodating retreat centers. While some of 67.4 2008 Rippinger * Monasticism's Rooted Adaptations Monasteries of the third millennium have broader borders their contact with an outside public entails the selling of caskets and caramels, fruitcakes and jam, greeting cards and icons, another dimension consists in offering guests the freedom of a room without HBO or wireless com-puter hookup, but with the amplified sounds of nature and the silence of the cloister. The counsel of a wisdom figure and the simple rhythms of a daily round of prayer and work constitute for many guests the unique spiritual ambience of monastic hospitality. If monastic life has been de-romanticized in recent years, it has also been given a wider religious compass. Monasteries of ~e third millennium have broader bor-ders than their predecessors. An international com-munity like Taiz6 illustrates an ele-ment of young than their predecessors, people that is quite at home in the lit-urgy and life of a monastic commu-nity. Thomas Merton would no doubt be impressed at how his Trappist community at Gethsemani recently invited a number of victims of clergy sex abuse to their community to have the monks hear their stories. The spirit of ecumenism and religious renewal heralded by Vatican Council II is incorporated in the variegated communities of Bose and its satellite houses in Italy. The number of non-Catholic and non-Christian com-munities that have claimed monastic connections in recent years is not small. These include not just tra-ditional communities of the Anglican and Lutheran tradition that follow the Benedictine Rule, but variants Revie~v for Religious of the Orthodox faith that follow the different forms of Eastern monasticism. This has led to some fascinat-ing boundary crossing, such as Pentecostal seminarians in Missouri taking regular weekend retreats at a local Trappist monastery or a Monastic Institute sponsored by St. John's Abbey in Minnesota inviting representa-tives from Buddhist and Islamic traditions to speak of monastic hospitality. A measured look at the future should not induce too much anxiety. Monasticism in the third millennium can count on doing what it has always done: adapt its timeless liturgical round and its particular work of com-munity life to fit the needs of a changing world and ever more complex demands. To do that in a way that is faithful to its spiritual pedigree and open to a wider public will require drawing both old and new from its storehouse. The shape of a future monastic identity will have less to do with drawing people by the charm of its physical surroundings and more with the substance of spiritual life. However newly configured it becomes in the course of the coming generations, one can only hope that monasteries will remain places where a wide variety of people can find a place of peace, a place where the work of inner transformation can be encouraged and expedited. 391 67.4 2008 WILLIAM P. CLARK Revisiting Hope spiritual reflection An Irish-American author, by the name of Frank O'Connor, writing of his growing up in Ireland, told how he and his pals enjoyed hiking in the countryside. Sometimes they would come to a wall separating one farm from another, a wall that seemed too high to scale. They would then toss their caps over it and thus be motivated to scale it. When obstacles daunt, we need to use our hope like those caps. In one of Graham Greene's novels, a man speaks of hope in a strange way. He refers to it as a disease. If it is a disease, it is a disease which both comforts and strengthens and is an antidote for the cancer of despair. We very much need hope after all the disheartening things we have experienced in our world and in our church in recent years. We need hope William P. Clark O!VII, in active retirement from teach-ing philosophy, writes from St. Henry's Oblate Residence; 200 North 60th Street; Belleville, Illinois 62223. Revi~-w for Religious in our own public and private lives. Charles Spurgeon offers a good image of hope: "Hope is like a star--not seen in the sunshine of prosperity, and only discovered in the night of adversity." Hope seems especially important as we grow older. As adults we come to realize that choices really do not exist in the way we thought they would when we were children. We expected the regal power of adulthood to provide clarity and insight and control. In the light of humbling realizations, hope takes on increased impor-tance. According to an oft-quoted saying of Julian of Norwich, "The highest honor we can give God is to live gladly because of the knowledge of that love." We can give God that honor only through faith and hope. We know of God's love through faith. The primary object of hope--and our destiny--is to be perfectly united with God in love. Diametrically opposed to hope is the belief that existence is meaningless. If existence has no mean-ing, why would anyone want to continue living? One of our most intimate experiences is of ourselves as incomplete, as unfinished. As someone put it, "In this life there are no finished symphonies." We are drawn beyond anything we manage to achieve. Regardless of the level at which we find ourselves, we feel an attrac-tion to something still higher. In a certain sense, we leave every achievement behind in the very moment of accomplishment. When we achieve what we most want, our pleasure in it often fades. We even may be most acutely aware of our failures precisely when, after some achievement, someone praises us for it. Even in our achievements, we experience the need to go beyond where we are. We still hunger for what is "not yet." Desire outstrips satisfaction. Desire or longing is a driv- 393 67.4 2008 Clark * Revisiting Hope ing force in our lives. It can show itself as aching pain or as hope. As Christians we deal with the future by choosing to believe that life, not death, is the ultimate reality. We choose to turn continuously to our God in hope. That hope rests on the conviction that we are free and thus we have real control over our future. We can turn from where we are to what we want to be. Hope is confidence in God's power to do all things. Hope is the "nevertheless" of faith. In spite of every contradiction, we believe in the divine life within us and that God will bring it to completion if we but persevere in trust. We believe God will preserve and guide the church. Sometimes believing those things is difficult. That is why we must again and again ask the Lord to strengthen our hope. Hope might well be described as the dynamic force of faith and love. Because we are pilgrims, because we. do not see God and do not yet share God's love defini-tively, our faith and our love need to be permeated with hope. We know we cannot attain final fulfillment on earth. We know equally well how decisive our life on earth is in regard to final fulfillment. It is through hope that we press on. Hope offers a vision beyond the inevitable difficul-ties of our human condition, beyond human suffering and even death. It is hope that enables us to choose life, even in a deathlike situation. In hope we trust God can bring life out of death. Sooner or later virtually every-one has to face a deathlike situation in which they are challenged to choose life. It is a deathlike situation to be forced (in fear) to enter long-term nursing care. It looks like the end of the road, the gateway to death. From a purely human Revie~ for Religious point of view, there seems nothing to look forward to except the loss of privacy and freedom, humiliating dependence, chronic pain, and loneliness. To many it appears worse than death. How do people find the courage to carry on in such a situation except through hope? Persons with severe disabilities, persons who have undergone some crushing loss or misfortune, how can they find the courage to go on except through hope? Obviously the hope in question is not a form of escapism or wishful thinking. Rather it is the kind of hope that the Catechism calls a "theo-logical virtue." That terminology is helpful, emphasizing two charac- .teristics our hope should have. By saying it is a virtue, we are saying it is a well-intentioned, stable aspiration. By saying "theological" we are saying it is directed toward God and is a gift from God. Christian hope is not based on self-confidence. Self-confidence is fragile even in a purely human sense. A combat pilot in World War II put it this way in his book God Is My Co-Pilot: "Those who knew no strength except their own to lean on soon found that fear can sabotage even the strongest hea~'t." As Christians, the fulfillment we hope for is pure gift. It is not something we deserve because of our own talents, or efforts, or merits. Nor should hope be confused with optimism. Hope and optimism are quite different. Optimism often distorts reality, making it look better than it is. Hope is the assur-ance of God's fidelity even in the most troubled times. Hope means surrendering everything into God's hands. Christian hope is not based on self-confidence. 67.4 2008 It is not unusual for people to lose hope, to become disillusioned, even bitter, when years of hard work bear no apparent fruit, when little of a desired change is accomplished. Such temptations can surface in any life when one's efforts and prayers seem to be without result. We may be tempted to confuse unseen results with waste, utter waste. That is a mistake. Real faith and hope pro-vide the remedy for that temptation and that mistake. For whatever reason, hope seems to be a some-what neglected virtue. In the Christian tradition we find much more emphasis on faith and charity than on hope. Simply consider the output of books and articles, whether in academic theology or in popularization. Hope also seems an underdeveloped virtue. One finds people whose faith is firm who nevertheless experience considerable fear and anxiety. In his book The God 1 Don't Believe ln, Juan Arias tells of a conversation he had with the great Dominican theologian Reginald Garrigou-Lagrange. The conversation took place toward the end of Garrigou's life. He is quoted as say-ing: "How difficult is hope! I feel I shall soon reach my God. I cannot deny that my faith and my charity have been purified and that they are virtues which I possess in peace, but hope is my torment." Scripture scholars tell us it is often difficult to dis-tinguish faith and hope in the Bible. One reason sug-gested for' this is that the original Hebrew text uses the same root word for both ideas. Thus there seems to be a scriptural basis for saying that hope is not something apart from faith. Bernard H~iring calls hope "the inter-nal dynamism of faith." Faith is more than intellectual assent to a body of propositions. The fullness of faith is the gift of one's whole being to God as Truth itself. The biblical con- Review for Religious cept of faith includes trust in the Lord, who is faith-ful, who pledged to remain with us, who gave us that hope-inspiring message recorded by John: "Do not let your heart be troubled. Trust in God and trust in me. There are many mansions in my Father's house; if there were not I should have told you. I am going to prepare a place for you, and after I have gone and prepared you a place, I shall return to take you with me; so that where I am you also may be" (Jn 14:1-4). In the Bible, faith is understood as a joyous, grateful acceptance of the One who is our savior and our hope. In the Epistle to the Hebrews, there is a close con-nection between faith and hope. "Faith is the confident assurance concerning things we hope for and conviction about things we do not see" (Heb 11:1-2). Scripture scholars tell us this is not a formal definition of faith. In any case, the passage gives us a good insight into the dynamic nature of faith. It suggests how hope is implied in faith. We think of hope as a reaching beyond. Faith is depicted here as enabling us to reach beyond ourselves and our own powers in a double sense. The first part of the passage, "Faith is confident assurance concerning things we hope for," represents reaching beyond our-selves into the future. It concerns what is not yet pres-ent but is confidendy awaited. The second part, "Faith is. conviction about things we do not see," represents reaching beyond ourselves to grasp a present reality that is unknown except through faith. Together these two dimensions describe essential characteristics of Christian existence. First, Christian existence is marked by the assurance that the goods promised by God will be ours. Second, Christian existence is marked by the conviction that the past and present facts on which that assurance is based are indeed facts and not illusion. 67.4 2008 Clark * Revisiting Hope The assent of faith is a surrender to God reveal-ing himself and his kingdom to us, a surrender based ultimately on the testimony of the Spirit, not on the strength of any argument. Faith gives assurance to our hopes because God does not reveal abstract, philosophi-cal ideas, but trust-inspiring truths of salvation, or, better, God reveals himself as a lov-ing Father. To put it another way, by faith we not only believe in God but we also believe that God believes in us. Typically we focus on the first part of that statement. Most people, if asked what ° they mean by faith, would answer with a simple formula such as "It means belief in God." We fail to appreciate the implications of the second part of the statement, that God believes in us. This latter idea is the basis of our hope. Saying God believes in me means he knows I am capable, of being totally fulfilled. It means I have such a capability because God has so willed it. This is possible because God's faith in me does not depend on me, on my goodness. That faith in me comes from the fact that God first loved me. That love is the foundation of my goodness and my value. As Fulton Sheen used to say, "God does not love us because we are good. We are good because God loves us." God's love is unshakable. God loves us without the possibility of regret or reversal. The Bible constantly reminds us of God's initiative. It tells us over and over again of God's loving invitation to us, that he does not regret his work, that his friendship is everlasting. It is By faith we.not only believe in God but we also believe ¯ that God believes in us. 398 Re~iew for Religious not easy to believe in this faith God has in us. It is not easy to sustain the hope that belief implies. So we often minimize God's generous love. We hesitate to believe that God believes fully in us. Only too often do we have to face our limitations and our brokenness. In spite of that, God seems to be telling us: "I know everything about you but I still believe in you." In Isaiah we read: "The mountains may depart, and the hills be shaken, but my love for you will never leave you, and my covenant of peace with you will never be shaken, says Yahweh" (Is 54:10). God does that in spite of our infidelities, our sins. "Though your sins are like scarlet, they shall be white as snow; though they are red as crimson, they shall be like wool" (Is 1:18). We can trust completely in God's faithfulness even though it is beyond our ability to measure. According to our narrow standards, even a mother can lose faith in her child. But God never loses faith in us: "Does a woman forget the baby at her breast, or fail to cherish the son of her womb? Yet even if these forget, I will never forget you. See, I have branded you on the palm of my hands" (Is 49:15-16). Even if we deliberately turn away from God, God continues to believe in us. He goes on believing in our capacity to return. Like the father of the prodigal son, he will go out every morning and evening to wait for us with open arms. When he sees us returning, he will run to meet us and prepare a feast for us. There is not one text in the Bible mentioning sin and judgment without some reference to the hope to which God calls us. This conviction that God believes in us, this hope, is obviously important in our spiritual life. It also has great witness value. Traditi6nally we have been encouraged to witness to our faith by the way we lead our lives. In 399 67.4 2008 Cl~rk * Revisiting Hope 400 today's world it is vital also to witness to our hope. In our shrunken world we are constantly made aware of the problems, the suffering, the evil that exists in virtu-ally every corner of the world. That led Louis Evely to say, "Hopelessness gnaws at our era." We are called to witness to the meaning of Christian hope. We need to show by our lives how our hope gives us strength and courage to face the difficulties and problems that inevitably come into our lives, to show, as Isaiah says, "Those who hope in Yahweh renew their strength, they put out wings like eagles. They run and do not grow weary, walk and never tire" (I~ 40:31). It is important to bear that witness. In Lumen gen-tium the council fathers urged Christians not to hide their hope in the recesses of their hearts, but to bying it to bear on the external structures of daily life. Pierre Teilhard de Chardin was fond of saying, "The world belongs to those who offer it the greatest hope." Christian hope is a gift, a gift of peace, but also a deci-sion. Christian hope means that in and through Christ we can courageously face sin and evil in the world and in our own lives. Hope frees us from the need to predict the future and allows us to live in the present with the deep trust that God will never leave us, but rather will fulfill the deepest desires of our heart. It is important to realize that Christian hope is not a form of escapism or wishful thinking. It is a Christian virtue, not a purely human virtue. No one naturally hopes for victory in the face of helplessness or defeat. In his Letter to the Romans, St. Paul utters a triumphant cry of hope: "Condemnation will never come to those who are in Christ Jesus, because the law of the Spirit which gives life in Christ Jesus has set you free from the law of sin and death" (Rm 8:1-2). Paul's hope arises Revie~ for Religlous out of his personal experience of the inward struggle and anguish that characterize the human situation (Rm 7:14-23). He ends that description with a desperate cry: "What a wretched man am I? Who can free me from this body under the power of death?" And Paul answers: "God--thanks be to him--through Jesus Christ our Lord" (Rm 7:24-25). What distinguishes Christian hope is that it arises in the very face of human helplessness and defeat and is anchored in Jesus Christ. The Epistle to the Hebrews says: "This is the anchor our souls have, reaching inside the curtain, where Jesus has entered as a forerunner on our behalf, having become a high priest forever of the order of Melchizedek" (Heb 6:20). This does not mean we are to leave the present world as it is and simply wait for God to make it new. History reveals that the Christians who did the most for the world in which they lived were precisely those who thought most of the next. We need to look not only at what we hope for but also at what we are doing when we are hoping. Hoping implies looking ahead, but it is not just envisioning something we do not yet possess. The experience of hope includes three things: desire, we want what we hope for; belief, we believe what we hope for is indeed possible; doubt, we fear what we hope for may not hap-pen. Those are the elements of human hoping. Hope, as a Christian virtue, is something different, something more. The difference lies in the third element. Christian hope does not include doubt. Christian hoping is not just believing in the possible. It is a conviction about what is sure. Christian hope is the gift of certainty that what God has promised will surely be ours. St. Paul calls it a "hope that never disappoints" (Rm 5:5); in 401 67.4 2008 Cl~rk * Revisiting Hope Christian hoping comes only as a gift of grace. 402 Hebrews it is called "a sure and steadfast anchor of the soul" (Heb 6:20). Christian hoping comes only as a gift of grace. It is rooted in faith, which is itself a gift. Our faith and our hope are not based on history. A natural reading of history surely does not provide us encouragement to hope. In fact, that reading of history suggests that noth-ing will ever change radically for the better. That reading of history provides no model of people living together in mutual respect and universal love. In fact we see just the opposite. The human appe-tite for violence is enormous. A cynic would say history shows that people love killing each other. Almost three thousand years ago Homer wrote in the Iliad: "Men grow tired of sleep, love, singing, and dancing sooner than war." One need look no further than the last cen-tury for ample evidence supporting that view. But there is another history, the history of God's definitive intervention in our world in the person of Jesus Christ. Our faith and our hope are based on that intervention, on God's word--his word in Scripture and his incarnate Word. In his second letter, St. Peter tells us: "What we are waifng for, relying on his promises, is the new heaven and the new earth, where uprightness will be at home" (2 P 3:13). Old Testament prophets have spoken of "swords beaten into ploughshares and spears into pruning hooks" (Mi 4:3); "lions sleeping alongside lambs, the poor given justice, the weak raised to strength, and no hurt or harm done on all God's holy mountain" (Is 11:6;9). Preaching to the Jews, Paul said: Review for Religious "To keep his promise God raised up for Israel one of David's descendants, Jesus, as savior" (Ac 13:23). Hope is a challenging virtue. There are times when our hopes seem to be in vain. Hoping for, if not an end, at least a lessening of suffering and evil in the world seems almost a futile effort. And, from time to time in our personal lives, we are disappointed in our hopes. Often we may feel we have only enough spiri-tual bread in our basket for one day, and we are fearful about tomorrow and all the tomorrows to come. But we do not live in those tomorrows. We have no guarantee there will even be a tomorrow for us. In any case, just as the past is history and should not preoccupy us, so the future is mystery and should not preoccupy us. There is a difference between living for the future and living in the future. The former is done in the present; the latter alienates us from our real life. Among the ancient Christian symbols in the Roman catacombs, there is one which depicts an anchor with two small fish attached to the points of the anchor. The symbolism is clear. We Christians are the small fish attached to the anchor of our hope, Jesus Christ. God offers us the fullness of hope in Jesus Christ. Christ, as the fulfillment of God's saving love, is our hope. Christ is the great visible sign of God's fidelity and love for all men and women. Christ is our hope as victor over all the negatives of life, over the disappointments and frustrations, over anguish and pain, over sin, and even over death. "In the power of the Holy Spirit, may you be rich in hope" (Rm 15:13). 403 67.4 2008 HEDWIG LEWIS Becoming All Fire: Thoughts on Religious Identity Abba Lot, one of the Desert Fathers,. on a visit to Abba Joseph, confided: "Abba, when I am able, I recite a short office, I fast a little, I pray, I medi-tate, I stay recollected. As far as I can, I try to keep my thought pure. What else should I do?" Abba Joseph rose to his feet and stretched out his hands to heaven. Suddenly his fingers became like ten lamps alight. He turned to Abba Lot, eyes sparkling, and whispered, "If you will, become all fire." 404 A young Jesuit, in one of his regular sessions with his spiritual director, asked searchingly: "What is it to be a Jesuit today?" The older Jesuit grabbed a hard-copy of the Decrees of General Congregation 35 (GC35) that lay beside his compute.r, raised it aloft, and said, emphasizing every phrase: "To be a Jesuit today is to be 'a man on fire.'" Many a mystic has written about the "spark of the divine" in every human heart. Divine Providence graces each Of us with potential to turn that spark into a blaze. Hedwig Lewis SJ, th~ author of several professional and psycho-spiritual books, reside~ at St. Xavier's College; P.B. 4168; Ahmedabad 380 009; Gujarat, India. His website is http://joygift.tripod.com. Review for Religious We can let it burn so fiercely that everything around catches fire, spreading far and wide, destroying despair and detestation, creating space for hope and harmony. Hearts Inflamed Fire has often been used to express diverse emotions we experience: purification and passion, comfort and control, devotion and devastation. "Becoming all fire" would mean controlling these conflicting tensions and living life to the full--hearts on fire with Love. And Love then spreads out, setting other hearts afire. All religious are called to be on fire with Love and to let Love shine forth through their good works, in keeping with their charisms, so as to bring glory to God and spread the joy of the kingdom. The Jesuits recently rekindled their own fire. Over a period of about two years before GC35 (held in the first months of 2008), they met in their provinces and came up with suggested topics for discussion, which were sent to Rome. These were scrutinized and presented to the delegates of GC35, who zeroed in on six themes and drafted them into decrees. These were promulgated in early June. Decree 2, titled "'A Fire that Kindles More Fires': Rediscovering Our Charism," defines Jesuit iden-tity today. It responds to questions like: What does it mean to be a Jesuit in a globalized world? What mean-ing and message do Jesuit life and identity bring to people of diverse identities? Drawing inspiration from this decree, I offer here some reflections on what it means to be % man on fire" in the Society of Jesus. I hope this article will serve as a source of enlightenment to Jesuits, to those who share the Ignatian constitutions, and to other men and women religious, and will help them to be "persons on fire." 405 67.4 200g Lewis ¯ Becoming.41l Fire: Tbougbts on Religious Identity The Enkindling Spirit Religious founders have been "men and women on fire," and members of all religious orders and congrega-tions today can tell stories of how they originated as a spark that enkindled other sparks and became a flame. A torch was handed from generation to generation. The first Jesuits "began a narrative, they lit a fire.''t GC35 beautifully summarizes this tradition in the opening paragraph of Decree 2: The Society of Jesus has carried a flame for nearly five hundred years through innumerable social and cul-tural circumstances that have challenged it intensely to keep that flame alive and burning: Things are no different today. In a world that overwhelms people with a multiplicity of sensations, ideas, and images, the Society seeks to keep the fire of its original inspi-ration alive in a way that offers warmth and light to our contemporaries. It does this by telling a story that has stood the test of time, despite the imperfec-tions of its members and even of the whole body, because of the continued goodness of God, who has never allowed the fire to die. (§1) When we read the histories of other religious communi-ties, we find them echoing these sentiments. The story of the Society of Jesus begins with St. Ignatius Loyola. The very name Ignatius suggests fire. Ignatius faced not only cannon fire but also the ecclesi-astical canons that almost had him burned at the stake. His spiritual journey as a "pilgrim" takes a defini-tive turn after his "sublime illumination" at the River Cardoner in Manresa (§5). He set myriad hearts on fire with the love of God, sharing his spiritual experiences through "conversations" and his "school of prayer," the Spiritual Exercises. He enlightened a few enthu-siastic men on the ways of God, forming a group that Review f~r Religious would share his vision of spreading Christ's kingdom. As the Eucharistic Preface of his feastday liturgy states, Ignatius provided the church "with a society of apostles on fire with [God's] love." A letter that Ignatius wrote in 1546 reflects his fiery spirit. A certain Friar Barberan in Spain had publicly expressed a wish that all Jesuits from Perpignan to Seville should be burned at the stake. Ignatius, in Rome, heard of the outburst and wrote to a friend, "Please tell Father Barberan from me that I wish him and all his friends and acquaintances, not only between Perpignan and Seville, but throughout the whole world, to be set on fire and burned up by the Holy Spirit, so that they may all attain to great per-fection and signalize them-selves gready, to the glory of his Divine Majesty." St. Francis Xavier, the pioneer apostle of the Society, ventured beyond physical and socioreligious frontiers "to set the world on fire." Through five centuries to the present, Jesuits have been inflamed with the same spirit and have followed the blazing trails of their predeces-sors and created new paths (§25;.Decree 1, §6). As "men on fire," charged by the Ignatian magis, Jesuits are urged to spread the fire of God's love even in the darkest parts of the world's civilizations (§22). They must gather people around and warm their hearts, listen attentively to their varied stories, encourage them to dance in harmony with their different melodies, and thus "give them meaning and provide focus in a frag-mented world" (§1). The Jesuit vision is to re-create a divine milieu by manifesting "a strong sense of the The very name Ignatius suggests fire. 407 67.4 2008 Lewis ¯ Becoming All Fire: Thoughts on Religious Identity sacred inseparably joined to active involvement in the world. Our deep love of God and our passion for his world should set us on fire--a fire that starts other fires! For ultimately there is no reality that is only profane for those who know how to look" (§ 10). Hopefully GC35's decrees will bring to reality the prophecy of the Jesuit visionary Pierre Teilhard de Chardin: "Someday, after we have mastered the winds, the waves, and gravity, we shall harness for God ener-gies of love. Then for the second time in the history of the world we will have discovered fire." 408 Persons on Fire The "new" fire that GC35 has lighted engulfs the "spirit" of the Jesuit identity as spelled out in the pre-ceding three general congregations. To be a Jesuit today is to be "a man on fire." The fire at the heart of a Jesuit's identity and mission is Jesus Christ (§2). The "man on fire" is an alter Cbristus, for Christ is his con-stant companion (§3). The "man on fire" lets his light shine through good works for the greater glory of God (§22). He enkindles other hearts with the Love that burns within him, for that was Christ's deepest yearn-ing: "I have come to cast fire on earth!" (see §21). From an Ignatian perspective, it is a "fire" that con-sumes and cleanses, for the Jesuit is "a sinner, yet called to be a companion of Jesus." It is a fire that cannot be contained, for the Jesuit is "a man for and with others." It is a fire that urges the Jesuit, a "servant of Christ's mission" (§7), to the edges of society (§24) in the ser-vice of faith and the propagation of justice (both human and environmental) (§7, §24; Decree 1, §6). The fire is kept ablaze by the Jesuit living out generously the Ignatian "polarities": "being and doing, contemplation Review for Religious and action, prayer and prophetic living, being com-pletely united with Christ and completely inserted into the world with him, as an apostolic body" (§9). Our near-contemporary St. Alberto Hurtado (of Chile, 1901-1952) was "a fire that enkindles other fires" (§25). He established the nonprofit organization Hogar de Cristo (the Hearth of Christ) to aid the homeless. It provides both shelter and human warmth for body and soul. Hurtado not only enkindled these unfortu-nate people, but wanted his experience with them to intensify the fire in his own being. He made this conviction abundantly clear: "Love them in order to make them live, that a more human life may develop in them, unlocking their intel-ligence, putting an end to their backwardness. May the errors anchored in their hearts prick me continuously. May I be tor-mented by the lies and illusions used to intoxicate and enrapture them; may the mate-rialistic press that pretends to enlighten them irritate me; may their prejudices stimulate me to show them the truth. And this is nothing more than the translation of the verb 'to love.' I have placed them in my heart so they may live as people in the light, and the light is none other than Christ himself, the true light that enlightens everyone who comes into the world. All the light of natural reason is really the light of Christ; all knowledge, all human science. Christ is the supreme science. ,2 Father Pedro Arrupe SJ was described in 1952 as "a man on fire" by a seventeen-year-old student in Madrid, The "man on fire" is an alter Christus, for Christ is his constant companion. 409 67.4 2008 Lewis * Becoming All Fire: Thoughts on Religious Identity Adolfo Nicol~is.3 Like Hurtado, Arrupe had sheltered the hapless victims of the atomic bomb at Hiroshima. Given his training in medicine, Arrupe ministered to those suffering from severe burns. His experience would inflame his own heart with greater compassion and love - - for the suffer- ,~ ing. Later, as the Jesuits' superior general, he would open centers for refugees (see Decree 1, §6). Arrupe's is also a good example of how "men and women on fire" foster religious vocations: they walk their talk and talk their walk in the service of the Lord. Arrupe's lecture on his experiences at Hiroshima had rekindled in young Nicol~s's heart the burning desire to become a Jesuit. Nicolas would later follow the great missionary to Japan and eventually succeed him as supe-rior general in Rome. The Jesuit "man on fire" must realize that "the Jesuit identity is relational." He shares in the life of a com-munity, each member drawing its fire from the same source: Christ. Together as "friends in the Lord," they bear witness to the Light. A glowing community life, one that is intensive and joyful, attracts people, "inviting them--above all the young--to 'come and see,' to join us in our vocation and to serve with us in Christ's mis-sion. Nothing could be more desirable and more urgent today, since the heart of Christ burns with love for this world, with all its troubles, and seek~ companions who can serve it with him" (§ 19). The Jesuit "man on fire" must realize that "the Jesuit identity is relational. Review for Religious Playing with Fire Jesuits are also, by choice, "firemen" in Christ's brigade. The "demons" of this age are on a rampage, spreading on earth the fires of the underworld through irreligion, injustice, and consumerism (see §21). As firemen in Christ's brigade, Jesuits have been called to unflagging commitment to Christ and his mission of extinguishing the fires that defile human dignity and ravage natural resources. The Jesuit fireman plays with fire and becomes vul-nerable to the "inferno" he has to confront. It often means getting burned by rampant injustice or religious fanaticism. He comes under fire when he ventures beyond the frontiers--as is evident in the long list of Jesuit martyrs for social justice in recent times. Yet he remains committed regardless of thorns, threats, and thrashings and moves ahead fearlessly under the banner of the cross (§11; Decree 1, §9). The pathway is not always bright. There are periods in the Jesuit fireman's life when the fire within him burns low, threatened by storms inside or out, or the path is hidden in thick smoke. He experiences, in short, the challenge of the cross--where "the Divinity is hidden." The light flickers or fades in the struggle, and doubts and anxieties oppress. The time may compare with what mystics have described as the "dark night of the soul." "The experience of a hidden God cannot always be avoided, but even in the depths of darkness the transforming light .of God is able to shine" (§7). The "man on fire" must not lose hope, but seek and find that "light" so as to rekindle his fire. After the example of Jesus our companion, whose "entire life was a kenosis," he must feel supported and continue on his mission (§ 14). 411 67.4 2008 Lewis * Becoming/Ill Fire: Thoughts on Religious Identity While GC3 5 was in session, every Jesuit community around the globe kept a small lamp lit in the chapel as a symbol of oneness and solidarity, uniqueness and unity. Every Jesuit, in his own God-given way, must more than anything else be "a man on fire." And then, merging his flame with the flames of other religious "men and women on fire," together with "all persons of goodwill" (§21), he must set the world ablaze. Notes ~ GC35, Decree 2, §2. The texts of all the decrees are available at www.sjweb.info. Paragraph numbers of this decree will be given in the body of the article thus: (§2). 2 Albert Hurtado, personal reflection written in November 1947, quoted in "Saint Hurtado's Christocentric Mindset" by Hedwig Lewis sJ, Ignis 2005, no. 4, Gujarat Sahitya Prakash, Anand, India. 3 Adolfo Nicolfis sJ, "Eight Encounters with Father Pedro Arrupe," Province Express, Australia, 14 November 2007. 412 A Birthing On my way to Damascus I was tripped by Grace, and fell Into the hands of Love. My brain lay scrambled And pride lay wounded I felt blinded. Deep within my labored soul Faith gave its birth cry. Paulson V. Veliyannoor CMF Review for Religious A. PAUL DOMINIC A Source for Prayer Undreamt Of God speaks first in one way, and then in another, but no one notices. He speaks by dreams, and visions that come in the night, when slumber comes on mankind, and men are all asleep in bed. Then it is he whispers in the ear of man, or may frighten him with fearful sights, to turn him from evil-doing, and make an end of his pride; to save his soul from the pit and his life from the pathway to Sheol. (Jb 33:14-18; JB) If it is true that God speaks to us in dreams, what fol-lows? Or what should we do? We should speak in turn. Or we should at least desire to do so and try. Speaking to God in dreams as God does to us in dreams is not normally at our command. However, whether we dare speak to God after we have dreamt depends on us: it is definitely within our power. Such speaking to God is prayer indeed. Prayer linked with dreams may start in dreams and end in them or continue after them, or it A. Paul Dominic sJ last wrote for us in our 66.4 (2007) issue. His address is Human Development Centre; Port Mourant, Corentyne; Guyana (South America). 413 67.4 2008 Dominic ¯ A Source for Prayer Undreamt Of 414 may begin only outside them, drawing inspiration from them. Both kinds could be learned, though for now my interest is in the second,~ which is simpler: it is prayer following the dreams. The literature on prayer has been mosdy on how to pray rather than on what to pray. Is it worthwhile to con-sider the manner and matter of prayer separately? In any case, being persuaded myself that more deserves to be said about what to pray about, I would like to deal with the hardly dreamt-of topic broached above. To state it explicidy, whatever you dream at night can well serve as food for your prayer. I believe that something sensible can be said about dreams as source material for our praying. The idea proposed here is really part of what Christians generally use in their meditative or contem-plative prayer, namely, the Bible.2 They use the whole Bible, even if not every page and even though they most often use Gospel passages.3 Even in the Gospels, some paragraphs may seldom be considered prayer-worthy. It is a rare person who will pray over the genealogy of Jesus given at the beginning of Matthew. Still, the Bible in all its multiplicity and variety serves Jewish and Christian prayer. I think this is true of the bibli-cal passages about dreams, albeit they are not noticed much.4 Biblical dreams are found here and there in both Testaments. For many, they could prove to be a new wellspring of prayer. God Active in the Unconscious A

Issue 55.6 of the Review for Religious, November/December 1996. ; lived experience of all who find that the church's rich heritages of spirituality support their personal and.apostolic Christian lives. The articles in the journal are meant to be informative, practical, or inspirational, written from a theological or spiritual or sometimes canonical point of view. Review for Religious (ISSN 0034-639X) is published bi-monthly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Telephone: 314-977-7363 ¯ Fax: 314-977-7362 E-Mail: FOPPEMA@SLUVCA.SLU.EDU Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ¯ St. Louis, MO 63108-3393. Correspondence about the Canonical Counsel department: Elizabeth McDonough OP 1150 Cedar Cove Road ¯ Henderson, NC 27536 POSTMASTER Send address changes to Review for Religious ¯ P.O. Box 6070 ¯ Duluth, ,\IN 55806. Periodical postage paid at St. Louis, Missouri, and additional mailing offices. See inside back cover for information on subscription rates. ©1996 Review for Religious Permission is herewith granted to copy any material (articles, poems, reviews) contained in this issue of Review for Religious for personal or internal use, or for the personal or internal use of specific library clients within the limits outlined in Sections 107 and/or 108 of the United States Copyright Law. All copies made under this permission must bear notice of the source, date, and copyright owner on the first page. This permission is NOT extended to copying for ~:ommercial distribu-tion, advertising, institutional promotion, or for the creation of new collective works or anthologies. Such permission will only be considered on written application to the Editor, Review for Religious. for religious Editor Associate Editors Canonical Counsel Editor Editorial Staff Advisory Board David L. Fleming SJ Philip C. Fischer SJ Regina Siegfried ASC Elizabeth McDonough OP Mary Ann Foppe Tracy Gramm Jean Read James and Joan Felling Iris Ann Ledden SSND Joel Rippinger OSB Edmundo Rodriguez SJ David Werthmann CSSR Patricia Wittberg SC Christian Heritages and Contemporary Living NOVEMBER/DECEMBER 1996 * VOLUME55 Q NUMBER6 contents directions 566 583 The Dialogue of Conversion: Toward Jubilee 2000 Jeffrey Gros FSC proposes ways in which religious communities can participate in the ecumenical dimension of preparing for and celebrating the bimillenary jubilee of the incarnation. A Way of Being Church: Journey, Serve, and Evangelize Erik Karl Riechers SAC explains the Union of Catholic Apostolate as a Pallottine family model for sharing a spirituality and ministry. models 593 Frances Cabrini: A Woman for Today Rita E. Goldman paints a w~rm and human portrait of Frances Cabrini as we celebrate the fiftieth anniversary of her canonization. 601 The Cistercian Martyrs of Algeria, 1996 M. Basil Pennington OCSO relates the story of the seven Cistercians who were abducted and killed in Algeria. Review for Religious life and death 613 619 Death Questions and Life Questions Cathy Arata SSND builds upon her apostolic experience in E1 Salvador in facing the hard questions of life. Prophetic Sorrow a Sign of the Times Beverly Anne LoGrasso OSU presents the Ursuline community's grief response to the rape and murder of two of their sisters. consecrated life 625 640 Full of Grace: Another Look at the 19th-Century Nun Dolores Liptak RSM relates the congregational stories of the 19th-century American sisters who transformed negative images and made of their own lives powerfully attractive invitations for service. "Objective Superiority" in Vita Consecrata Dennis J. Billy CSSR critiques the phrase "objective superiority" and presents an interpretation in the context of both Vatican II documents and Vita consecrata. 564 646 651 departments Prisms L.,'¢~,-s Canonical Counsel: Canon. 127 Technical Requirements for Advice or Consent Book Reviews 666 Indexes to Volume 55 November-December 1996 prisms Life and death issues are always with us. At times they touch more poignantly into our experience. Traditionally the November liturgical calen-dar is~ associated with death since we begin by remem-bering all the faithful departed and through the Sunday Eucharists we face somber scripture readings about the end times. December's liturgical calendar, on the other hand, looks more to life, celebrating Mary's conception as the "immaculate one" within a hope,filled Advent sea-son which culminates with the star-bright birth of Jesus our Savior. Prisms provided by life and death issues-have us face the God- and faith-questions in our lives. They are prisms necessary if we are to value realistically who we are, who we are becoming, and what we do, what happens to us. God provides us with many other prisms which help us see and appreciate the everyday richness of our lives and ministries as Christian men and women. Some people seem to little appreciate that we all use prisms to view life, accept values, and relate to God. Perhaps many of us fail to make use of the variety of prisms available through which to develop a more ade-quate and vibrant understanding of God, self, church, and world. Rather, some seem to choose to look at life through a single monochromatic lens or through a spattered one that allows only darkness and light and voids the rich sub-tlety of dawn and sunset beauty. Christmas presents us with an ever startling prism through which we see God's presence to ourselves and our world. We celebrate God's dialogue with us through the Word by whom all things came into being and in whom we find life. In listening to John's majestic pro- Review for Religious logue about the Word becoming flesh, I find the imagery of prisms and of dialogue all of a piece. John Paul II says, "By dialogue we let God be present in our midst; for as we open ourselves in dia- 'logue to one another, we also open ourselves to God." Dialogue-- entering into the presence of the Word--is similar to the various prisms of creation which allow us to truly seek and find a labor-ing God active in our world. Paul VI, too, had boldly proclaimed that "dialogue is a new way of being church." Drawing upon the imagery of the Word made flesh, he was reclaiming evangelization as an essential ele-ment of living ~the Christian life. Just as some people close them-selves from appreciating God's pervasive love that is visible in creation only through a variety of prisms, we can be people closed to the call to be church through dialogue. We can talk only to those people who think exactly as we do. We can read nothing that would challenge 6r broaden our mind-set. We can ,enter into conversation not to listen or to learn, but only to accept agreement or refute and "win the day." Not only evangelization, but life itself is being closed down--with other~ and so with God. It can happen to any of us--bishop, priest, religious, or layperson--who may claim the possession of truth in such a way that dialogue is neither possible nor desired. Every Christmas morn faces' us with this question: How do we find the Word in a manger--today? Like shepherds on the watch or like teachable magi, are we avail-able to an alien messenger's voice for direction or to a light from afar to help guide our way? As we approach the third,.millennium, John Paul has indi-cated that dialogue encouraged by the church is fourfold: the dia-logue of life found in people's sharing as neighbors, the dialogue of actioti collaborating for a world more humfin and more divine, the dialogue of sharing the riches of offr spiritual experience and helping one another find the Absolute, the dialogue of special-ists exchanging theologiFal insights to deepen understanding and appreciation of religious heritages and spiritual values. No one of us can remain aloof today from at least some aspects of this fourfold dialogue. Dialoguemprivileged prisms in our Christian responsibility to be neighbors, ecumenists, and evangelists! All of us who dialogue with you our readers in each issue of this journal pray that you be blessed with many grace-illumined prisms .coloring your Christmas season. David L. Fleming SJ November-December 1996 directions JEFFREY GROS The Dialogue of Conversion: Toward Jubilee 2000 Zeal for the unity of the church is central to Roman Catholic spirituality. As Christians move, toward the cel-ebration of the opening of the third millennium, we have been called to gospel, renewal in all dimensions of church life, especially church unity: "Among the most fervent petitions which the church makes., is that unity among all Christians of the various confessions will increase until they reach full communion.''1 For religious this is a particularly opportune moment for service in the church. Prayer, conversion, and spiri-tual renewal--to which religious have long known them-selves to be consciously called--are essential for understanding and engaging in the church's ecumenical commitment: "Concern for restoring unity pertains to the whole church, faithful and clergy alike. It extendS to every-one, according to the ability of each, whether it be exer-cised in daily Christian living or in. theological and historical studies.''2 This is a special time .for renewal of commitments already made and for deepening the knowledge, dialogue, and prayer that will serve the unity for which Christ prayed. This .essay will suggest how religious communities, especially communities of contemplative and retired per- Jeffrey Gros FSC writes from the National Conference of Catholic Bishops' Secretariat for Ecumenical and Interreligious Affairs; 3211 4th Street, N.E.; Washington, D.C. 20017. Review for Religious sons, can participate in the ecumenical dimension of preparing for and celebrating the bimillenary jubilee of the incarnation (see Pope John Paul's apostolic exhortation dated 25 March 1996, Vita consecrata §44). After the brief introduction, we will discuss~ (1) the jubilee theme and its preparation, (2) a schedule of prayer, (3) a program of spiritual reading, and (4) the ministry of hospitality for dialogue. Of course, the social-justice and evange-lization elements suggested for jubilee preparation also entail ecumenical dimen-sions and possibilities. The reception of the results of ecumenical dialogues is a key element in the new evangelization of which Pope John Paul so frequently speaks. With the publication of Directory for the Application of Principles and Norms on Ecumenism, religious communities have been challenged to set up commissiofis within their institutes and appoint coor-dinators for ecumenical leadership.3 Obviously the tasks of such a commission and coordinator can begin with seeing to the ecumenical component of initial and continuing formation and with applying the directory's suggestions to hospitals, schools, retreat centers, social-service and advocacy, programs, and the many other are~is where religious provide leadership and witness. Vim consecrata further spells out ways that religious can contribute to church unity (§§2, 100, and 101). However, the publication of the apostolic letter Tertio millen-nio adveniente, with its detailed program leading up to the year 2000, gives such commissions an opportunity to design a prayer cycle and educational program that can enable all, especially retired religious, to participatei a.ccording to their station in life. Obviously, diocesan ecumenical officers and local ecumenical agencies can be of great help in such planning and' implementa-tion in the communities. The specificity of the Holy Father's pro-gram lends itself to rich adaptation in local communities. The publication of the encyclical Ut unum sint, with its enthu-siasm and rich spiritual emphasis, provides a significant resource for religious community reflection. As Pope John Paul notes in the The publication of the encyclical Ut unum sint, with its enthusiasm and rich spiritual emphasis, provides a significant resource for religious community reflection. November-December 1996 Gros ¯ The Dialogue of Conversion . encycl!¢.al: "A new task lies before us: that of receiving the results already achieved," which "must involve the whole people of God" (§80). The five years in preparation provide the church an oppor-tunity to pray and reflect over the results offered to the church for reception: "With regard to other Christians, the principal docu-ments of the Commission on Faith and Order [of the World Council of Churches] and the statements of numerous bilateral dialogues have already provided Christian communities with use-ful tools for discerning what is necessary to the ecumenical move-ment and to the conversion it must inspire" (UUS §17). These statements can find their way into the spiritual reading, prayer, and discussion of religious communities during the course, of the years of preparation for the jubilee celebration. The Jubilee Theme In the pope's letter on the jubilee, he emphasizes the social-justice implications of reordering society implicit in the theme selected, Leviticus 25, which recounts the biblical jubilee in which captives and slaves are liberated, land redistributed, and relations among God's people reordered. In addition to unity among Christians, conversion to a' new way of viewing society and widespread study of the church's social teaching are essential ele-ments. The World Council of Churches has already selected this same text, °under the theme "Return to God, Rejoice in Hope," for its fiftieth jubilee, to be celebrated at its 1998 assembly in Africa, In the first section of the pope's letter, he addresses the ques-tion of God's will .for the church, remarking that ~'Jesus Christ is the same yesterday and today," and in the second section he lays out his own philosophy of Christian history, which is based on the theology of the incarnation. Within this theological and his-torical context, he elaborates in the third section his vision of the jubilee preparation and, in the fourth, its specific stages. We will enumerate some of the ecumenical challenges and resources that come into play on the road toward the realization of this hope. We present the stages of preparation. There are five specific stages proposed for the years between the letter's publication and the jubilee. The first phase is remote preparation, 1994-1996. It includes reflection on sinfulness and the need of repentance, iden-tification of the difficulties on both sides of the sinful divisions in the church, preparation of a program of prayer for the Holy Review for Religious Spirit's gift of unity, "the promoting of fitting ecumenical initia-tives," and repentance for acts of violence and intolerance. This will entail careful historical study and reconciliation of memories (UUS §2). For this, members of religious orders and institutes may wish to look into their own histories to discern what role their predecessors may have played in the negative his-tory of relations among churches and religious groups. They can be led by the examples of religious orders (Oblates and Jesuits) during the celebrations of the 500th anniversary of the European discovery of the Americas. Also there will be attempts to deal with the religious indifference, the widespread loss of percep-tions of transcendence, and the crisis of obedience that are the experience of our time. Finally, there will be an attempt to create an ecumenical martyrology of common heroes in the faith who have suffered and whose commitment to the cross of Christ can bring us into deeper unity with one another (UUS §84). Again, religious orders and institutes may figure prominently on these lists, particularly members who gave their lives in the past fifty years in the common struggle against communism and totalitar-ianism. This remote preparation will be followed by three years devoted to specific themes: (1) 1997 will be devoted to Christ, recalling the common baptism in which all Christians share and which is the root of .the real, if yet imperfect, communion .that supports our common pilgrimage toward full unity. (2) 1998 will focus on the Holy Spirit .fostering the many charisms of the peo-ple of God, linking Christians of the northern and southern hemi-spheres, and giving strong impetus toward church unity. This will also be the year of the World Council Assembly. Catholic engage-ment in this jubilee celebration and its preparation can be integral to the program of the churches moving together toward the year 2000, (3) 1999 will be devoted to God the Father, with a focus on penance, the preferential option for the poor, the dialogue of cul-tures, and women's rights. In this year the Holy Father suggests an interreligious focus, especially with our fellow monotheists, Jews and Muslims. Here the leadership of Pope John Paul is well ahead of the church as a whole,.with his pastoral visits, his gath-erings of religious leaders in Rome and Assisi, and his Vatican documents and addresses on dialogue.4 Finally, the jubilee itself is to be planned "and carefully pre-pared in an attitude of fraternal cooperation with Christians of November-December 1996 Gros ¯ The Dialogue of Conversion other denominations and traditions, as well as of grateful openness to those religions whose representatives might wish to acknowl-edge the joy shared by all the disciples of Christ" (TMA §55). Certainly such an ambitious project ~will take skill in dialogue and outreach at ever} level of Catholic life, building on the thirty years of developing bonds of trust and affection among the churches. Religious have a significant contribution to make on this spiritual journey. ~, Prayer Cycle in therJubilee Preparation ¯ Some will participate actively in the planning and designing of the jubilee events and the engagement of the Catholic and ecu-menical communities in the dialogues, prayer opportunities, and 'study that will contribute to reconciliation. However, all religious can participate in prayer, which is at the very center of ecumeni-cal activity. In this section we will suggest particular themes according to the years leading up to the jubilee and, in the next, themes for spiritual reading which can enhance the prayer. A province or community can ask some of its members to work with some ecumenical partners to develop a set of petitions for prayer ,during the course of each year, and possibly to draw on the prayer resources of the partners.'If it is feasible, a religious com-munity can invite a leader from another church, or even a number of members of the congregation, for common prayer and reflection. Such prayer arrangemen.ts can be more or less detailed, depending on the prayer styles and flexibility of different communities,s During the time focused on early preparation and repentance, the encyclical Ut unum sint and the apostolic letter Tertio millen-nio adveniente can be reviewed to develop prayer intentions, read-ings, and themes. The themes of charity and conversion,the common martyrology, and the healing of memories all provide material for prayer of .thanksgiving, repentance, and petition to dispose the community .for the journey toward the jubilee cele-bration andthe fostering of closer Christian relationships, Specific prayers and readings on the communion (koinonia) among the churches and the goal of full communion can be drawn from World Council resources.6 General agreements on such themes as Scripture and Tradition, Eucharist and Ministry, Authority and Teaching, and Mary can provide a prayerful preparation for more specific intentions as the jubilee draws closer. Review for Religious The year 1996, because it calls specifically for the Roman Catholic Church to recall its own failures and to repent its own complicity in the divisions among Christians, might well focus on the African American churches and the peace churches (the Brethren, Hutterites, Mennonites, and Quakers). Slavery and the continuing racism and violence in American society make it par-ticularly appropriate to pray.with and for these two groups of churches in repentance, confession, reconcilia-tion, and thanksgiving.7 The historic peace churches have been persecuted by members of almost all the churches, including Roman Catholics, because of their refusal to compromise with state-sponsored and church-legitimated violence. We should not only pray for and with these Christians, but also let our prayers and actions for peace benefit from their spirituality and the discipline of their nonviolent lifestyle. Because these churches are small, it may not be easy to find members in each community, but their spiritual literature is rich and widely available. Christ, our common baptism, and the grace we share with other Christians will be emphasized in 1997. During this year, the 450th anniversary of the Council of Trent's, Decrees on Justification, it is hoped that Roman Catholics and Lutherans can proclaim, in a binding joint declaration, a common understand-ing of Christ's justifying grace received in faith by Christians. If such an agreement on grace, sin, merit, and faith were to be suc-cessful, it would be a great contribution to our common spiritual life and a basis for effective movement beyond the 16th centur)i's condemnations. Prayer for and with the Lutheran churches, for the success of such an agreement and for the influence it could have on the life of church members, and quiet meditation on the meaning of God's love in Jesus Christ, as proclaimed especially in Paul's Letter to the Romans, can make this a year that sees our commitment to Christ renewed and our full .communion with the Lutheran churches realized. The Evangelical Lutheran Church in America will also be considering proposals for full communion with Episcopalians and with three Reformed or Calvinist churches: Presbyterian, United Christ, our common baptism, and the grace we share with other Christians will be emphasized in 1997. November-December 1996 Gros * The Dialogue of Conversion Church of Christ, and Reformed Church in America. These hopes and proposals for reconciliation will suggest opportunities for prayer and reflection too. Wherever Christ's will for the unity of the church is being realized, spiritually sensitive Catholics will be prayerfully attentive. During this year we can als0 include in our prayers the Eastern and Oriental Orthodox Churches and the Assyrian Church of the East. These three traditions all share with us the sacraments and bishops in the apostolic succession; a common Trinitarian and Christological faith, some elements of which have been clarified only recently in ecumenical dialogue; and a common understanding of the catholic demands of full communion in a visible, sacramental church. Existing tensions, however, especially in Eastern Europe .but also occasionally in the Middle East, Africa, and Asia, call for sensitivity, repentance, and reconciliation. Prayer for particular Orthodox and Catholic churches around the world, for their peace and reconciliation, is an important contribution to Christ's will for unity. The rich liturgical traditions of the Christian East can provide resources for community prayer and celebration for and with these churches. During 1997 we can also focus prayer on our relationship with Episcopalians and Anglicans worldwide. We share many spir-itual gifts. The dialogue has moved forward with unexpected pos-itive results, so much so that in 1994 the Holy See could say that "no further work" was necessary at this time on the theology of Eucharist and ministry, indicating that the agreements produced to date and the subsequent clarifications show a common faith as regards these two areas of our life. Obviously, the question of women's ordination and under-standings of authority and papal primacy are still under discussion. The Archbishop of Canterbury indicated, on behalf of the Anglican communion, a willingness to accept Pope John Paul's 1995 invitation to talk about how the papacy can be renewed to better serve the unity of the church. Regarding all the progress made to date, there is much for which to be grateful; for the broad common heritage of spirituality, there is much to celebrate; and, in anticipation of future steps toward full communion, there is much for which we must pray. The Episcopal Book of Common Prayer provides many resources for prayer in our religious com-munities as we yearn for the day when full Eucharistic communion can be celebrated together. Review for Religious The year 1998 will be characterized by the celebration of the Assembly of the World Council of Churches. This is an oppor-tunity to make use of the Bible-study and prayer materials that will be produced for the occasion.8 This will also be a year dedicated to the Holy Spirit, to the role of the laity, and to enhanced rela-tions between peoples in the northern and southern hemispheres. It will be a year to raise up special prayers for the Roman Synod for the Americas and its contributions to Christian reconciliation and a year for leadership by laypersons in ecu-menism. There are local ecumenical confer-ences and agencies that can provide partners in getting prayer materials ready to help com-munities focus on the churches' common wit-ness in their immediate areas. In particular, with the year dedicated to the Holy Spirit, religious communities may wish to pray with and for various Protestant churches with which the Catholic Church is committed to full communion. United Methodists, Presbyterians, the United Church of 'Christ, Disciples of Christ, and the Reformed Church in America all participate in dialogues with the Roman Catholic Church with the hope of full communion. Most of these churches have participated with the Catholic Church in the liturgical move-ment and have common prayers and liturgical texts that can form the basis for prayer services. Their local representatives and mem-bers of religious communifies could profitably share with one another their common or different experiences and perceptions of their church life. Our relationships with some other churches look, at this time, more toward mutual understanding than toward full sacramental communion. The year 1998 should provide opportunities for prayer for and with Baptists, Pentecostals, and other independent Evangelical churches. More often than with them, we may find ourselves prayingJbr them and for their conversion to an open communication and dialogue with the Roman Catholic and other Christian churches. However, some of these Christians may be willing to pray with us even if there are few other areas of col-laboration to which they would be open. Pope John Paul suggests that 1999 be dedicated to the Father The year 1998 will be characterized by the celebration of the Assembly of the World Council of Churches. November-December 1996 Gros ¯ The Dialogue of Conversion and to interreligious dialogue. We can pray particularly for Jews and Muslims and engage in common prayer when this is possible. While there are some fine resources available for Christian and Jewish prayer, little has been produced for local use in interfaith worship.? Care should be taken to produce any materials jointly with those with whom prayer is planned. The diocesan ecumeni-cal officer can assist. As with Christian groups, this can be a time of reflecting on the sad heritage of past relationships (here, for example, the cru-sades, the inquisition, the holocaust) as we move through repen-tance to reconciliation and solidarity. This is a time when one can raise i~rayers to God for other families of faith and draw on some of their traditions, like Hindu yoga and Buddhist meditation, to enrich our own Christian prayer life. Also during this year, prayerful reflection on the poor, on the roles of women, and on the maternal aspects of God can nourish the spirituality and prayer life of communities and individual religious. Finally, the year 2000 is devoted to the anniversary of the incarnation, with the Holy Father hoping for a major ecumenical gathering in Jerusalem, an interfaith gathering (possibly at Mr. Sinai), and planning a Roman Catholic Eucharistic gathering in Rome. During this year, thought and prayer can look towards the harvest time, when the years of ecumenical dialogue and prayer yield their fruit: a thoroughgoing ecumenical council of Orthodox, Anglican, Roman Catholic, and Protestant Christians celebrat-ing full communion. The fruit of much prayer and study can show itself in local prayer meetings and events of celebration. On the first Sunday of Advent there will be a celebration of reconciliation in the United States for several Protestant. churches that will come together, after forty years of dialogue, to become the Church of Christ Uniting (COCU). Prayers for and with these churches for the Holy Spirit's blessing on this venture will be impor~tant for all Christians. During this period before the event, the Episcopal, Presbyterian, United Methodist, African Methodist Episcopal, Christian Methodist Episcopal, and the African Methodist Episcopal Zion churches and the United Church of Christ, the Disciples of Christ, and the International Council of Community Churches will be deciding whether they are ready for this step toward full communion. Catholics can join with these Christians in prayer as they walk the path towarO unity. Catholics can be with them in longing for Review for Relig4ous the day when more Christian churches join in similar celebra-tions of full communion. Spiritual Reading in Preparat~ion for the Jubilee As a time of prayer before the great celebration of the incar-nation, these five years can include reflection informed by read-ing that serves the same goal of deepened conversion to Christ's will for the unity of the' church. The practical suggestions here will touch three levels of reading: church documents, ecumenical doc- ¯ uments, and more general spiritual-reading resources. Partners from other churches and communities, if they are familiar with their own spiritual traditions, can provide appropriate sugges-tions to meet particular spiritual needs. While there are many church documents that can provide understanding and stimulus for our prayer life, only four recent texts will be suggested here. The most useful may be the encycli-cal Ut unum sint because of its spiritual core and the enthusiasm with which it is written. Like all of the encyclicals of Pope John Paul, it includes much that is.familiar to those following the ecu-menical movement over the'last thirty years. However, if a para-graph or two are taken for meditative reading each day, with reflection on how the pope's comments relate to one's own expe-rience~ and how one is challenged by the values he lays out, this text can be of significant help. The Holy Father's emphasis on renewal of the individual and the church, on the centrality of prayer and dialogue to nourish prayer, on the dialogues of con-version and charity, on the centrality of love and truth, on the reception and celebration of gifts from others, and on openness to repentance and change, all provide profound opportunities for conversation with God about his will for us and for the church. The apostolic letter Tertio millennio adveniente is of a different character. Its first two sections, on theology and history, are rather dense. Careful reading, however, and even exploring of events and ideas laid out here and in the rest of the letter will be a help-ful orientation as one begins these five carefully programmed years of reflection and prayer. Some of the anniversaries recalled in the second section of the letter will lead us to want to read about certain segments of the Christian community, about certain saints and Christian leaders, and about the development of the church in different cultures. OUr prayer life can be nourished by November-December 1996 Gros * The Dialogue o~ Conversion biography and Christian history as we carry our heritage toward the future. Some may find the other two documents less spiritually nour-ishing since they have a more specific purpose. For those, however, who would choose to reflect on them prayerfully, they have a sig-nificant contribution to make. The Directory for the Application of Principles and Norms on Ecumenism is a more formal document, with theological and juridical content. For those who are involved in leadership or who wish to reflect on the position of the Catholic Church, this text is foundational. The sections on Ecumenical Formation and on Communion in Life and Spiritual Activity pro-~ vide important bases for reflecting on one's community's and one's own spiritual formation and on ministry in the light of what God is doing in the church. The apostolic letter on the churches of the East, Orientale lumen, will help, during the year 1997, in ini-tiating reflection on Christological understandings that have emerged in dialogues and on the spiritual riches of this half of the tradition catholic?° Much of what one finds in this text is also outlined in Ut unum sint. From our dialogues with other churches, we are fortunate to have very rich results to nourish our spiritual reading and our spiritual lives. Though some of these are technical texts, all of them are oriented toward bringing us closer to Christ and his mysteries and to one another in the church God has willed for us. The reconciliation which they are meant to serve is as deeply spiritual as it is theological and institutional. Therefore, it is use-ful for every religious house and spiritual renewal center to have a library where these ecumenical results are available for reading and reflection.11 These documents should facilitate for us a pro-cess of spiritual .reconciliation by giving us a deeper appreciation of the gifts of the other Christian churches and help us make the unity to which they witness a part of our own spiritual life. For each year coming up, there are significant resources for our reading and reflection. In 1996, getting to know the African American and peace churches can enrich our own faith and com-mitment to justice and peace in our spiritual lives.12 In 1997, deci-sions will be before the Catholic and Lutheran churches concerning the doctrine of grace, a focus on Christ's saving love that can renew all Christians.~3 This theme of justification by faith has produced some important spiritual-reading volumes in English.14 The Anglican-Roman Catholic dialogue has already Review for Religious produced some marvelous results that enrich our sacramental understanding.~5 We are fortunate to have the texts of the Orthodox, both Eastern and Oriental, available.~6 For special attention in 1998, various documents already recommended and the specific preparatory materials for that year's World Council Assembly provide ample resources. In this year many could well reflect on the history and future of the churches together in the World Council.17 An extensive set of materials on Christian-Jewish and interreligious dialogue has been developed for reading and reflection; it can be especially useful during 199928 For more general spiritual reading, there is a variety of resources available. For 1996, books on conversion, ecumenical journeys, rec-onciliation, and ecumenical spirituality are widely available29 The African American and peace church traditions provide rich prayer and meditation resources for 1997.20 Spiritual biographies are a way of understanding the spiritual journeys of early and later Orthodox, Anglican, and Protestant Christians. Lives of Luther and resources from Orthodox and Anglican spiritual writ-ers can enrich one's sensitivity and appreciation for these tradi-tions. 2 ~ In 1998 (and earlier too) a wide variety of Bible-study resources will be available from the. World Council of Churches. That would be a year to reflect on the spiritualities of John Calvin, John Wesley, and Roger Williams and on the Christian commu-nities of which they were leaders.22 As a result of Thomas Merton's influence and the East/West monastic dialogue, religious are per-haps more acquainted with some interreligious resources than they are with such ecumenical onesfl3 In any case, 1999 provides an opportunity to deepen and broaden our reading in various living spiritual traditions of world religions.24 Approaches to other believers can, moreover, enrich our understanding of and rela-tionship to fellow Christians of other churches.~5 Finally, the jubilee year itself can be a time of reflection on the hopes of the whole Christian community for an ecumenical coun-cil that will truly unite Orthodox, Catholic, Anglican, and Protestant churches.26 Our prayer life can be nourished by biography and Christian history as we carry our heritage toward the future. Noventber-Decentber 1996 Gros * The Dialogue of Conversion The Ministry of Hospitality Institutional and theological efforts have their contribution to make toward visible unity. More importan( are the spiritual resources that foster zeal for God's will for the church. But the relational dimension of ecumenical spirituality can be realized only by people's concrete experience of the "dialogue of conver-sion" of which Pope John Paul speaks so eloquently in Ut unum sint. These five years provide an opportunity for any.community, no matter how mobile or sedate, to invite fellow Christians of other churches in for prayer, a meal, and possibly a discussion, depending, on people's time and interest (see VC §101). If more care can be given to such an invitation, communities can share some common reading before, the visit and can invite a Christian leader, her or his spouse, and even some members of their church. The ecumenical officers of the diocese can be of particular assis-tance in making these contacts and advising on appropriate ser-vices and programs. Pope John Paul outlines the basis for this dimension of the ecumenical spirituality: , If prayer is the "soul" of ecumenical renewal and of the yearning for unity, it is the basis and support for everything the council defines as dialogue. This definition is certainly not unrelated to today's personalist way of thinking. The capacity for dialogue is rooted in the nature of the person and his dignity. As seen by philosophy, this approach is linked to the Christian truth concerning man as expressed by the council: Man is in fact "th~ only creature on earth which God willed for itself"; thus he cannot "fully find him-self except through a sincere gift of himself." Dialogue is an indispensable step along the path toward human self-real-ization, the self-realization both of each individual and of every human community. Although the concept of dialogue might appear to give priority to the cognitive dimension, all dialogue implies a global, existential dimension. It involves the human subject in his or her entirety; a dialogue between communities involves in a particular way the subjectivity of each. (UUS §28) Religious, with their experience of community and renewal, of dialogue and governance since Vatican II, are in a particularly advantageous position to model and expand this dimension of ecumenical spirituality in preparation for the jubilee. As we Christians move toward the third millennium with hopes of full communion growing ever stronger, we support our Review for Religious prayer with the disciplines of spiritual reading, meditation, com-mon worship, and dialogue. In Vita consecrata the Holy Father calls upon religious to notice their excellent opportunity to con-tribute to the experience of koinonia, which lies at the basis of hopes for full communion among the churches: "A great task also belongs to the consecrated life in the light of the teaching about the church as communion . Consecrated persons are asked to be true experts of communion and to practice the spirituality of communion as 'w.itnesses and architects of the plan for unity which is the crowning point of human history in God's design.' The sense of ecclesial communion, developing into a spirituality of communion, promotes a way of thinking, speaking, and act-ing which enables the church to grow in depth and extension" (VC §46). The first thirty ~,ears of Roman Catholic ecumenical involve-ment have been characterized by getting to know our ecumenical partners and understanding their churches, theology, and spiri-tualities. The theological dialogues have been most productive. In 1997 we are beginning.a third phase of the dialogue,27 This spir-itual journey from dialogue to decision is a spiritual resource that needs to be available to all Catholics. As our relationship with the Lord deepens in preparation for the celebration of his incar-nation, so "in the deep personal dialogue which each of us must carry on with the Lord in' prayer, concern for unity cannot be absent. Only in this way, in fact, will the concern fully become part of the reality of our life and of the commitments we have taken on in the church" (UUS §27). Notes ' John Paul II, Tertio millennio adveniente ("As the Third Millennium Draws Near"), Origins 24, no:' 24 (24 November 1994): §16 (hereafter Ta4A). 2 John Paul II, Ut unum sint ("That All May Be One"), Origins 25, no. 4(8 June 1995): §19 (hereafter UUS). 3 Directory for the Application of Principles and Norms on Ecumenism, Origins 23, no. 9 (29 July 1993): §§50-51. 4 Red}mptoris missio, Origins 20, no. 34 (31 January 1991): §29. s One might suggest a prayer for each year. For example, the Magnificat for 1996 (repentance), the Te Deum for 1997 (Christ), the Veni Sancte Spiritus for 1998 (Holy Spirit), and the Nicene Creed for 1999 (God the Father). November-December 1996 Gro~ ¯ The Dialogue of Conversion 6 Thomas Best and Gtinther Gassmann, eds., On the Way to Fuller Koinonia (Geneva: World Council of Churches, 1993). Gtinther Gassmann, ed., Documentary History of Faith and Order: 1963-1993 (Geneva: World Council of Churches, 1993). 7 The Office of African-American Catholics provides a kit, Love One Another, including prayer materials that can be used for such services (U.S. Catholic Conference Publishing Services; 3211 4th Street, N.E.; Washington, D.C. 20017). Other prayer materials, designed by the African Methodist Episcopal, Christian Methodist Episcopal, and African Methodist Episcopal Zion Churches. Liberation and Unity, for ecumeni-cal Lenten use, is available from Consultation on Church Union; Research Park; 151 Wall Street; Princeton, New Jersey 08540. ~ Available from: World Council of Churches U.S. Office; 475 Riverside Drive;New York, New York 10115; tel. 202-870-2470. 9 H. Schlesinger and H. Porto, Prayers of Blessing and Praise for All Occasions (Mystic, Connecticut: Twenty-Third publications, 1987). Leon Klenicki and Bruce Robbins, Jewish and Christians: A Dialogue Service about Prayer (Chicago: Liturgy Training Publications, 1995). ~o Orientale lumen, Origins 25, no. 1 (18 May 1995). 11 Lukas Vischer and Harding Meyer, eds., Growth in Agreement Reports and Agreed Statements of Ecumenical Conversations on a World Level (New York: Paulist Press, 1984). Jeffrey Gros and Joseph Burgess, eds., Building Unity (New York: Paulist Press, 1989) and Growing Consensus (New York: Paulist Press, 1995). Also the volumes noted in n. 5 above. 12 William Watley, Singing the Lord's Song in a Strange Land (Geneva: World Council of Churches, 1992). Marlin Miller and Barbara Nelson Gingrich, eds., The Church's Peace Witness (Grand Rapids: William B. Eerdmans, 1994). 13 H. George Anderson, T. Austin Murphy, and Joseph A. Burgess, eds., Justification by Faith (Minneapolis: Augsburg, 1985). Karl Lehmann and Wolfhart Pannenberg, eds., The Condemnations of the Reformation Era: Do They Still Divide? (Minneapolis: Fortress Press, 1990). 14 Jared Wicks SJ, Yearning for Grace: Luther's Early Spiritual Teaching (Philadelphia: Coronet Books, 1969) and Luther and His Spiritual Legacy (Wilmingtom Michael Glazier, 1983). George H. Tavard, Justification: An Ecumenical Study (New York: Paulist Press, 1983). is William Purdy, The Search for Unity (London: Geoffrey Chapman, 1995). Christopher Hill and Edward Yarnold, eds., Anglicans and Roman Catholics: The Search for Unity: The ARCIC Documents and their Reception, (London: SPCK/CTS, 1994). 16 John Borelli and John Erickson, Orthodox and Catholic in Dialogue (Crestwood, New York: St. Vladimir Seminary Press/Washington, D.C.: U.S. Catholic Conference, 1995). Ronald G. Roberson, ed., Oriental Orthodox-Roman Catholic Pastoral Relationships and Interchurch Marriages (Washington, D.C.: U.S. Catholic Conference, 1995). Paul Fries and Tiran Nersoyan, Christ in East and VVest (Macon: M. ercer University Press, I ~87). Review for Religious ~7 W.A, Visser't Hooft, The Genesis and Formation of the World Council of Churches (Geneva: World Council of Churches, 1982). 18 "Dialogue and Proclamation," Origins 21, no. 8 (4 July 1991), "Interreligious Dialogue," Living Light 32, no. 2 (Winter 1995), Eugene Fisher and Leon Klenicki, eds., In Our Time: The Flowering of Jewish- Catholic Dialogue (New York: Paulist Press, 1989). 19 For the Conversion of the Churches, by Groupe des Dombes (Geneva, Switzerland: World Council of Churches, 1993). Dianne Kessler, Lorelei Fuchs, and Gillian Evans, Encounters.for Unity (Norwich: Canterbury Press, 1994). Michael Hurley, ed., Reconciliation in Religion and Society (Belfast: Institute of Irish Studies, 1994), and Timothy J. Wengert and Charles W. Brockwell Jr., eds., Telling the Churches' Stories: Ecumenical Perspectives on Writing Christian History (Grand Rapids: William B. Eerdmans, 1995). Louis Dupr~ and Don Saliers, eds., Christian Spirituality: Post-Reformation andModern (New York: Crossroad, 1989), and E. Glenn Hinson, ed., Spirituality in Ecumenical Perspective (Louisville: Westminster/John Knox Press, 1993). 20 James Washington, Conversation with God: Two Centuries of Prayers by African Americans (New York: HarperCollins, 1994). Daniel Liechty, ed., Early Anabaptist Spirituality (New York: Paulist Press, 1994). 21 Bengt Hoffman, ed., The Theologica Germanica of Martin Luther (New York: Paulist Press, 1980), and Roland Bainton, Here I Stand (Nashville: Abingdon Press, 1991). William Wolf, Anglican Spirituality (Wilton, Connecticut: Morehouse Publications, 1982). Kallistos Ware, The Orthodox Way (London: Mowbrays, 1979) and The Art of Prayer: An Orthodox Anthology (London: Faber and Faber, 1966); Georges Barrois, ed., The Fathers Speak (Crestwood, New York: St. Vladimir's Seminary Press, 1986). 22 J.L. Richard, The Spirituality of John Calvin (Atlanta: John Knox Press, 1974). Alexander Ganoczy, The Young Calvin (Louisville: Westminster/John Knox, 1987). Richard P. Heitzenrater, Wesley and the People Called Methodists (Nashville: Abingdon Press, 1995). Frank Whaling, ed., John and Charles Wesley (New York: Paulist Press, 1981). Edwin Gaustad, Liberty of Conscience: Roger Williams in America (Grand Rapids: William B. Eerdmans, 1991). 23 Thomas Ryan, Prayer of Hear.t and Body (New York: Paulist Press, 1995). 24 Aloysius Pieris SJ, Love Meets Wisdom (Maryknoll: Orbis Books, 1988). William Johnston sJ, The Still Point (New York: Fordham University Press, 1980). Patrick G. Henry and Donald K. Swearer, For the Sake of the World: The Spirit of Buddhist and Christian Monasticism (Minneapolis: Fortress, 1989). Anthony de Mello SJ, Sadhana: A Way to God (St. Louis: Institute of Jesuit Sources, 1979). M. Thomas Thangaraj, The Crucified Guru (Nashville: Abingdon, 1994). Achiel Peelman, Christ Is a Native American (Maryknoll: Orbis Books, 1995). Leon Klenicki and Gabe Huck, eds., Spirituality and Prayer: Jewish and Christian Understandings(New York: Paulist Press, 1983). Bernard Lee, The Galilean November-December 1996 Crros ¯ The Dialogue of Conversion Jewishness ofyesus (New York: Paulist Press, 1988). The Paulist Press's Classics of Western Spirituality series includes many Muslim and Jewish titles. zs Institute for Ecumenical and Cultural. Research, Confessing Christian Faith in a Pluralistic Society, (Collegeville, 1995). 26J.M.R. Tillard, A Church of Churches (Collegeville: Liturgical Press, 1991). Aram Keshishian, Conciliar Fellowship(Geneva: World Council of Churches, 1992). John Zizioulas, Being as Communion; Studies in Personhood and the Church, (Crestwood, New York: St. Vladimir's Seminary Press, 1985). Lewis Mudge and Paul Crow, eds., "Toward the Year 2000: An Ecumenical Celebration," Midstream 24~ no. 4 (October 1987). 27 John Hotchkin, "The Ecumenical Movement's Third Stage," Origins 25, no. 21 (9 November 1995): 353-361. I Am the Bread I am the Bread baked of the Father's fine flour, molded in Mary by Spirit's pure power. I am the Bread Bethlehem born, kneaded and nailed, scorching with scorn, rising from death and the dead. I am the Bread. Come, eat me, hold me, share me, held by death, never. Living forevert. We are the bread. Jean Miriam Donachie SC Review for Religious ERIK KARL RIECHERS A Way of Being Church: Journey, Serve, and Evangelize Together I~rhere is any one way of describing the quandary of modern atholic life, I would suggest this: that we are groping for a way of being church. Small Christian communities, lay-associate programs, lay-formation programs, justice movements, secular institutes, and a host of other ecclesial forms all seek practical, concrete ways of living the reality of church. It is to ecclesiology that people generally go for a deep under-standing of the nature and purpose of the church. Yet a second, com-plementary avenue is open to us, namely, seeking in our.own praxis of church life specific principles that other ecclesial groups could apply to themselves. It is a good thing to celebrate our own local church history and Spirit-filled growth, but it is regrettable that oth-ers derive litde profit from it when we neglect to share it with them. Here I intend to share the exl~erience of the Union of Catholic Apostolate (UAC). While its experience is not automatically adapt-able to the church at large or even to every institute of consecrated life, the UAC has learned some essentials that could easily serve the entire people of God, helping it on its way of being church. One Way of Being Church: The Union of Catholic Apostolate When people first hear about the UAC, they almost Erik Karl Riechers SAC last wrote for us in March-April 1995. His address is Pallottine Faith Enrichment Centre; 6 McMillan Avenue; Red Deer, Alberta; T4N 5X8 Canada. November-December 1996 Riecbers ¯ A Way of Being Church always assume that they are being introduced to yet another form of third-order spirituality, that of the Pallottine Fathers and Brothers. Yet nothing could be further from the truth. The UAC is a radical and very challenging break from the model of spiri-tuality that led to the third orders. In the 1980s the conservative theory of "trickle-down" eco-nomics became popular. The concept was simple. If great wealth and prosperity could be produced at the top levels of society and the state, then benefits and positive effects would trickle down to lower levels. The idea of third orders might well be described as "trickle-down" spirituality. The concept was that an order would have a rich and vibrant spirituality and that, after a time, this spiritual wealth would be shared by other religious with a similar interest or direction. These would be the second orders. Finally, lay people would want to share in the founding spirituality, and some of it would trickle down to them, allowing them to par-ticipate in some derivative fashion, but never fully and certainly not in the same sense as the first order. There is nothing fundamentally wrong with this model, and it is not my intention to belittle or ridicule it. However, for the Pallottine family it leaves a great deal to be desired, for it fails to recognize the element that is always at the heart of our UAC spir-ituality: that all Christian men, women, and children are called by name to an apostolic life. This vocation, this life, does not trickle down from the Pallottine Fathers and Brothers, nor is it but a shadow of someone else's spirituality. The calling of Christians is directly from God, not delei~ated to them by the hierarchy. Their spirituality, therefore, must be as unique as their vocation, and not just an offshoot of the spirituality of another person or group. The UAC is a concrete expression of Vatican Council II's teaching on the universal call to holiness that insists that "all the faithful are invited and obliged to holiness and the perfection of their own state of life" (Lumen gentium §42). Imagine a great shimmering pool. For this pool's water a num-ber of tribes have various needs. Yet each of them goes to the common pool in order to satisfy those needs. The tribes procure the water and carry it home in distinctive containers, yet each has taken life-giving water from the same source. Some will use the water to cook, others to drink, others to wash the grime from their bodies, while yet others intend to douse the plant~ that will grow to still their hunger. Review for Religious The image reveals to us the way in which the UAC approaches Pallottine spirituality. The pool is Pallottine spirituality, and its contents are the ideals, intuitions, and insights of Vincent Pallotti. Every group of the UAC is distinctive and has a unique need for what is within the common pool of Pallottine spirituality. The Pallottine Fathers and Brothers go to that pool and realize its spiritu-ality in their own unique way. The Pallottine Sisters draw from the pool and use what they have drawn from its depths in their own par-titular fashion. Every group, lay or religious, goes to the same life-giv-ing source, goes to Pallotti, and comes away with its own manner of letting that life flow through them. We know ourselves to be one, for our thirst has led u~ to the same pool, and we acknowledge that we are all nourished from a common source. Yet we know ourselves to be unique, for that invigorating fountain of spirituality is cre-atively used to nourish many forms and variations of life in the Spirit. When we look across the world at all the expressions of the UAC, we see a web of communities, a grand alliance of spiritual-ity, and a confederation of Christians. Despite our wide diversity and exceedingly different experiences of life, we support one another as communities and individuals and share those experi-ences. This has been our ultimate strength, the power that is born of a genuine solidarity. For when we gaze upon the countenance of our Pallottine brothers and sisters, we recognize first and fore-most the people who stand beside us at the pool of Pallottine spirituality, who share our thirst, and who share our way of slak-ing it. In that gaze lies the certain knowledge that we are not alone in life. In our family no one receives a scrap from the mas-ter's table, because we all have an equal seat at that table. Despite our wide diversity and exceedingly different experiences of life, we support one another as communities and individuals and share those experiences. A Way of Forming Church I am often asked: What does the UAC offer people? I believe November-December 1996 Riechers * A Way of Being Church " that there are a number of interwoven answers to that question, each of them a principle applicable--though in varied ways--to the experience of being church. The need for spiritual growtb.~Many people today have a grow-ing awareness that their spiritual lives need more than a bare min-imum, that these lives of theirs have failed to grow beyond the confines of the catechism classes of their formative years. They come to the realization that children's catechesis does not suffice in a world of adult problems, and they begin to experience the need for development toward a responsible adult faith. Yet often they then face a second problem, namely, that they can get many bits and pieces in workshops, seminars, and adult-education classes, but that there are few places where they can get a comprehensive formation in Catholic, spiritual living. The UAC is a place where we begin to solve this problem through four movements. In the UAC we assist one another in coming to an adult faith in an adult church. Our manual of formation, titled Called by Name, offers a systematic approach to spiritual growth. Here we move the believer from the sporadic to the systematic. Called by Name takes a thorough look at eight great facets of spirituality: (1) God's infinite love and mercy and its effect in our lives, (2) the presence and work of God in human time and history, where we might experience this God, (3) the sheer power of the word of God, (4) communion as the antidote to loneliness and polarization, (5) the unrelenting call to embark on the mission with Christ, (6) the covenant according to which God creates, a homeland for Christians, (7) community that gathers under God's grace, and (8) hope and unity that,sustains and drives the Christian life. Each of these themes is tackled from three different angles. First, from the point of view of Catholic spirituality, we link our-selves with the Great Tradition and the wealth that Scripture, Vatican Council II, and Christian experience have to offer us. Here we move the believer's faith from adolescence to adulthood. Second, from the point of view of Pallottine spirituality, the members of the UAC experience the wonderful depth and richness of Vincent Pallotti's approach to God and the faith. Here we move the believer's spirituality from the common to the concrete. In this part of our formation, we make a transition from the common spirituality of all the people of God to a specifis form of realizing this spirituality in our concrete lives, the specific form of Pallottine spirituality. Review for Religious Finally, we learn together how we can integrate what we have learned into a life of prayer as members of the UAC. Employing the rich resources of the Tradition and the Pallottine heritage, we explore many forms of prayer in order that individuals may find a prayer method suited to their temperament and need and that all together we may discover the splendid variety of oppor-tunities to raise our minds and hearts to the living God. In this final part of a chapter's formation, we move the believer from prin-ciple to prayer. Hand in hand with this desire to grow in faith beyond the bare-bones basics is the need to sustain Christian life and aposto-late. In order to be church we must keep the flame of faith alive in our hearts, to "confirm our call and election" (2 P 1:10). This, however, has become an increasingly daunting task in today's society. Many people who are committed to liv-ing out their Christian commitment in the world suddenly find themselves facing unre-lenting pressures from their colleagues, friends, and acquaintances to conform to social norms that con-tradict their faith commitment. When they choose to go to Mass rather than the picnic, to be people of generosity rather than gos-sips, and to offer compassion in the place, of criticism, they often discover that the reward is outright ridicule for living in such a way as to be a "sign of contradiction." Unfortunately, no one wants to be contradicted. When Christian life is lived with pas-sion and zeal, it says to the people who live what is an otherwise unchallenged lifestyle that we would beg to differ. Yet, while this is a hard reality to live through, it is not the crux of our problem. It is hard enough to keep the flame of faith alive in our hearts without the added burden of trying to do this as a solo per.formance. People are looking for support in their lives, in their struggles. It is easy enough to fall away from the Way of Christ, but hard to resist the many temptations and avoid the pitfalls constantly presented to us on that way. Therefore, many people are experiencing the need to find a place where the spiritual life they have formed can be sustained and strengthened. The UAC is a place where people can find a spiritual homeland for Hand in hand with this desire to grow in faith beyond the bare-bones basics is the need to sustain Christian life and apostolate. November-December 1996 Riecbers ¯ A Way of Being Church themselves. It offers the chance to speak of our faith, the daily struggles that affect it, and the many experiences and encoun-ters at work, rest, or play that challenge it. The UAC is the place where committed Christians share the many ways in which their faith can be lived as parents, professionals, business people, and citizens of the nation. It is the place where we heed the admo-nition of the Letter to the Hebrews: "Keep encouraging one another so that none of you is hardened by the lure of sin" (Heb 3:13). In the UAC we offer one another courage by teaching one another the joys of fidelity, giving one another a hand when we stumble along, speaking of our hope in moments of despair, and walking the way together, even when the path leads through dark-ness. Then, and only then, do we consider our Christian call to be fulfilled. Encouragement is the UAC's way of keeping the hearts of our brothers and sisters from being hardened.~It is all too easy to point out the lure of sin, to make people aware of the dangers lurking on every side that threaten to devour them whole if they are unwary. In the UAC we choose the harder Way of encourag-ing one another, resisting easier ways. This way is much harder because it demands that we get involved. The members of the UAC are committed not just to spreading faith, but also to keep-ing it alive in one another, and that means being committed to one another. It is the way of our Pallottine spirituality not just to point .to solutions, but to be part of the solution, part of the heal-ing. When we are lost, it is a pleasant thing to find someone who can give us directions. It is, however, without doubt a better thing when that person offers to guide us directly. Together to Evangelize A guiding motto of the UAC has been "Together to Evangelize." Over the course of the last years, three components have helped our reflection on our role within the New Evangelization: the scripture passage of the road to Emmaus, the person and charism of Vincent Pallotti, and the call to mission. So that we may be guided yet again to the place ~of renewal for .all the Pallottine family, I take a word from Reinhold Niebuhr as a lantern to light our path. With piercing insight this great Protestant theologian wrote: Review for Religious Nothing that is worth doing can be achieved in our life-time; therefore, we must be saved by hope. Nothing which is true or beautiful or good makes complete sense in any immediate context of history; therefore, we must be saved by faith. Nothing we do, no matter how virtuous, can be accomplished alone; therefore, we must be saved by love. Let us bring this word to Emmaus experience, to Pallottine perceptivity, and to people who are together for evangelization. "Nothing that is worth doing can be achieved in our lifetime; there-fore, we must be saved by hope. "Two despairing disciples walk away from a life once brimming over with aspirations, hopes, and dreams. To follow Christ--ah, here was the achievement of a life-time, an endeavor worthy of discipleship, an undertaking for which you could put your life on the line and leave your "fishing nets lying on the shore." In .Christ they thought they had found the One worth investing their entire lives in. Their words speak of their hearts' discontent: "But we had hoped that he was the one to redeem Israel" (Lk 24:21). And why not? After all, this man's words gave wings to the hopeless spirit, set sinners' hearts a-soaring, and suffused beaten men and women with vibrant new life. Here was a prophet "mighty in word and deeds," whose power calmed waves and curbed fears, sent healing grace rippling through the bleeding woman and peace to the demoniac's shattered soul, The dream of liberation from the heavy foot of Rome, glory for God and royal dignity for themselves, was vividly real; it was a dream wor-thy of a lifetime of sacrifice. It was a dream not to be! "Nothing that is worth doing can be achieved in our lifetime." Pallotti clearly concurs. "On my own I can do nothing; with God I can do everything." What Pallotti sees with a clarity begot-ten of grace is that no effort of ours, regardless how noble, how ideal or how cloaked in dignity, will find fulfillment in our lifetime. Our effort, strength, stamina~ and speed will first thrill us and then tantalize us with their obvious inability to coerce complete-ness out of our life's work. God alone can deliver more than we may manufacture. God alone can write an ending beyond our endings. "Not the intellect., not the will., not worldly goods ¯. not riches., not honor., not dignity., not promotions, but God." With Pallottine conviction we profess that God alone is our hope: "therefore, we must be saved by hope." Born of this Pallottine conviction is the UAC's task for the November-December 1996 Riecbers ¯ A Way of Being Church Z---ygOJ New Evangelization. We must turn to the busy world with its many worthwhile pursuits and offer it the hope that comes from God alone~ Otherwise the worthy work of our people will become their downfall, as they rdalize that no fulfillment is forthcoming in their lifetimes. You can go out and combat poverty with leonine ferocity, but, for every Ethiopian fed yesterday, a Somali starves today. You can dedicate yourself to nobly terminating racism, and do it with a Schwarzeneggerian swagger, but today's apartheid-free South Africa yields its ~place in the news to a genocidal Rwanda. Gorbachev tears down walls for freedom; elsewhere someone loots the bill for terrorists. Desmond Tutu seeks to set his people free with the South African Truth Commission's airing of stories buried too long and too deep; others, far away in various direc-tions, distort ,the truth in hate-mongering rhetoric. Into this world we have been sent. To these men and women we must speak of the God of infinite love who can give every worthwhile human endeavor the blessing of a consummation that human history will relentlessly, ruthlessly deny it. We are together to evangelize so that people may be saved by hope. "Nothing which is true or beautiful or good makes complete sense in any immediate context of history; therefore, we must be saved by faith." The Emmaus-bound disciples have tasted beauty, truth, and goodness in their time with Christ. "Before God and all the people', (Lk 24:19), Jesus revealed the beautiful heart, that wel-comes children; the true heart of the teacher lecturing tirelessly, openly, and authoritatively in temple and boat, on mountain and plain; and the good heart weeping for Lazarus in the tomb, heal-ing the centurion's servant, and shielding Mary from the harangu-ing of her harried elder sister. Now they stand in a puzzlement born of betrayal. For this beauty, truth, and goodness called Christ has been condemned to death and crucified. Moreover, even the empty tomb, the vision of angels, and the women's confident assertion that Jesus yet lives is now nonsensical to the disciples. The resurrection with the gaping truth of the tomb, the celestial beauty of an angelic news flash, and ~the gripping goodness of tidings that Jesus is 'risen from the dead~all remain meaningless because the only context these two know is death .and destruction with their definitive finality., "Nothing which is true or beautiful or good makes complete sense in any immediate, context of history." Review for Religion's Pallotti continually points to faith as the only context big enough to allow us to make heads or tails out of life's maddening complexity. If the span of our days is all we have, if the psalmist's seventy years (or eighty for the strong) are all we have for com-prehending life's events, then no avenue save futility and absurdity is open to us. Vincent Pallotti prescribes faith in the God of infi-nite love as the antidote: God's infinity offers a context in which we can live beyond the immediate experience. While Pallotti himself does not understand every why and wherefore of God's will, he has faith that God is not to be outdone in generosity. Puzzled and likely hurt by the rumor-mongering jealousy that made his pastorate in Spirito Santo a nightmare lived in waking hours, and eventually caused an unjust and unjus-tifiable suppression of the UAC, Pallotti has faith in the inex-haustible mercy and mystery of God, which will open up the present hour of harrowing agony to a meaning beyond the momentary. Here we find the UAC's second task in the New Evangelization. We must teach faith as a means of finding mean-ing beyond the momentary. The immediate context of history has to be broadened to the eternal horizon of faith, which is God himself. The now is simply not enough. Try as we may, the death of children by abuse does not make sense in our immediate context alone. What does truth mean in our day when wealthy people may purchase enough legal persuasion to win verdicts of "not guilty," while ordinary people of low or moderate incomes may find themselves convicted after minimal arguments for the defense? Can the immediate context alone help us cope with the drunken driver who walks away, unsteadily but alive, from the crash that claims the life and aspi-rations of the teetotaling pedestrian? Unlike Disney movies, lost dogs do not always find their way home, mermaids do not always find princes, beasts do not always marry beauties, angels are not always in the outfield, and some Cinderellas die in grinding poverty without ever making it to the ball. We must spread faith in God, for his rising from the dead is the only possibility of writing a conclusion beyond the otherwise absolute, limiting finality of human life. We are together to evan-gelize so that people may be saved by faith. "Nothing we do, no matter bow virtuous, can be accomplished alone; therefore, we must be saved by love." A final glance at the road to Emmaus revealsto us the truth of this Niebuhrian statement. November-December 1996 Riechers ¯ A Way of Being Church The disciples are doing a virtuofis thing. They are talking about all the things that happened in, Jerusalem, seeking a shred of meaning, a fleeting glimpse of God, in the morass their lives have become. Yet they do not accomplish anything until Jesus interprets everything for them. Pallotti once wrote, "My Jesus, anyone who does not love you cannot live." Why not? Because, if people do not love, they do not reach beyond .themselves, for love is self-transcendende. If we never reach past our narrow needs and greeds, we remain alone; like the gospel grain of wheat. But those who remain alone do not live. Out of this divinely, revealed and inspired love, Pallotti would have us move from self to neighbor. It is this infinite love that drove him to found the UAC. This love is the constitutive ele-ment of the UAC. This love is what Pallotti would have us rekin-dle. This love, however, we cannot accomplish on our own. We must receive it from the God of infinite love. As the UAC we find in this experience our last task for the New Evangelization. A clear-eyed view of the world shows us a devastating truth: We cannot go it alone; we must be saved by love. The rugged individualism of the 1980s has decayed into the ragged loneliness of the 1990s. The myth of ever-expanding opportunities and limitless futures has collided headlong with the era that downsizes everything, including compassion. The peren-nial quest for self-discovery has not relieved our people of their confusion. They must be saved by love. And we must be together to evangelize so that it may be so! There you have it. Our journey has been hard, but happy, touched by love and laughter, sprinkled with songs and tears. It is the price to be paid if we would find a way of being church. In the end of all our journeys, we can only hope that this rendering of a passage of Virgil's Aeneid (1.198-203) may be true of us: "And the time will come when it will gladden our hearts to recall these first trying days and the difficult things that we did, not each of us striving alone, but all of us working together." Review for Religious RITA E. GOLDMAN Frances Cabrini: A Woman for Today What if Mother Cabrini had been born in 1950 instead of 1850? What aspects of her life would be different? Personally, I think none. She was a true daughter of the church, and I am sure she would have welcomed the era of Vatican Council II. Even in her day she was considered forward. When she wanted Missionaries in the title of her religious congregation, she was told only men were mis-sionaries. At that time there was in Italian no feminine form of the masculine word missionari. A certain Father Marinoni, the director of the Foreign Mission Seminary, said, "It is not even in the dictionary." But she persisted. In Italy her sisters came to be called Missionarie del Sacro Cuore di Gesi~. We often think of saints as human beings far above ourselves, not realizing that in their lives they experienced their humanity in ways that we could recognize from our own lives. Perhaps it is the way the saints have been writ-ten about that leads us to think they were not truly human beings like ourselves. Many years ago lives of saints were written in very flowei'y, complimentary terms. The books Rita E. Goldman retired from United States foreign service in 1989 after assignments in Liberia, Nepal, Burma, Cameroon, and Romania. Since then, besides some volunteer work with Holy Cross sisters in Israel and with Mother Cabrini's sisters in Chicago, she has been involved in the RCIA program of her parish, St. Frances Cabrini. Her address is 3041 North Country Club Road, Apt. 220; Tucso.n, Arizona 85716. models November-December 1996 Goldman * Frances Cabrini 5.94 tended to portray only their "saintly" attributes, making the per-' sons seem not human to us when we read about them. In this article I hope to present Mother Cabrini as a real person, one very much like us. In fact, several prelates and business associ-ates who had known her were surprised when she was canonized. They said that in many business transactions she did not behave like a saint--she often pounded the table to make a point and would raise her voice in a heated exchange! Mother Cabrini was a modern woman. Her interests were extensive, and she certainly did not adapt 'readily to the role expected of late-19th- and early-20th-century women religious. She was a business woman and world traveler, keenly aware of the currents of thought in the world of her time. In fact, after her meditation, prayers, and Mass each morning, one of the first things she did was read the morning newspapers. This was before radio and television came upon the scene. I have no doubt that, if Mother Cabrini were living today, she would be turning on the radio or the TV to get her daily news of what was going on in the world. She would have loved the instant communication that exists today--in her day "instant" communication was onl~ the tele-graph and, later, the telephone. On 30 October 1952 Mother Cabrini was posthumously named "The Italian Immigrant of the Century" at a gathering of the American Committee on Italian Migration. Mother Cabrini was singled out because of her "unselfish devotion to humanity" and because "her accomplishments stand as monuments for all to behold and put to shame those people whose bigotry helps raise the cry of intolerance toward the immigrant." If Mother Cabrini.were living today, she would be in her element in regard to the immigrant. In our day there continue to be refugees, political, refugees, immi, grants, and displaced persons; they often make headlines. This has been a century of immigration. In the early 1900s it was the mas-sive immigration from southern and eastern Europe. Today it is immigration 7from Central and South America, Vietnam, China, and the war-torn areas of central Europe. Mother Cabrini's Missionaries of the Sacred Heart of Jesus are in the forefront in helping today's immigrants just as Mother Cabrini was. Maria Francesca Cabrini was bor.n on 15 July 1850 in a small village in Lombardy, Italy. Her parents were pious and devout, and little Franceswas certain she wanted to be a missionary. She was the tenth of eleven children, of whom seven met early deaths. Review for Religqous Only Magdalena (who was retarded), Rosa, Giuseppe, and herself lived to adulthood. As a child Frances used to launch paper boats filled with vio-lets into a stream nearby, pretending the violets were missionar-ies going to foreign lands, especially China. As a teenager Frances applied to two religious communities for admission, but each refused her because of her frail health, a problem she bore throughout life. In 1870 she lost both of her parents; she was twenty. Her sister Rosa had become a public school teacher, and Frances followed her in this. When she was twenty-four years old, her pas-tor and bishop, valuing her desire to serve, asked her to lend a hand for a few weeks at a poorly run orphanage. These "few weeks" that lasted six years were a time of great suffering and prepared Frances for the work she would eventual.ly do. The local bishop offered her his backing: "You always wanted to be a missionary. I know of no such order of women. Why not found one your- ~ self?" So in 1880 she and seven young women con-secrated themselves to God and took religious vows of poverty, chastity, and obedience.~They called themselves Missionaries of the Sacred Heart, They took over an abandoned Franciscan monastery in the town of Codogno, not far from where Frances was born. Maria Francesca Cabrini now became Mother Frances Xavier Cabrini, ready to conquer the world for Christ. During the next few years, Mother Cabrini expanded her order in Italy, opening many houses and accepting new vocations. But she was still intent on doing missionary work. In 1887 she met Pope Leo XIII, who, even though he was aware of her desire to do missionary work in China,-persuaded her to go to America to assist the many Italian immigrants there who were in dire need. He said to her: "Not to the Orient, Cabrini, but to the West. Your China is the United States." At the time of her death in Chicago in 1917 at the age of sixty-seven, Mother Cabrini had founded sixty-seven hospitals, orphanages, and schools in .the United States, South and Central America,. and Europe. After her death other foundations were made in Africa, Asia, and Australia. .From an early age, after a frightening experience of near If Mother Cabrini were living today, she would be in her element in regard to the immigrant. November-Deconber 1996 Goldman ¯ Frances Cabrini drowning, Frances had a real fear of water. Yet, even with this fear, she in her missionary travels crossed the Atlantic Ocean some twenty-three tiines, going to the United States and South and Central America. The only times she really had for "rest" were during these ocean voyages. Most of her correspondence was done at these times, including long letters about her travels written to her sisters back in Italy. Mother Cabrini's favorite sub-ject when she taught school was geography, and this is very much reflected in the travel letters she wrote. She certainly researched and read beforehand about the places where she was going to start a mission. It was in reading the book of her Travels that I came across the real Mother Cabrini, and I would like to quote some passages from these letters to show how human and like us she really was. Did Mother Cabrini know and speak English? The answer to that is yes. During her second voyage to New York in 1890, she wrote: "The sisters tell him [a friendly man on the boat] in English what he has not understood from me. He is very intelligent, and from the expression on my face he understands what I intend to say. He asks me to speak English as well as I can, and he helps me with some French words, saying he can understand. Sister Bernardina is going to make a novena for me to obtain the grace to speak English, and assures me she will obtain it. What do you think of it? 1 fear the day of judgment will arrive before 1 learn English." During the voyage from Genoa to New York in 1894, Mother Cabrini related the following: "Yesterday a waiter told me how sorry he was that he could not speak Italian so that he might ren-der the sisters better service. He wants me to act as interpreter, but my knowledge of English is limited, barely enough to prevent me from losing my way or dying of hunger." Sister Mary Louise Sullivan, however, in her Mother Cabrini: Italian Immigrant of the Century (1992), says: "Mother Cabrini read American newspapers daily when she was present in her houses in the United States. The Chicago Tribune was on her desk each day. She knew what you were talking about when you spoke to her in English and would sometimes reply gently in English when you tried to address her in halting Italian. She could become quite angry and would raise her voice when upbraiding a sister in her native Italian." Some of the humorous incidents she related were, in con-junction with the roughness of the ocean during some of her voy- Review for Religious ages. On her second voyage to New York in 1890, she wrote: "Poor sisters! At every movement of the boat they think we are in a great storm. Sister Eletta would like to have the boat stopped, at least during meals. I told the steward this just to make him laugh. He is so kind." On another occasion she said, "During this tempest not one of the sisters was frightened; all remained quietly in bed, ready to perish quietly, but under the bedclothes." On the voyage from New York to Le Havre in 1899, she wrote: "What a terrible night we have passed! The steamer seemed to jump and fly out of the water. At other times we thought it would capsize . At about 9 a.m. the rocking began again. I was still in bed and could not get up, and the stew-ardess asked if we wanted some break-fast. I told her to bring us some coffee. It was the first time I had ever had anything brought to my bed, and the poor coffee reached me at a very bad moment. No sooner had it been poured out than cup and coffee pot, by a sudden jerk of the steamer, were spilled over my bed. I was forced to get up whether I liked it or not." On her trip to New York in 1890, Mother Cabrini had a com-mon experience for one who is fair-skinned. (Mother Cabrini was very fair and had blond hair--remember she came from northern Italy.) She wrote: "Meantime the heat is like summer. For three days I looked like Bacchus. My forehead is very red, even pur-ple, and this redness is spreading all over my face. At first I thought it was erysipelas. I did not like the prospect, for I should have had to retire from the open, and fresh air is life to me. Happily, however, the doctor said the redness was the effect of the air and of the water which was spraying on my face . Today the skin has begun to peel off my forehead and nose. I am chang-ing like a serpent." Mother Cabrini mentioned language difficulties more than once. In 1898, going from Liverpool to New York, she wrote up this anecdote about Sister Frances, who knew English but not much Italian: "The other day, for instance, she wanted to say cauliflower in Italian, which is cavolf!ore, but her rendering made "I always close the porthole before I go to bed, as I would rather put up with the heat than receive a surprise visit from a fish." November-December 1996 Goldman ¯ Frances Cabrini it 'fiore-cavalli,' which is 'horses-flowers.' By expressing herself in this roundabout way, she was doubly charitable, for 'she gave me the opportunity of a good hearty laugh." That same year Mother Cabrini recounted her experience with the London underground: "We entered a small station. Having gotten our tickets, we stood with many others in what appeared to us a room, waiting to proceed, when suddenly we felt ourselves descending into the earth. Then there was a stop, and we found ourselves in a large subway, lighted by electricity. People began to run as if they were running for their lives, and without saying a word. So we too followed and took our places in the train, or rather trains, for there was a line of carriages which could not be counted in the light, for it was like night so deep down. We had hardly gotten into our compartment'when the train moved off, and, as quick as lightning, we found ourselves in the center of the city, having gone all the way underground. At the station we entered a lift, though owing to its large size it did not seem to be a lift. Then we rose and came out into the daylight." Mother Cabrini related the following on her 1900 voyage from Genoa to Buenos Aires: "At dawn this morning we arrived at M~laga . I thought I would like to make a little visit to the town, and, as everyone was buying the raisins of Mfilaga to take to Buenos Aires, I also secured a box as a memento of the place. But I had better luck than the others, who went into smart-look-ing shops to get theirs, where they had to pay more for the box than for the raisins. I, however, fixed my eye on a donkey coming down a small mountain, loaded with boxes of the celebrated grapes of that mountain. In the evening everybody returned with their beautiful and elegant boxes, and I with my rustic box . At table someone offered us a bottle of M~ilaga wine, find I, wishing to reciprocate, sent to the cabin to get one of the botdes that Mother Augustine had placed there. They asked if it was Mfilaga, 'Yes,' I replied, 'this is Mfilaga.' They enjoyed the joke, drank the.wine, and were surprised at its exquisite taste. They could scarcely believe that such good wine came from Piedmont." On this same 1900 voyage, Mother Cabrini wrote about her cabin: "It is very nicely situated in that part of the steamer where the rocking is little felt, and there is a porthole to the west which I can open at will. I have to keepit closed from 4 a.m. to 7 a.m., as the sailors clean the ship during these hours and throw water about heedlessly. The water often enters through the portholes Review for Religious and causes much inconvenience to those who are not expecting it. I always close the porthole before I go to bed, as I would rather put up with the heat than receive a surprise visit from a fish." All that has been said above will give you some idea of the modernness, and the humor, of Mother Cabrini. Perhaps we can visualize her today walking the corridors of the various institutions she founded, giving comfort and solace to those she meets. Or we can see her walking the streets of New York, Chicago, New Orleans, and all the other cities in both the United States and Central and South America where she founded missions, visiting the homes of Italian immigrants and asking about their lives and their children, assisting them in all the ways that were at her disposal. She did all these things in her life, but we might ask ourselves what made Mother Cabrini tick. I would say the love of God and serving him in his people was the driving force behind all Mother .Cabrini did. She literally left everything in order to find God more perfectly and to serve human beings.God gave her the graces and she generously corresponded. From her earliest days she had this "vision" of mis-sion, and she sacrificed all in order to carry it out. This involved constant interior self-denial, not the bodily mortifications of some of the saints, but a continual going against self in order to conform more perfectly to the will of God as she saw it in her regard and for the institute she founded. It was her contemplation, her communing with God, that gave her the energy to do all she did for others. But most of all she was a woman of faith. She had a great devotion to the Sacred Heart of Jesus and firmly believed that he did everything--she was just an instrument. The following passage in the Constitutions of the Missionary Sisters of the Sacred Heart of Jesus expresses very well what made Mother Cabrini tick: "Mother Cabrini lived her experience of church with missionary fervor which captured her from the first Frances Cabrini was moved to action by the spirit of the Gospels, the word of the church expressed by the Holy Father, the cry of the suffering, the misery of the poor, ~ the tragedy of the abandoned. November-Decevnber 1996 Goldman ¯ Frances Cabrini moment she knowingly gave herself to God. It became the moti-vating force of her life. Strengthened by the Lord, nothing hin-dered her--not even the boldest undertakings--as long as it was justified by the greater glory of God and by her commitment to bring Christ to the world. Frances Cabrini was moved to action by the spirit of the Gospels, the word of the church expressed by the Holy Father, the cry of the suffering, the misery of the poor, the tragedy of the abandoned. Her courage and zeal, rising as they did from her loving communion with the Heart of Christ, impelled her to make her own St. Paul's motto: 'I can do all things in him who strengthens me.'" In proclaiming someone a saint at the conclusion of the care-ful process of canonization, the church tells the faithful that this person is worthy of imitation. The saints are our heroes, certainly more worthy of imitation than film or rock stars. In this brief essay I hope in some way I have shown you the humanness and modernness of Mother Cabrini. I hope, too, thatI have dispelled the notion that saints inhabit such a rarefied realm that they have no relevance for us. Mother Cabrini is very human and very approachable. She lived a life very similar to ours, in our century. She coped with many of the frustrations that we do, but with bet-ter motives, a better =attitude. We too can become saints, but it will take a lot of faith and a lot of love, not only of ourselves but of our neighbor. Knowing Mother Cabrini, we can ask her to help us attain this goal. By praying for her to assist us, we are asking a woman of our own times, a woman who understands what it is like to live in today's world. Icons i hear icons weep in our city their kingly gift of myrrh trickles down making holy faces glisten-glisten into sorrowing sorrowing the sorrow we refuse to bear Lou Ella Hickman IWBS Review for Religious M. BASIL PENNINGTON The Cistercian Martyrs of Algeria, 1996 )n 26 May 1996, from one end of France to the other, all across the land the bells tolled. It was a rather somber note for the glorious feast of Pentecost, Thousands stood in silence around the Eiffel Tower. It was a moment of remembrance, of pain, of joy, of awe. And yet in some ways it was strange that this should be tak-ing place. Since the early days of 1992, after an unpopular gov-ernment canceled an election it was slated to lose, blood had flowed freely in Mgeria. It was estimated that as many as fifty thousand had died in the guerrilla warfare, including at least a hundred citizens of other nations, some forty of them from France alone. Eleven priests and religious had been among those slain. But now, with the kidnapping and subsequent horrifying slaugh-ter of seven Trappist monks of Our Lady of Atlas, suddenly France and the world stopped to take note. Why? Because this was not just another moment in ongoing bloody events. It was a moment of exquisite love: "Greater 10ve than this no one has, than that one lay down one's life for one's friends."' These seven were, as the Trappist abbot general expressed it, "martyrs of love." Consciously, deliberately, these men remained among a chosen people to give an unfaltering witness of love, knowing full well what would be the probable outcome of their witness. M. Basil Pennington OCSO, a contributor to our pages since 1972, writes from St. Joseph's Abbey; 167 Spencer Road; Spencer, Massachusetts 01562. November-December 1996 Pennington ¯ The Cistercian Martyrs Who Were These Seven? The seven monks of Our Lady of Arias who gave their lives in a witness of love were, in fact, quite typical of today's Cistercians. They came from varied backgrounds, mostly the middle class, from different parts of France. Most of them began their monas-tic journey a bit later in life, after having served God's people in other ways. They entered three different French monasteries, but each in some way heard the call to go live a witness of love among the Muslims. In response to that call, they came together at Our Lady of Atlas Monastery, Tibhirine, and formed a "school of char-ity" under the tutelage of Father Christian de Chergd, the prior. All who knew the small community noted how closely these men were bonded in a true friendship. We are not surprised, then, when we learn that, as a student at the Carmelite seminary of Paris, Father Christian wrote his thesis on Christian friendship, a friendship that stands out by reason of its delicacy and its spir-itnal depth. Father Christian, .like others of the seven, first came to know Algeria and, its people during his military service. For twenty-seven months he was stationed there with significant administra-five responsibilities in service of the local population. He returned later as a monk to be another kind of presence, to give another kind of witness. After his ordination as priest, Father Christian had served for a time as chaplain at the great Basilica of the Sacred Heart on Montmartre, but his own heart sought something more. This he pursued at the ancient Cistercian Abbey of Aiguebelle in the foothills of the Alps in southeastern France and then, after some preparation with the White Fathers at Rome, with his Trappist brothers at Tibhirine. Christian was fifty-nine when he found the fullness of love he had always sought and laid down his life for his friends. Brother Luc Dochier, at eighty-two, was the senior of the " community. He was a medical doctor and brought this valuable skill not only to the community but also to people all around. The monastery's dispensary, which was tied in with the health department of the region, was the best for a hundred kilometers around. For all his learning--and he remained ever an avid reader ready to share with the brothers what he read--he was at heart a very simple man. The love of God was central, and love of neigh-bor consumed his working hours as he ministered to all who came. Father Cdlestin Ringeard, twenty years Luc's junior, was Review for Religious Brother's right-hand man. He was a man of energy and color. As a priest of the diocese of Nantes, his ministry had been in the streets; his flock, the alcoholics, the prostitutes, the gays. Like Father Christian, he had seen service in Algeria. In the medical corps he cared for the "enemy" as well as his own. With Brother Luc he cared for them again. Father C~lestin had entered the Abbey of Our Lady of Bellefontaine, in Maine-et-Loire, not far south of Paris. Bellefontaine is the motherhouse of Spencer. It was from there that in March 1984 he set out for Algeria with two others, Brother Michel Fleury and Father Bruno Lemarchand. Brother Michel was from a peas-ant family in Loire-Atlantique. He first heard the call to serve Christ in the poorest of the poor. He joined the Fr~res du Prado, who saw their life as living a "modern Trappist life in the midst of the poor." But soon enough Brother felt drawn to the fullness of the traditional Trappist life. When he joined the brothers at Our Lady of Atlas, he was given the task of com-munity cook. Michel was a simple man, a gentle man, yet very discrete. Curiously, when the abductors took the monks off, Brother managed to carry with him his monastic cowl and leave it along the route, giving the pursuers the sole indication of the direction in which the monks had been taken. Father Bruno, in a sense, no longer belonged to the commu-nity of Our Lady of Atlas. In 1990 he had been sent with three others to start a new little community of witness in Morocco near Fez. He had returned to Atlas a few days before the incursion of the guerrillas in order to take part in the election of a prior. He had brought with him to monastic life a rich background:. He had been a professor and then the head of the College of St. Charles of Thouars. His first experience of Algeria had come early in life when his father was assigned there as an army officer. Two of the martyrs came from the ancient Cistercian monastery hidden high in the French Alps, Notre Dame de Tamie. Born in the region, Brother Paul Favre-Miville was the son of a The monastery's dispensary, which was tied in with the health department of the region, was the best for a hundred kilometers around. November-December 1996 Pennin~ton ¯ The Cistercian Martyrs Savoyard blacksmith. It took him a long time to find his way to the monastery, but he came with skills that enabled him, when he got to Our Lady of Atlas, to set up a good irrigation system that served monk and neighbor alike in the cooperative gardens. His confrere from Tamie, Father Christophe Lebreton, at forty-five, was the youngest of the community. Coming from a family of twelve children--he was the seventh--he seemed to come naturally to monastic life. He was of a poetic nature, very much the lover, who expressed himself well in words, both in his journal and in poems. A mixed group, indeed, like that found in any Cistercian monastery, drawn together by a vision, a transcendent vision cen-tered on a particular, in this case, being a presence of Christ among a people that doe~ not yet understand who this incarnate God of love is. The Background Story The story actually begins over sixty years ago when the monks of Aiguebelle conceived the idea of implanting among the Muslims of Algeria a small community of monks who could be the praying heart of the Christian community in that country and also witness to Christ's love by their own lives of love. They found a site about forty-five miles south of the nation's capital, Algiers, near the city of M~d~a (Lemdiyya) at a place called Tibhirine. Although the community was fully committed to the traditional Cistercian con-templative life, along with many other third-world communities it extended monastic hospitality to providing some medical care for those who came to the monastery door. And, continuing the earliest Cistercian tradition, the brothers who worked the farm and gardens shared their expertise with their less fortunate neigh-bors, enhancing the human condition of these very poor people. As there was no possibility of local vocations, recruits had to be constantly sought in the form of volunteers from the Trappist monasteries of France. Thus the community enjoyed the enrich-ing presence of monks from a number of abbeys. In general, life was quite peaceful in the little monastery, though disturbed at times by the recurring wars. The latest period of disturbance began in December 1991, when the government suddenly canceled elections in which it seemed the fundamentalist Islamic party, the Islamic Salvation Review for Religious Front (FIS), would win control. The FIS formed a guerrilla force and was promptly outlawed. An even more radical group then formed in the mountains, the Armed Islamic Group (GIA). It was this group that warned all foreigners to leave the country, and it began to indulge in periodic acts of terrorism. As the community of Atlas gathered to discuss what they should do in the face of this new warning and threat, they realized they were not the first Cistercian community to face such a chal-lenge. This was the case with the com-munities of Huambo and Bela Vista in Angola, Butende in Uganda, and Marija Zvijezda in Bosnia. For the monks of Atlas, the question became more acute when an armed band of the GIA, the "brothers from the mountain" as Father Christian called them, visited the monastery on Christmas eve in 1993. The guerrillas wanted to oblige the monks to collaborate with them through medical aid, economic support, and logistical help. In response the prefect of M4d~a offered the monks armed pro-tection and the possibility of moving from the monastery to a protected area. Through community discussions and votes during the following days, the monks decided to remain at Atlas, to decline armed protection so as to remain a sign of peace, and to reject any form of collaboration with the armed group except medical aid given only in the monastery dispensary. Father Christian sought to express the monks' position in a letter to the chief of the GIA, Sayah Attiya: Brother, allow me to address you like this, as man to man, believer to believer. In the pre~ent conflict in which our country is living, it seems to us impossible to take sides. The fact that we are foreigners forbids it. Our state as monks (ruhbfn) binds us to God's choice for us, which is prayer and the simple life, manual work, hospitality, and sharing with everyone, especially with the poor . These reasons for our life are a free choice for each one of us. They bind us until death. I do not think that it is God's will that this death should come to us through you . If one day the Algerians judge that we are unwelcome, we will respect their desire to see us leave. With very great regret I know that we will continue to love them all, as a whole, and that includes you. The community enjoyed the enriching presence of monks from a number of abbeys. Novonber-Deconber 1996 Penning'ton ¯ The Cistercian Martyrs When and how will this message reach you? It does not matter! I needed to write it to you today. Forgive me for having written in my mother tongue. You understand me. And may the only One of all life lead us! Amin. As the danger increased, in June 1994 the apostolic nuncio invited the monks to come and live at the nunciature. The broth-ers did not judge the time had come yet to abandon their monastery. When, on 23 October 1994, two Spanish Augustinian nuns were murdered at the entrance of the parish church, Father Christian wrote to the abbot general: The'communities of men seem to be standing by their option to remain. This is clear so far for the Jesuits, the Little Brothers of Jesus, all the White Fathers. It is also clear for us. At Tibhirine as elsewhere this option has its risks. That is obvious. Each one has told me that he wants to take them, in a journey of faith into the future and in sharing the present with neighbors who have always been very close friends of ours._The grace of this gift iis given to us from day to day, very simply. At the end of September we had another nocturnal "visit." This time the "brothers of the mountain" wanted to use our telephone. We pretended to listen in, then emphasized the contradiction between our way of life and any kind of complicity with what could harm the life of another. They gave us assurances, but the threat was there, supported by arms. (13 November 1994) On 16 December, after more cflreful and prayerful discussion, the brothers again took a vote to confirm their decisions. At this time the archbishop of Algiers, Henri Teissier, thanked them for taking the risk of prolonging their presence and their witness, telling them how significant was their presence of prayer and daily work in Tibhirine for the whole Christian community of Algeria. He thanked them for their fidelity and courage. The Testament of Father Christian It was during the previous Advent of 1993 that Father Christian had composed his "Testament," to be opened only after his death. This was done on 23 May 1996 when his and his bro,thers' passing was announced. There is no doubt but that this testament will be cherished as one of the great spiritual classics of the 20th century-- though surely that is not what this humble and transparent monk would ever have intended. Let us share it,with you in full: Review for Religious When an A-DIEU is envisaged. If it should happen one day--and it could be today--that I become a victim of the terrorism which now seems to encompass all the foreigners living in Algeria, I would like my community, my church, my family, ¯ to remember that my life was given to God and to this country; ¯ to accept that the One Master of all life was not a stranger to this brutal departure; ¯ to pray for me--for how should I be found worthy of such an offering? ¯ to be able to associate this death with so many other equally violent ones that have been allowed to fall into the indifference of anonymity. My life has no more value than any other. Nor any less value. In any .case, it has not the innocence of childhood. I have lived long enough to know that I am an accom-plice in the evil which seems, alas, to prevail in the world, and even in that evil which would strike me blindly. I should like, when the time comes, to have enough lucidity to beg forgiveness of God and of my brothers and sisters in the human family, and at the same time to forgive with all my heart the one who would strike me down. , I could not desire such a death~ It seems to me impor-tant to state this. I don't see, in fact, how I could rejoice if the people I love were indiscriminately accused of my murder. It would be too high a price to pay for what will be called, perhaps, the "grace of martyrdom" to owe this to an Algerian, whoever he may be, especially if he says he is acting in fidelity to what he believes to be Islam. I know the contempt in wtiich the Algerians as a whoie can be held. I know, too, the caricatures of Islam which ,encourage a certain Islamism. It is too easy to give oneself a good conscience in iden-tifying this religious way with the fundamentalist ideology of its extremists. " For me, Algeria and Islam are something different: they are body and soul. I have proclaimed it enough, I think, seeing and know-ing what I have received from them, finding here so often that direct line bringing the gospel that I learned at my mother's knee, my very first church; finding it precisely in Algeria, and already in the reverence of believing Muslims. My death, obviously, will appear to justify those who Novevnber-Deconber 1996 Pennington ¯ The Cistercian Martyrs hastily judged me naive or idealistic: "Let him tell us now what he thinks of them!" But these .must know that at last my most insistent curiosity will be satisfied. For this is what I shall be able to do, if God wills: immerse my gaze in that of the Father to contemplate with him his children of Islam as he sees them, all shining with the glory of Christ, fruit of his Passion, filled with the gift of the Spirit, whose secret joy will always be to establish communion and to refashion the likeness in playing with the differences. For this life lost, totally mine and totally theirs, I thank God, who seems to have wished it entirely for the sake of that joy in and in spite of everything. In this thank-you where, once and for all, all is said about my life, I certainly include you, friends of yesterday and today, and you, 0 my friends of this place, at the side of my mother and my father, of my sisters and my brothers and their families--the hundredfold given as he had promised! And you, too, my last-minute friend, who would not have known what you were doing; yes, for you too I say this thank-you and this a-dieu--to commend you to the God in whose face I see yours. And may he grant to us to find each other, happy thieves, in Paradise, if it please.God, the Father of us both. Amen.t Inshallah.t Algiers, 1 December 1993 Tobhirine, 1.January 1994 Christian Has ever an executioner been addressed so lovingly: "my last-minute friend . , . I see your face in the face of God. may we find each other in Paradise"? The "Father, forgive them for they know not what they do" of the Master is echoed with a fullness rarely heard in the long annals of discipleship. Greater love than this no one has. The Time Approaches Two more nuns were shot in Algeria on 3 September 1995. Ten missionaries had now been slain. After the funeral Father Christian wrote a letter to the abbot general in Rome: The celebration had a beautiful atmosphere of serenity and offering. It brought together a very small church, whose Review for Religious remaining members are perfectly conscious that the logic of their presen(+ must include henceforth the possibility of a violent death. It is for many a new and radical plunge, as it were, into the very charism of their congregation., and also a return to the source of the first call. For all that, all of us clearly desire that none of these Algerians, to whom our consecration binds us in the name of the love which God has for them, ever wound this love by killing any of us, any of our brethren. Lord, disarm me and disarm them. A few months later Father Christopher wrote these prophetic lines at the end of a poem: Finally, my friends, let's get it straight: I belong to him and follow his steps to the fullest truth of my Easter. On the night of 26-27 March 1996, Mohammed, the layman who helped the monks, was roused from his sleep--he lived with his family in a cottage at the gate of the monastery--by the "brothers of the mountain." They said they came for Brother Luc, the doctor, to take him to care for some of their men who were wounded. They crashed through into the monastery. When they demanded that Brother Luc come with them, Father Christian refused to allow it in view of Brother's age and serious asthmatic condition. With this the armed band rounded up all the monks they could find. Fortunately two were sleeping in another building and escaped capture, as did the priests and sis-ters in the guesthouse. The seven monks were carried off into the night and nothing further was heard of them until a London Arabic newspaper, A1 Hayat, published extracts from a communication of the GIA dated 18 April. It said that the emir did not recognize the aman, the protection that his predecessor accorded the monks; that it was illicit because the monks "have not ceased to invite Muslims to be evangelized, to display their slogans and symbols, and to com-memorate their feasts with solemnity." He went on, "Monks who live among the working classes can be legitimately killed . They live with people and draw them away from the divine path, urging them to be evangelized. It is also licit to apply to them what applies to lifelong unbelievers when they are prisoners of war: murder, slavery, or exchange for Muslim prisoners." Only later did the French government acknowledge that on 20 November-December 1996 Pennington ¯ The Cistercian Martyrs April the GIA had made a tape on which they required the seven monks to speak as proof that they were still alive. This tape was delivered to the government a week later. There were rumors of secret negotiations. But the monks would not have wanted to win their freedom at the cost of the lives of others, which would cer-tainly have been the case if the captured GIA terrorists were released to wreak more violence. The Martyrdom Although there had been some ambiguous statements from the French government in this regard, President Chirac stated formally on 20 May that there would be no negotiations with the terrorists regarding an "exchange of prisoners." This seems to have settled the mfitter. On 23 May, Radio Medi 1 in Tangiers read extracts from a GIA communiqud announcing that the seven monks had been beheaded on 21 May. Some doubt as to the verac-ity of this report lingered. But the French government, now admitting it had received the earlier secret communication from the GIA, confirmed the authenticity of the radio report. On Thursday evening, 23 May, in a powerfully symbolic act watched by millions on television, Cardinal Lustiger of Paris extinguished the seven candles which, in the presence of Christian, Muslim, and Jewish leaders, he had lit seven weeks earlier as a prayer and a hope for the release of the seven monks. Muslim-Christian Relations The se'~en monks of Our Lady of Atlas had dedicated their monastic lives to furthering the growth of healthy and life-giving relations between Muslims and Christians, who shared faith in and worship of the God of our common father, Abraham. At first impulse one might say this sacrilegious butchery had decimated their life's mission. But in fact, according to the paradoxical logic of an all-loving God, it gave it a whole new impetus. Rabah Kebir, the leader of the Islamic Salvation Front, who had earlier demanded of the GIA the release of the seven monks, now spoke out most forcefully: "I strongly condemn this criminal act, which runs absolutely contrary to the principles of Islam." Kahdidja Khalil of the High Council of French Muslims went further: "We strongly condemn this savage and barbaric act. It is Review for Religious forbidden in the holy Koran to touch 'all servants of God,' and that means priests and rabbis as well." The High Council had issued a fatwa, a solemn religious decree, declaring the monks' abduction illegal and calling for a day of fasting to pray for their release. In his address on Pentecost to the faithful in the piazza of St. Peter's, Pope John Paul II said: "Despite our deep sorrow, we thank God for the witness of love given by these religious. Their fidelity and constancy give honor to the church and surely will be seeds of reconciliation and peace for the Algerian people, with whom they were in solidarity." Also on Pentecost Sunday, in a symbolically powerful gesture once again, Cardinal Lustiger relit the seven candles before the high altar of Notre Dame Cathedral as a sign of reconciliation, declaring that the monks had not died in vain, but rather "for life, for love, and for reconciliation." The Funeral The fullest confirmation of the sacrifice of the seven Trappist brothers came on 30 May, only a few hours before the abbot gen-eral's arrival in Algeria for the celebration in honor of the martyrs. That morning the mutilated remains of the seven monks were found in a heap beside the road not far from Mtdta. They had evi-dently been interred for a time at some other location. The remains were placed in very simple wooden coffins and taken to the military hospital in Algiers. There the abbot general had the sorrowful task of identifying the remains. On the same day as the remains were found, Cardinal L~on Etienne Duval, the father of the church in Algeria and a great friend and supporter of the monks, completed his life's journey at the age of ninety-two. His funeral Mass on 2 June would be one with the Mass in the Cathedral of Our Lady of Africa for his seven sons and brothers. The Holy Father sent Cardinal Francis Arinze to represent him and preside. The two surviving monks of Our Lady of Atlas, Fathers Jean-Pierre and Amedeus, stood at the altar with him, as did the archbishop of Algiers and the Trappist abbot general and procurator general. In the sanctuary were the cardinal archbishop of Paris, Jean-Marie Lustiger, three other French bish-ops, and five ministers of the Algerian government. Seven of Father Christopher's brothers and sisters were present. November-Dece~nber 1996 Pennin~ton ¯ Tbe Cistercian Martyrs Cardinal Arinze in his funeral oration amplified the words the Holy Father had used on Pentecost: "The monks suffered unheard of violence . They gave all men and women an exam-ple of total sacrifice in honor of God and religion . The monks of M6d6a established friendly relations with their Muslim neigh-bors. They offered their services, especially in the field of medicine . They also contributed to the development of spir-itual dialogue and in this way gave evidence that sincere Muslims and Christians are able to gather together and mutually enrich each other also in the sphere of the spirit." Two days later, on Tuesday, 4 June, a small party was trans-ported by helicopter to M6d6a and on to the now deserted monastery at Tibhirine under heavy military escort. The remains of the brothers had been brought there the day before. The Muslim villagers, who loved the monks and had so often benefited from their ministrations, had dug the seven graves in the ceme-tery by the monastic church. The funeral service within the church was simple and brief, that at the graveside even more so. No news media or outsiders had been allowed to come. The brothers were laid to rest with those of their community who had gone before. If these Trappist brothers have been singularly blessed in receiving the grace of martyrdom, in their heroic victory are not we all also singularly blessed? Their witness of steadfast faith and a love that does not flinch in the face of death not only inspires us, but wins for us the grace to follow their example, each in our own calling. We have all been baptized into the death of Christ. We live that death so that in death we may enter into his risen life, We can rejoice in the cruel death of these men because we know and believe they h~ve truly entered into that life, the life for which they longed with all their being. Review for Religious CATHY ARATA Death Questions and Life Questions Nila, short for Petronila, was a woman approaching fifty years of age when I first saw her, but to look at her one would have guessed that she was in her mid-sixties. There was little pleasure in her life, no leisure, lots of heartache, and plenty of hard work. It was now the end of September, and she had been suffering from a severe case of hepati-tis. Her doctor had told her many times that what she needed most was rest, but the doctor had no idea of the circumstances in which she lived and moved and had her being. Nila and her husband, daughter, and son lived in a small isolated village with fifteen other families. The vil-lage has no water and no electricity and is a steep, ardu-ous climb from anywhere else. All the houses are adobe, with tin roofs and earthen floors. There is no school, no health clinic, no store of any kind. To get her daily supply of water, Nila had to walk downhill for about fifteen minutes and then t.rudge uphill with a five-gallon jug of water on her head. She usually did this three times a day. When the housekeeping chores were done, she went to the stream to do the family wash. On the days that she needed firewood, it was another long walk to gather the wood and then return home carrying up to fifty pounds of it on her head. I had seen Nila a few weeks before. Her yellow eyes Cathy Arata SSND worked in El Salvador for seven years. Her present address is 6401 North Charles Street; Baltimore, Maryland 21212. November-December 1996 life and death Arata ¯ Death Questions and L~e (~uestions gave ,no doubt that she did indeed have hepatitis. But that was back in July, and now we were entering October. It was about 7:30 in the evening, and I had just driven into the village where I live. As I was getting out of the car, someone told me that Nila had just been carried down the mountain in a hammock and that she was seriously ill. At first I did not pay much attention. It had been a long day and I was tired. I wanted only to get into my lit-tle house, close the door, and not be bothered. I was also impa-tient at the expectation that I would go and visit her. Well, I did go and was taken off guard by what I saw when I arrived at the place where they had taken. Nila. It was a small one-room adobe house, dark inside with a candle or two burning. The family, too poor to have closets, had boxes of clothing piled on tables along the wall. There were three simple wood-frame beds; on each one sat three or four children. Nila was in the mid-dle of the floor on a straw mat. She was, I guess you could say, semiconscious, writhing in pain. The small house was crowded with neighbors who had come to gawk at her. Close to where she lay, there were ten or twelve chickefis scratching on the floor for a morsel to eat. I was angry and frustrated with all the people who were stand-ing around "doing nothing," probably because of my own com-pulsive need to do something. So, when Nila's brother asked me if I could drive her to the clinic about three miles away, I readily agreed to do so. I went for the car, and the men began to lift Nila into the hammock in order to carry her to a spot where I would be able to meet them with the car. It was about 8:30 p.m. and the clinic was closed. In E1 Salvador all doctors and teachers have to give one year of com-munity service after their schooling. The doctor of this little vil-lage was a government doctor and was not happy to see us when we went to her home to tell her we had a patient who needed help. She was undoubtedly as tired as I, and she angrily said, "Why didn't you come during hours?" But she relented. Nila's brother and her older daughter literally dragged her from the car to the clinic because, although she was still alive, she was dead weight. Recognizing immediately that she needed a hospital, the doctor was harsh and cold and scolded us for not coming sooner. Nila died the next day in the hospital in Ilobasco, a small city about an hour and a half away. Her older son, a guerrilla.during the war and now a member of the newly formed National Police, Review for Relig4otts was with her. He borrowed money to buy the simple, crude wooden box in which to carry her back to the village. The box, with the remains of Nila, was placed on the back of an old pickup truck and driven over a dirt road much in need of repair. The news of Nila's death jolted me because I was taken off guard, not only by her death, but also by my own coldness and lack of compassion. That evening, when I arrived at the house where the wake was to be held, most of the community had already gathered, and, as was the custom, the men were outside playing cards and drinking homemade liquor while the women and children were inside praying and singing devotional hymns. The coffin was in the middle of the floor, in the exact spot where I had found Nila two nights earlier. It had survived the journey from Ilobasco and was now surrounded by flowers of many kinds which the neighbors had brought from their gardens. Most of them were placed in "vases" of Nestl~ instant-milk cans. A candle burned at each corner of the coffin, which was so constructed that a small piece of glass made Nila's face visible. But, because the house was so hot, steam had formed on the inside of the glass, and her face could not be seen clearly. The chickens were scratching around, but no one seemed to notice. After all, it is not unusual to have chickens roaming through the house. Two pigs came in and were shooed away. As we prayed the rosary, my mind flashed to Jefferson City, Missouri, where at the same moment Mary Margaret Johanning, our former SSND international leader, lay dying. I could not help comparing the way Nila died and the way Mary Margaret was dying. Both women were too young to die, and both believed fervently in an all-loving God. Perhaps that is all they had in common. It seemed obvious that, as Mary Margaret died, her God was present to her in the doctors and nurses who tried to lengthen her life, using all the newest technology that medicine has to offer. God was present to her too in the hundreds of cards and notes she received from her sisters around the world. Above all, The news of Nila's death jolted me because I was taken off guard, not only by her death, but also by my own coldness and lack of compassion. November-December 1996 Arata ¯ Death Questions and Life Questions God was present in her devoted family and host of loving friends who accompanied her in her dying. And Nila? Was God present as she writhed on the earthen floor surrounded by chickens looking for a morsel to eat? When her husband arrived at the wake drunk and vomiting, swinging his .machete in the air, was God there too? Was God outside with the men who were drinking and playing cards? It seems as if God treats us all very differently, and for a long time I have been angry with this God of ours. I have been resent-ful and frustrated that God is not the God I think God should be! God should not allow such things as Nila's cruel poverty and harsh dying and death, nor should God allow wars and concen-tration camps and bullets and bombs and mortars that carry atroc-ities beyond human imagining. God should put a moratorium on those things insurance companies call "acts of God," such as earth-quakes, floods, typhoons, and hurricanes. I have been resentful toward myself, too, because I am pow-erless in the face of such evil. My resentment has shown itself in my impatience, my coldness, my frustration at not being able to do what God is not doing: changing unjust structures, wiping out poverty, replacing wars with lasting justice and peace, and con-trolling the forces of nature. The past few months I have been gifted by my community with some sabbatical time: time to step out of a very active min-istry spanning thirty-three years and reflect on the meaning of those years, time to pause long enough to quiet my own com-pulsive need to right the wrong in the world and, in the silence and space, allow God to intimate to me that I was forgetting who I was and that I was assuming the role that was properly God's! Most of my questions, though, remain: Why such evil in the world? Why such a disparity between those who are poor and those who are rich? Why such a disparity of natural resources from country to country? Why th

Issue 51.4 of the Review for Religious, July/August 1992. ; for religi.ous Christian Heritages and Contemporary Living JULY-AUGUST 1992 ¯-VOLUME 51 ¯ NUMBER 4 Review for Religious (ISSN 0034-639X) is published bi-monthly at Saint Louis University by the Jesuits of the Missouri Province. Editorial Office: 3601 Lindell Boulevard ¯ St. Louis, Missouri 63108-3393. Telephone: 314-535-3048 ¯ FAX: 314-535-0601 Manuscripts, books for review, and correspondence with the editor: Review for Religious ¯ 3601 Lindell Boulevard ° St. Louis, Missouri 63108-3393. Correspondence about the Canonical Counsel department: Elizabeth McDonough OP ¯ 5001 Eastern Avenue ¯ P.O. Box 29260 Washington~ D.C. 20017. POSTMASTER Send address changes to Review for Religious ° P.O. Box 6070 ° Duluth, MN 55806. Second-class postage paid at St. Louis, Missouri, and additional offices. SUBSCRIPTION RATES Single copy $5 includes surface mailing costs. One-year subscription $15 plus mailing costs. Two-year subscription $28 plus mailing costs. See inside back cover for more subscription information and mailing costs. ©1992 Review for Religious for religious Editor Associate Editors Canonical Counsel Editor Assistant Editors Advisory Board David L. Fleming SJ Philip C. Fischer SJ Michael G. Harter SJ Elizabeth McDonough OP Jean Read Mary Ann Foppe Mary Margaret Johanning SSND Iris Ann Ledden SSND Edmundo Rodriguez SJ Se~in Sammon FMS Wendy Wright PhD Suzanne Zuercher OSB Christian Heritages and Contemporary Living JULY-AUGUST 1992 ¯ VOLUME 51 ¯ NUMBER 4 contents evangelizing and witnessing ° 486 Church of the Poor Juan Ram6n Moreno sJ reflects on the implications of seeing the poor as central for the identity of the church and religious life. 496 Women Missioners amidst Violence Annmarie Sanders IHM reflects the questions, fears, and chal-lenges facing foreign women missionaries in Peru. 504 School of Terror Roy Bourgeois MM speaks on behalf of the poor as he voices his concern about a particular military training camp called the School of the Americas. inculturating 508 Women Religious and the African Synod M. Gerard Nwagwu offers her thoughts on the evangelization of Africa in an article originally presented as the keynote address at the National Day of Celebration of the Nigerian Conference of Women Religious in January 1992. 519 Rerooting Religious Life in South Africa Jennifer Mary Alt OP reflects on how native African spiritual values might become better integrated into the religious-life vocation. 527 54O 545 living religiously Religious Life and Religion Albert DiIanni SM calls attention to the religious core of a belief in God and of our relationship with God which cannot be reduced to a personal~ social, or ecological morality. Detachment in Our Psychological Age Eileen P. O'Hea CSJ explains detachment as a way of freeing ourselves from our compulsive behaviors and opening ourselves to God's healing. An Ache in My Heart Bernard Seif SMC witnesses to the continuing call and direction of God in bringing forth new forms of dedicated life in the " church. 482 Review Jbr Religious focusing religious life 550 Religious Life in Church Documents Patricia F. Walter OP presents some aspects identifying religious life in conciliar and postconciliar documents of the magisterium. 562 The Ignatian Charism of the Sisters of St. Joseph Joan L. Roccasalvo CSJ shows how the Spiritual Exercises per-meate Jean-Pierre M~daille's Maxims of Perfection and so fire an Ignatian spirit for the Sisters of St. Joseph. 575 Envisioning Associate Identity Rose Marie Jasinski CBS reflects on the status of the associate movement in the light of the second national conference held 5-7 May 1991. 581 Musings about Vocations James E. Claffey CM finds vocation ministry a stimulant to a broader understanding of how God breaks into our history. 585 595 600 614 484 625 632 ministering Pastoral Leadership beyond the Managerial (XL*~ Matthias Neuman OSB stresses the role of spiritual leadership in the midst of ministry challenges. Scarcity and Abundance in Parishes Thomas P. Sweetser SJ compares the parish to a desert of scarci-ties, but at the same time a desert beautiful with hidden wells of life. Marian Community and Ministry Patrick Primeaux SM combines data from both the theological and businessomanage.ment disciplines to distinguish a Petrine and a Marian way of ministering and of living community. Three Images of Priesthood Henry J. Charles proposes the images of priest as collaborator, mystagogue, and holy man for a renewed understanding of priesthood. departments Prisms /~ Canonical Counsel: Involuntary Ex~laustration Book Reviews .l~uly-Augu.ct 1992 483 prisms History happens. We human beings can write our history books and, by emphasis and omission and sometimes by romanticizing, make as if we are mas-ters of our history. It may take only some seventy years for the rewriting of the Communist history of Russia or it may take five hundred years for the European discovery of the Americas to be reevaluated. But it happens. We say that Pope John XXIII made history when he called the Second Vatican Council. We are well aware that the church experienced, through the actions of the bishops present at the council, something that has been likened to a second Pentecost. For our own availability to the God of history, we need to return again and again to the happening of that first Pentecost and the subsequent events as recorded in the Acts of the Apostles. God's Spirit makes things happen, even when the very persons involved seem so little capable of being the crafters of history. Most recently Pope John Paul II has expressed his own desire to make history by his call for a new evangelization, partic-ularly occasioned by our entering into the third millen-nium. This call to a new evangelization holds the promise of another moment of this second Pentecost that came with Vatican II. It is history happening, in which none of us is the master or control-artist, but every one of us plays an important role--with the Spirit's direction. Evangelization--new evangelization--demands much of us all. A paradigm of evangelization and inculturation captures our attention anew as we reflect upon the events in the Acts of the Apostles. It means that no one can hold himself or herself exempt from the call of this second moment of the second Pentecostqthe call to a new hear- 484 Review for Religious ing of good news. This is not the time for new rules or the impo-sition of old ones--the Judaizers tried that two thousand years ago. It is the time for Cornelius, his wife, and household to invite Peter once again to proclaim the gospel so that new conversion on everyone's part can take place. It is the time for Peter to dream new dreams and hear God telling him that old restrictions do not apply in a new creation moment. One of the deepest meanings of Pentecost lies in the fact that all peoples heard the good news in a way that they could under-stand and respond to. It goes beyond the language barrier to breakthroughs involving customs, heritages, and rituals. In the Pentecost beginnings, Jesus Christ and the gospel message needed no inculturation. In the new evangelization as in the original one recorded in the Acts of the Apostles, it is not Jesus Christ who needs to be inculturated; he is already a confidant of people's hearts. It is his church that must be inculturated by being evan-gelized anew as well as by evangelizing others. The Acts of the Apostles--the story of the first evangelizing time--portrays the exhilarating and somber picture that inculturating a church does not come without cost--a cost which everyone must bear in lis-tening to ~hocking good news, in experiencing a certain amount of turmoil, in suffering the pain of differences expressed vigorously by people who serve or are served. John Paul II has said that "we need an evangelization that is new in its ardor, new in its method, new in its expressions." That ' is what we--always the disciples--must allow to happen to our-selves first: to be evangelized anew in order to be the new evan-gelizers. We need to rethink how to inculturate a church, not a gospel. If the original Jewish and pagan converts to the new Christian faith seemed to share little common religious heritage and ritual and yet, with struggle, came to form the Body of Christ, can we today not recognize the imperative of a new evangelization demanding the same kind of breakthrough for traditionalists, lib-erals, feminists, or whatever modern-day version an appeal to the party of Apollos or Paul takes? A new evangelization brings the excitement of discovery into our own lives and so into our church. Let the Spirit lead. It has happened; it will happen again. David L. Fleming SJ ~uly-Augu~t 1992 485 JUAN RAMON MORENO Church of the Poor evangelizing and witnessing Juan Ram6n Moreno SJ was one of six Jesuits mur-dered along with an employee and her daughter by Salvadoran military forces at the Jesuit residence of the Central American University, San Salvador, on 16 November 1989. He was widely known as a spiritual director, teacher, preacher, and giver of retreats and conferences and was the founder and editor of the spirituality journal Diakonfa. Besides holding other responsibilities, at various times he was novice director for the Jesuits of Central America, local superior, university professor, and president of the Panamanian and Nicaraguan con-ferences of religious. This article was first published in Diakonfa 7 (1978): 17-28 and republished in a collection of Father Moreno's writings, Evangelio y misidn (San Salvador: UCA Editores, 1990). The translation is by James R. Brockman SJ with the permission of UCA Editores. The footnotes are the translator's. The term "church of the poor" is meant to express a new awareness of what it is to be church, an awareness that is growing in force among Christians in Latin America. The following thoughts are proposed as a help toward under-standing the foundation and principal traits of this way of viewing the church. Church of the Poor and Vatican II The schema on the church elaborated by the precon-ciliar doctrinal commission brought together the ecclesi-ology traditionally taught in recent centuries, and the 486 Review for Religious that allow one to recognize in Jesus the hoped-for Messiah are that "the blind see and the lame walk., and the good news is proclaimed to the poor" (Mt 11:5), what should be the traits that make recognizable Jesus' church? Church Born from Below Vatican II has allowed us to pass from a church that becomes conscious of itself and is organized and structured fr0m within, from itself, to a church that seeks to understand and structure itselffr0m without, from the world that it has been sent to in order to make God's kingdom grow in that world. Nevertheless, the reality that the world is a divided world had not yet made its full impact on the council. Consequently, the challenges to which it more directly proposes to respond are those of a world seen too much from above, from the angle of the learned and the skilled, from the culture and the perspective of the dominant classes. But at Medellfn2 the Latin American bishops began to express in an inspired and probing manner the conflictive reality of our world. The cry of the impoverished majority of the continent found an echo. The church began to become aware of itself and to organize and structure its life and pastoral action not from an abstract world or from just any part of the real, concrete world, but from below, from the world of the poor, and from there to fashion itself as the true church of Christ. Church of the Poor One must not confuse church of the poor with church3'br the poor. A church for the poo~r would be a church that is constituted in a first step that is logically prior to its encounter with the poor and then, in a second step, seeks out the poor to serve and help them. But the church of the poor is a church that in its very con-stitution has the poor as its center. There is no doubt that the church, as the historical body of Christ, must place itself in the world to transform it and to make present in it the reign of God. It must be incarnated, that is, take a body, become a visible and acting institution. But the problem is, what are the criteria that are to determine its institutional shape? What body will it take? Faithful to the incarnational logic of Jesus, the church must take the body of the poor, incorporat-j~ uly-.4ugust 1992 489 Moreno ¯ Church of the Poor ing the poor, making the poor to be those who make up what is characteristic and determinant of its body, which is structured and takes visible form from the cause and the interests of the poor. Let us take a Gospel passage that graphically illustrates this, which is the particular way of acting of Jesus. I choose the short scene with which Mark begins his third chapter. He describes a Jesus situated within a determined sociocultural-religious con-text. But Jesus is situated in it concretely, and he is situated in a way which is perceived by one of the parties as threatening to its interests--"they wer~ watching him closely" (3:2)--and which provokes a conflict so sharp that "they plotted together to see how to eliminate him" (3:6). What is indicative is the place where Jesus is situated and from which he faces the situation: solidarity with the actual man, the man in his poverty, the man oppressed by his paralyzed hand and forsaken by the institution. He has him step into the middle of the synagogue. And he obliges the others, the representatives of the grand institution, to face up to their own presuppositions: Is it licit or not? What is more important, the institution or the person, maintaining the institution or free-ing a man from what concretely oppresses him? What is the cri-terion to act on? "But they were silent" (3:4). Jesus' reaction is, "Then looking at them with anger . . ." (3:5). Countless times the Gospels speak of Jesus' look--always a loving and compas-sionate look. Now he looks "with anger." At whom? At that group of wise, prudent men who are respectful of the institution. Why? Because they refuse to commit themselves to the man, they refuse to make a decision in regard to a poor person, they refuse to take a stand in a situation that questions their rigid institutional schemes. Jesus says, "Hold out your hand" (3:5). Jesus chooses the poor person, the man in a situation of concrete need. The institution is either at the service of human beings orit does not reflect the true God. The Gospels contain many even more radical expressions about the poor as the fundamental criterion for discerning whether we are following the path to God's kingdom. Perhaps the most awesome and disquieting is the words contained in Matthew 25:31-46: "Come, blessed ones of my Father, inherit the kingdom . . . for I was hungry and you gave me to eat. depart from me, accursed ones., for I was naked and you did no~' clothe me . " There is not much room here for sociological or 490 Review for Religious theological lucubrations about who are the poor that are spoken of and what is the determinant criterion for measuring God's nearness. Crucified Church As we can see in the example of Jesus, taking the side of the poor supposes having the courage to get involved in conflict. The history of the Latin American church since Medellfn confirms what has been true all through its existence: insofar as it empties itself of power and prestige so as to enter the world of the poor and be identified with them and their cause, it has also had to suffer their lot--crucifixion and death--and it has come to under-stand why it cannot follow Jesus without denying itself and car-rying the cross. It is because the immense majority of the poor are not poor simply because of nature, but because of other persons. In reality, the poor are the impoverished. Hence, their mere pres-ence is an accusation, a questioning; it creates conflict. The poor are a cause of division, a division whose theological meaning is apocalyptically described in the eschatological discourse I have mentioned: "He will separate one from the other, as the shep-herd separates the sheep from the goats" (Mt 25:32). Jesus him-self, poor and in solidarity with the poor, appears as "a sign of contradiction" (Lk 2:34); and when he takes his place actually at the side of the poor, he provokes conflict and repression, and he suffers death. For this reason the church of the poor is the crucified church, the church of the martyrs. It is so insofar as it is a church of the poor. As long as it preaches universal but abstract love, as long as it is a church from above, the world's powerful praise and respect it; they consider it their church. But when it begins to translate love into historical terms, when it begins to take the side of the poor and it plans and organizes its pastoral work with them in mind, then it begins also to be the church that is slandered and persecuted. If we look at this fact in the light of the Beatitudes (see Lk 6:22-23, 26) there is no doubt which one is the church of Jesus. Church in which the Poor are Evangelized The poor are the privileged consignees of the good news of .~ly-Aug'ust 1992 491 Moreno ¯ Church of the Poor salvation. That does not mean they are the exclusive consignees. Partiality is not the same as exclusiveness. Jesus comes to bring sal-vation for all. But he comes to bring it from the poor, and fi'om them he confronts the changes that must come about in the world; he makes specific what it means to be converted, what it means to become brothers and sisters. This is not a matter of mystifying the poor, as if they were the good and the rich were the bad. It is that objectively God's identi-fication with the poor, the defense of their cause, is precisely where it is revealed what God is, a God who is love that saves, love that creates a brotherhood and sisterhood of sons and daughters, love that makes all things new. And so it is from there that salva-tion is offered to all. The Beatitudes proclaim, not the goodness of human beings, but the goodness of the God who identifies with the little ones of the earth. The Acts of the Apostles describes for us a church that under, stood this very well and where for that reason the poor find their place in such a way that they cease to be poor: Among them no one was needy, because all those who pos-sessed land or houses sold them and brought the price of the sale., and distribution was made to all according to their needs (Ac 4:34-35). It is the very gesture of him who "being rich became poor for you in order to enrich you with his poverty (2 Co 8:9). Church in which the Poor Evangelize Us This is another of the traits that characterize the church of the poor. St. John declares: Everyone who loves . . . knows God. Whoever does not love does not know God, for God is love (1 Jn 4:7-8). But those who from their objective condition teach the church what true love of God, Christian love, consists in are the poor: If someone has material possessions and sees a brother in need and yet closes his heart to him, how can love of God dwell in him? My children, let us love not just with words, with our lips, but with actions and in truth (1 Jn 3:17-18). The poor reveal to us what the demands are of that love which, because it is Christian, seeks efficacy and a real change in the conditions of suffering and injustice of the poor. They makd us discover who God is: the one who takes the part of the orphan, 492 Review for Religious the widow, the stranger, the one who becomes their goeL They make us understand the Jesus who has compassion, who casts out demons, who looks with anger. They reveal to us the demons that must be cast out today, what the sin is that today stirs up the Lord's anger, what it is that today negates brotherhood, that kills our brother or sister. It is from the poor we must learn what grace means, grace that is manifested in powerlessness, that makes possible the impossible, that bursts in as pure gift. In short, they keep on making us discover the Gospel in a new dimension. On the other hand, if the poor are the privileged consignees of the good news of the kingdom, that means they must also be privileged in understanding and interpreting what that good news signi-fies. The Gospel is understood through the lens of the poor and from their per-spective. Therefore, it is in them before all else that the Spirit becomes present, From the poor we must learn what grace means, grace that is manifested in powerlessness, that makes possible the impossible, that bursts in as pure gift. and from there the Spirit speaks today to the church. There is a hierarchical magisterium in the church, but it only makes sense if it is rooted in the reality of those poor who make up the church's rank and file. The good shepherd's sheep follow him because "they know his voice" and "he knows his own sheep" (Jn 10:4, 14). The hierarchy of the church of the poor is a hierarchy of service, not of domination. It is a hierarchy that knows its sheep in dia-logue and solidarity, that is ai~tuned to their concrete needs, their sufferings, their longings. Precisely for this reason, because it can hear and understand the people's silent cry, it is able to speak with a language that is recognizable, and in the hierarchy's voice the poor find their life, their cause, their hope, their own voice. The theological reflection of the church of the poor is done from below also, tuning in to 'the awareness and the feelings of the poor. Those poor have had their voice taken away--within the church as well--for so long that they have forgotten how to speak and must learn, to express themselves; but they must increasingly acquire a voice within the church. And that voice must be heard, because in it is revealed the Spirit of Jesus that guides the church. Thus will arise a church where things are considered, struc-at~ dy-./lugust 1992 493 Moreno ¯ Church of tbe Poor tured, and carried out from the perspective of the poor. It is they who say how the institution should function, what new ministries are required for a better service, what ministries and functions they need so that they themselves may be active participants within the church's life. Church on Its Way We must not forget that this church of the poor is also a pil-grim church, a church that must keep forming itself through hard-ship and conflict. I am not referring now to conflict with the powers of the world; I am talking about the world and the sin that are still found within the church itself, about conflict that arises from the church's limitations and from different models of church. The church's unity--that unity for which Jesus died--is eschatological unity, a unity that will come about beyond the church itself as fundamental gift of the kingdom that will burst forth into fullness. The church has a mission to go on building that unity--which is universal brotherhood and sisterhood--by attacking at the root what keeps that unity from being realized. That is not achieved by denying the reality of the conflict, but by facing up to the lack of love and Folidarity that produces it. The mere existence of the poor exposes that lack of love and sol-idarity- which is why there will be protest, conflict, and division as long as there are poor--and it reminds us that salvation, the fullness of God's reign, has not yet arrived. The Religious Life in the Church of the Poor What place do we religious have within this church of the poor that I have just described? The religious life arises as protest against the values and struc-tures of the world. It arises as a search for what is radical in the Gospel, for the "one thing necessary" (Lk 10:42), which tends to be obscured in a church tempted to become worldly, to stop being the distinct event that it ought to be within the world. With its special form of Christian existence, religious life ought to be prophecy that points continually towards the church's true mean-ing and calls on it, not to settle down, but to seek ever to go for-ward. That is the eschatological meaning of the vows, as they show us a beyond that urgesus to transform the present. 494 Review for Religious But what is the natural place for religious life to flourish? Where is the root that makes our life radically evangelical? If what I have said about the church of the poor is true, then there is no doubt that the poor are the place par excellence where the reli-gious life should be located in order to carry out its charism of prophecy. In point of fact, the Spirit is stirring up a notable move-ment among religious towards a real and concrete insertion among the poor. From there the Spirit provides light for a reinterpreta-tion of religious life itself. The religious vows are seen before all else as ,consecration to the Christ who is poor and identified with the poor, as vows that consecrate by freeing us from fixity and exclusiveness so as to form Christians who are available for all and approachable by all, but with an availability and approacha-bility whose universalness is shown precisely in being dedicated by preference to the poor and effectively committed to their cause. It means being detached in order to go where the institution can scarcely reach because of the difficulty and poverty of the condi-tions. Jon Sobrino expresses it very well as a going to the desert, the periphery, the frontier: to the desert, where no one is, where no one wants to go; to the periphery, where everything is seen through the lens of the powerless (not to the center, where the powerful are, where things are seen from above); to the frontier, where risks are greater and the task is harder, where there are no trodden paths because no one has trod them and the walkways are made by walking. What better way to fulfill religious life's prophetic function within the church than to help it read the signs of the times from that insertion into the world and struggle of the poor? What bet-ter way than to point out the new paths that the Spirit of Jesus is having us discover through the poor, in whom that Spirit becomes so specially present? The challenge offered us is, how to bring this about? To what conversion does the Lord call us as religious within the church so that we may help it become increasingly a church of the poor? Notes 1 The Documents of Vatican H (New York: The America Press, 1966), pp. 23-24. 2 The 1968 Latin American bishops' assembly at Medell~n, Colombia. July-August 1992 495 ANNMARIE SANDERS Women Missioners amidst Violence efforts of two insurgency groups, drug lords, and a military that violates more human rights than the groups it seeks to suppress. Through the country more than sixty percent of the people are living in emergency zones, and a great deal of these areas have been placed under military control. Many of the towns have lost their leaders, doctors, teachers, and development workers and even their police. Often only Catholic church workers remain, the great majority of whom are women religious. The situation has called us who serve here to a new way of liv-ing and ministering among the people and to a new spirituality. Following Christ and living Christian values can no longer be done as in the past. The reality in which our spirituality is lived out is now radically different. In speaking with various foreign women missionaries through-out Peru, I see that we struggle with many of the same new chal-lenges, are asking ourselves the same questions, and are recognizing similar patterns in our lives of prayer and relation with God. Our situation is unique because of the state of the country in which we work. The complexity of problems plaguing Annmarie Sanders IHM, a member of her congregation's vocation and formation team, has been in Peru since March 1989, She also works as associate editor of Latinamerica Press/Noticias Aliadas. Her address is Apartado 18-0101 ; Lima, Peru. 496 Review for Religious Peru does not follow any pattern in the history of other nations, and thus we have no precedent to follow. To understand our questions, fears, and challenges, one must better understand the context of the violence we face. Peru's two terrorist groups, the Maoist Sendero Luminoso (Shining Path) and the Tupac Amaru Revolutionary Move-ment, hold as their primary goals the takeover of the country. So far their efforts since 1980 ¯ have resulted in 23,000 deaths, 5,000 disap-pearances and US$18 billion in economic damage. Sendero has declared its willingness to wade through a "river of blood" to expunge foreign influence in Peru and establish a peas-ant society. It rejects competition from the church, the state, and the private sector. The methods of the two groups include bombings, intimidations, blackmail, torture, and ruth-less murder. The terrorist groups are known to be linked with narco-traffic rings, and in return for the security which the terrorists provide coca traffickers, they receive an esti-mated $40 million a year. Although the current government of Although the terrorist problem has been present in the country for over a decade, only recently has the church been directly affected. President Albert Fujimori attempts to control the drug trafficking and terrorist situations, it also battles cholera, endemic corruption, frequent drought, eighty-percent underemployment, and a deep economic depression leaving 13 million of Peru's 22 million inhabitants in extreme poverty, a figure which has doubled in three years. The government must also contend with the Peruvian military and police forces, which, according to the Washington Office on Latin America, are among the worst violators of human rights in the hemisphere. The U.S. State Department's 1990 human-rights report notes "widespread credible reports of summary executions, arbitrary arrests, and torture and rape by the military, as well as less frequent reports of such abuses by the police." The United Nations Commission on Human Rights noted that in 1991, for the fourth consecutive year, Peru had the highest number of disap-pearances of all the countries in the world. Although the terrorist problem has been present in the coun-try for over a decade, only recently has the church been directly affected. Between the church and the terrorists there had existed .~dy-August 1992 497 Sanders ¯ Women Missioners amidst Violence an "understanding." Generally, when terrorists entered to take over a village, if church workers complied with terrorist expecta-tions they were left unharmed. The church work often had to be significantly curtailed,.'but the religious could remain as a presence to the people. The recent direct destruction of church projects and prop-erty; the deaths of Irene McCormack, an Australian Sister of St. Joseph, in Junin in May 1991 and of Zbigniew Strzalkowski and Michael Tomaszek, Polish Franciscan priests, and Alessandro Dordi Negroni, an Italian priest, in Chimbote in August 1991; and the attempted assassination in July 1991 in Chimbote of Miguel Company, a priest from Spain, changed the scene signif-icantly. More religious encountered terrorist demands that their works--especially food aid and development projects--be stopped, and many received direct threats on their lives. Rather suddenly priests and religious became direct terrorist targets. Sendero Luminoso proclaimed that the church was the enemy of the peo-ple and an obstacle to revolutionary triumph. As the Rev. Robert Gloisten, a U.S. missioner and a staff member of the Peruvian Episcopal Conference for Social Action, stated, "We have become a church under fire with no idea of what will happen day to day." For several years, denial of the serious-ness of the situation was possible. Life was carried on with a vague knowledge that terrorists were active in a few isolated areas; as long as their activity did not directly touch us, we could continue peacefully. Those days are past. ~ The level of awareness and acceptance of the reality of this sit-uation naturally differs for each person. Much depends on one's personal experiences. For example, Pittsburgh Sister of Mercy Rita Harasiuk, who works in the diocese of Chimbote, was jolted by the death of her three colleagues into a new view of the situation: Although I began seeing things differently with the attempted assassination of Miguel Company, it was really the deaths of the two Franciscans that affected me the most. The two, along with two mayors from nearby towns who were also killed, were laid out together in coffins--all open-- and one worse than the other. For some of us, it was the first time we had seen what a human body looked like after having been shot in the head with weapons designed to destroy and mutilate . When Sandro [Alessandro Dordi] was killed two weeks later, we could see that more killing might go on. That's when we really began to strug-gle with what our response to this situation should be. 498 Review for Religious For California native Teresa Avalos of the Sisters of St. Joseph of Carondelet, an incident directly involving her community played a significant role in making the situation more real for her and her sisters. In July 1991 a group of Sendero Luminoso ter-rorists entered Moho, where five of her community members lived and worked. They dynamited several buildings, executed six people, and ordered the townspeople to break into and ransack the convent. "This brought the fear of violence that is directed toward us much more into the open," Avalos said. Others of us have grown in our acceptance of the seriousness of the situation from our hearing such accounts by our colleagues. We stand in solidarity with them, aware that the problem is no longer isolated. An important task most of us have faced has been the admission of our feelings in the midst of such turmoil. Fear, nat-urally, is among the most common emotions, and, unfortunately, sometimes very difficult to accept and share with others. "We are all at different stages of being able to accept the real-ity, and some are still in a stage of denial," said California native Liane Delsuc of the Sisters of Notre Dame de Namur. "This leaves me often feeling alone and sometimes I don't want to share my fears because others don't feel them. I start to think--is it only me that feels this way? Does that mean I should leave? That I am not able to handle it? But I do not feel that is the case. So I look for people with whom I can more freely share because in sharing it I feel stronger and as if I can continue living this." The sharing has helped us understand the wide range of emo-tions we feel. "Reflecting with others enables me to sift through real fears and imaginary ones," said Pauline Maheux, an Edmonton, Canada, native of the Ursuline Sisters of the Chatham Union; "in sharing we help one another admit to our fears and face them." The emotions one feels get mixed up when one watches the sense-less killing and destruction of years of work. Feelings include shock and anger. Often what is hardest for us to accept is the distrust we now feel towards others since we know that we must be aware of terrorist infiltration into our parishes and workplaces. An important task most of us have faced has been the admission of our feelings in the midst of such turmoil. July-August 1992 499 Sanders ¯ Women Missioners amidst Violence Harasiuk received a shocking revelation of this after the funeral for the slain Franciscans. At the offertory two gifts were quietly brought in procession to the altar: the rope used to tie the hands of those killed and the blood-covered cardboard left on their bodies with messages from the assassins. "We later dis-covered that among the young people bringing the gifts to the altar were persons who belonged to Sendero." Our situation naturally causes us to reflect on death--that which we see around us as well as our own. "I think much more about the possibility of my own death," said French native Anna Ingett of the Sisters of Christian Education; "not that I think death will come in the next few days,,but I am more conscious of its nearness." Given this stark reality, we are constantly asking ourselves on personal, communal, local, diocesan, and national levels: How do we deal with this personally and how are we to respond as church workers? One of the greatest challenges we face is receiving accu-rate information about what is happening in the country. The media in Peru are severely restricted and often rely on third-party sources; great doubts remain. Although organizations such as the Religious Conference of Peru work hard to gather facts, the dis-semination of information is very difficult, given the lack many religious have of telephones and reliable mail service. Many reli-gious, however, felt aided by the Religious Conference's meet-ings and workshops on violence and also by programs dealing with situations and problems in the various dioceses. What seems most useful to us are open, honest dialogues with our community members and other religious working in our areas. Many of us have listened to the facts, tried to process our feelings, and then asked ourselves some hard questions: How much more of this can I take? Will I leave if one more religious or priest is killed? Can I live with this tension? Can I remain a sign of hope in what looks like an apparently hopeless situation? Once some sense of peace was reached about our presence here, we began reexamining why we are staying. Many of us, espe-cially those working the emergency zones, began looking at our work with very different eyes. "After the deaths here, most of us slowed down and started thinking, evaluating, praying, and talk-ing together about why we are here and what we should be doing," said Harasiuk, who has been working for ten years as a pastoral team member in Chimbote. She recalls a meeting of priests and 500 Revlew for Religious sisters where someone asked, "Do you think you should continue working as you have been?" Not one person said yes. Many pastoral workers have reduced their work to simple presence in their parishes. They no longer lead groups, distribute food and aid, or attempt to organize the people. They maintain a low profile and lead quiet lives of simple accompaniment. For Delsuc, who is principal in a Lima barrio of a Fe and Alegrfa School, one of forty-three institutes set up by the Jesuits to educate young people in Lima's shantytowns and in the provinces, the questions about work are many: "I wonder if we are presenting relevant, peaceful alterna-tives that will allow the people to respond with Christian values to the violence around them? I wonder if it would'be better not to be involved in a certain work and just live alongside the people? I wonder if our commit-ment to the people is valuable even if it brings death?" Many of our ques-tions must be left unanswered. But we recognize that simply by asking them we have allowed our lives to be changed. For many of us, before we could accept the change the situ-ation calls us to, we had to let go of the past. Harasiuk says that this was a common experience for the religious in Chimbote after the deaths. "Our grieving process was not just for persons, but for a whole way of life that is passing. This situation has taken away from us a freedo~n to move day and night without fear, to speak openly without worrying about what we say or to who~n we are talking." For Harasiuk this experience also helped her to evaluate her life and her activity and to decide what really matters. "So many of the things I had been involved in suddenly did not seem so important." Maheux, who has served as a pastoral worker for eight years in Chiclayo, had a similar experience. "The situation has enabled me to sift through what is of essence and what is truly insignifi-cant. Relationships have taken on profound meaning . . . to be nourished and cherished." The change in relationships extends for most of us also to I wonder if we are presenting relevant, peaceful alternatives that will allow the people to respond with Christian values to the violence around them ? j~t~-Aug'u~ 1992 501 Sanders ¯ Women Missioners amidst Violence our relation with God. Many have noted that prayer is more dif-ficult, little ecstasy is experienced, much more anger is expressed, fewer words are used, and often God becomes the scapegoat for all of Peru's problems. Christ, for many of us, reveals himself in new ways in Scripture. "I experience Christ more in his passion, where he ends up in the midst of violence, mistreatment, and ridicule but stands strong to his values and commitments," said Delsuc. Many seek a sense of consolation in their relation with God--an assurance that they are loved and that God is still in control. Many, feeling lost in the confusion of these times, turn to God as a source of wisdom. For Lia Finnerty, a Canadian Holy Cross sister working in Juli, prayer is now more integrally connected with what is hap-pening in the news and in her village. "My prayer is the time when I can try to integrate our reality with God's word and see how our community is touched by all that." That need to connect our prayer with the wider community and to pray with others is co,ninon among us. Many note that the desire for communal peti-tionary prayer is much stronger and that it is a helpful experi-ence to bring to God each day all that we see and experience each day. Ingett, who serves on a pastoral team in Sicuani, notes that her community's time of petitionary prayer is also a time for asking pardon for all that these women experience in their daily inter-action with the people. Living in the midst of so much violence and structural injustice has clearly revealed to many of us the anger and violence present within ourselves. "Sometimes it's so hard to hear that the police have attacked innocent victims or tortured young people," admitted Finnerty. "My first reaction is often a violent one, even though I want to be nonviolent." We all seem to struggle with the anger we feel and our desire to be compassionate, and we ask ourselves many questions about how we can be more nonviolent people. We are trying different approaches. Massachusetts native Carmen Foley, a Halifax Sister of Charity serving as a spiritual director in Lima, is looking at her interactions with others and her judgments and is trying to be more merciful in her attitudes. Avalos, a pastoral worker in a Lima barrio and formhr.vice-provincial of her congregation, is look-ing at violence in her speech and her reactions. Finnerty, a pastoral worker among the Aymara people, is returning to the Aymaran value of solidarity and community as a block to violence. Delsuc 502 Review for Religious is practicing communication techniques to become more skilled in conflict resolution. Probably most important for all of us, however, is an openness to learn from the Peruvian people, who seem to know better than any of us just what hope in the midst of crisis is all about. As Maheux concluded, "My greatest source of hope for the future is the women, men, and children with whom I live. Their faith-fulness to the daily struggle to just live--to being able to eat, to the one-day-at-a-time facing of tremendous obstacles--teaches me that justice, peace, and life will endure and win out." Coming Out one shall know as dawn disentangles morning from night if one's desert spell was purgation or vacation was awakening or escape when one emerges anointed in power or scorched and spent Andrea Wild OSF July-August 1992 503 ROY BOURGEOIS School of Terror write from the Federal prison in Tallahassee, Florida, where am serving a sixteen-month sentence for an act of civil dis-obedience to protest the training of Salvadoran soldiers on United States soil. As I look back, I feel my being here is no accident, but rather the result of God's grace at work in my life. Growing up in rural Louisiana, I was a Sunday Christian and gave little thought to issues of peace and justice. I studied geology in college with the hope of getting rich in the oil fields of South America. After college I became a naval officer and volunteered for duty in Vietnam, feeling it was. my patriotic duty to fight communism. There I met a missionary who, amid the war, gave me a vision of Jesus as a healer and peacemaker. I left Vietnam wanting to be a missionary and entered Maryknoll, whose work is in twenty-eight countries overseas and in the United States. I was ordained in 1972 and went to serve the poor of Bolivia. A slum on the outskirts of La Paz became my home for six years. In Bolivia, as in Vietnam, the poor became my teachers and challenged me to grow in my faith. I then returned to do educational work in the United States. My involvement with E1 Salvador began in 1980, after Archbishop Oscar Romero was gunned down at the altar and after four church women from the United States were raped and killed by Salvadoran soldiers. Two of the women, Maryknoll sisters Maura Clarke and Ita Ford, were friends of mine. Their death forced me to confront what was happening in this small Central American country. Roy Bourgeois MM writes that prison can be a good place to read Scripture, pray, and do ministry. His address is Register No. 01579-017; PMB 1000; Tallahassee, Florida 32301. 504 Review for Religious After several trips to E1 Salvador, it became clear that the problem was not "communism" or "subversion" but hunger. As is the case almost everywhere in Latin America, the wealth, power, and land of E1 Salvador are in the hands of an elite few. While these live in huge mansions where they are waited on by servants and enjoy frequent vacations and shopping sprees in the United States and Europe, most Salvadorans live in dehumanizing pover.ty and die before their time. The poor, once told that their suffering was the will of God, now know better as they gather in small groups to read and reflect on the word of God. They now real-ize that their poverty and suffering are the result of exploitation, greed, and irresponsible stew-ardship of God's creation. In May 1983, five hundred Salvadoran sol-diers arrived at Fort Benning, Georgia, to undergo U.S. Army training. At the time, I was speaking at churches and colleges in New Orleans about the injustice of U.S. military aid to E1 Salvador. I felt it was no time for business as usual, so I went to Columbus, Georgia, the home of Fort Benning, and began meeting with local residents. After two months of meet-ings, talks, and prayer vigils, three of us decided to enter Fort Benning at night, dressed as U.S. Army officers. Armed with a.high-powered cassette player, we climbed a tall pine tree near the barracks that housed the Salvadoran soldiers. At lights out, we tuned the cassette player to its highest volume and played Archbishop Romero's last homily, given in the cathedral the day before he was assassinated; in it he called on the military to stop the killing and lay down their arms. We were arrested, tried for criminal trespass ~and impersonating military officers, and sen-tenced to eighteen months' imprisonment. After serving my term I sought a few months of silence and solitude at. a Trappist monastery, then returned to the pulpit and classroom. On 16 November 1989 six Jesuit priests, their coworker, and her fifteen-year-old daughter were brutally murdered in E1 Salvador. According to a U.S. Congressional task force sent to El Salvador to investigate the massacre, five of the nine soldiers arrested for the slayings had been trained at Fort Benning. Today, hundreds of Salvadoran and other Latin American soldiers are being trained at Fort Benning's School of the Americas. The The problem was not "communism" or "subversion" bu t hunger. .y~dy-August 1992 505 Bourgeois ¯ Scbool of Terror School of the Americas (SOA) was located in Panama before mov-ing to Benning in 1984. Since 1946 this training ground for Latin American soldiers has quietly readied some 45,000 officers and enlisted men for right-wing Latin American governments. Manuel Noriega is a distinguished alumnus, as is General Hugo Banzer of Bolivia. In 1984, when the SOA was forced out of Panama, then Panamanian president Jorge Illueja described the school as "the biggest base of destabilization in Latin America." The foundation of the course work at the School of the Americas is low-intensity conflict (LIC), which, by military ana-lyst Michael Klare's definition, is "that amount of murder, muti-lation, torture, rape, and savagery that is sustainable without triggering widespread public disapproval at home." Students of LIC learn that the enemy is not just an opposing armed force; rather, the enemy can include anyone, armed or unarmed, who threatens the stability of the existing order. Hence, priests, teach-ers, health-care workers, union leaders, cooperative members, and human-rights advocates are among the victims of the School of the Americas. On 3 September 1990, ten of us--Vietnam veterans, Salva-dorans, a teacher, and members of the clergy--began a water-only fast at the entrance of Fort Benning to protest the training of' Salvadoran soldiers. When our fast ended after thirty-five days, our bodies were weak but our spirits remained strong. Miguel Cruz, a Salvadoran in our group who had been forced to leave his country because of a death threat, said, "We have the option to end our fast. However, the poor in my country do not. For them hunger is an everyday occurrence." On November 16, when we had recovered from the fast, three of us--Charles Liteky, a former army chaplain who had received the Medal of Honor for heroism in Vietnam; his brother Patrick, who had trained at Fort Benning's Infantry School, and I-- returned to Fort Benning to observe the first anniversary of the killing of the six Jesuits and the two women. After a prayer service, we entered the post, placed a white cross with photos of the eight martyrs at the entrance to the School of the Americas, and poured blood in one of the school's main halls. We wanted to impress on our country that we cannot wash our hands of the blood of inno-cent people killed in E1 Salvador by soldiers trained in the United States. We were arrested and tried. A jury found us guilty of dam- '506 Review for Religious aging government property. The Liteky brothers received six-month sentences, and I received sixteen months because of my previous conviction at Fort Benning in 1983. "Was it worth it?" I am often asked by friends and critics alike. Prison is hard and very lonely at times, even with the support of family and friends, who also suffer. My dad cried when I called home to tell him of my sentenc-ing. Yet I feel I did what my faith and the poor called me to do in the face of such violence, death, and suffering. As a Christian I feel I must try to relieve the suffering of the poor and integrate my faith in a loving God with action. It is indeed tragic what our silence did to the people of E1 Salvador over the past twelve years as our po!iticians fun-neled billions of dollars (hard-earned tax money) to a military regime that killed thousands of innocent people. ~ The recent peace accords in E1 Salvador now bring new hope, and it is a time for rebuilding after all the death and destruction. It is also a time for the hundreds of Salvadoran soldiers who continue their training at Fort Benning to go home--along with the troops from Guatemala, Honduras, Venezuela, Peru, Chile, Colombia, Bolivia, and other Latin American countries. I am convinced that we can relieve some of the suffering of the poor in Latin America by closing down the School of the Americas. It is a school of terror and should be shut down. While I am in prison, friends in Georgi~ are carrying on the peace-and-justice work. To learn more about our efforts, write to School of the Americas Watch; P.O. Box 3330; Columbus, Georgia 31903. Archbishop Romero said, "We who have a voice must speak for the voiceless." I pray and hope that we will speak clearly and boldly. As a Christian I feel I must try to relieve the suffering of the poor and integrate my faith in a loving God with action. j~dy-August 1992 507 M. GERARD NWAGWU Women Religious and the African Synod inculturating Following the initial enthusiasm with which our people welcomed Pope John Paul II's announcement of a special assembly for Africa of the Synod of Bishops,l an accom-modating attitude of tolerance for whatever might result from the event seems to have settled in. In such a frame of mind, any document coming from the synod will proba-bly be treated like any other Vatican document---it will be gratefully accepted and respectfully mentioned, but lit-tle else will follow. If, however, the document were to grow out of our experiences and be developed from our contributions, then its contents would have a better chance of being well received and more fully observed. The introductory chapter to the Lineamenta2 speaks of the period of preparation and celebration of the synod as the "tempus acceptabile," the favorable hour, the hour of Africa. This is the hour we have all waited for. It offers us a unique opportunity to bring about some of the changes and modifications religious life in Africa needs. It is a time for religious women in Africa to state our vision of commitment and involvement. This favorable hour con-tinues until the synod is actually celebrated and concluded, As part of this process it is important for us to raise issues and speak out about the problems that women religious encounter as they try to contribute to the work of evan-gelization in Africa. Indeed, for Africans this synod truly M. Gerard Nwagwu does much of her teaching at the Catholic Institute of West Africa; P.O. Box 499; Port Harcourt, Nigeria. 508 Review for Religious promises to be a "third Vatican Council" in what it could accom-plish for us. Consequently the initial period of intense preparation needs to be followed by a continued interest in the synod that fosters a receptive disposition of willingness to adopt its directives. The next generation of religious is likely to question how we made use of this opportunity, criticizing chances wasted and applauding those utilized. The older generation in their turn will be less critical insofar as they have never experienced such an event during their active days and therefore cannot be blamed for not effecting changes. Our contemporaries themselves could point accusing fingers at us if, for all our ideals and foresight, we achie~ced nothing when the circumstances were most opportune. Accepting facts as they are can be a mark of virtue on occa-sion. However, if we were to do that in the present situation, it would indicate complacency and inertia exactly when the action of working toward objectives that will benefit our people is demanded of us. Accepting the status quo just when the church calls us to make a move could indicate a cowardice and portray a fear of "launching out into the deep waters and laying out the nets for a catch," as Christ challenged the Apostles to do at a point when all hope seemed lost.3 We need an openness among ourselves to help us discover our weaknesses, our duties, and our obligations of evangelization--duties that the Code of Canon Law itself demands of religious in canons 211 and 758. Aware of these challenges, we can begin searching for an effective strategy. The Lineamenta presents a good number and variety of themes for our consideration. In any of these themes, the African reli-gious woman-has a role to play, not simply because she is an African or works in Africa, but because her religious life is directly intertwined with the life of the church. Vatican II witnessed to the fact that at no time in history has the church lacked some form of religious life.4 Religious life, in other words, is a con-stant and inseparable feature of the church. This universally his-toric fact is no different on African soil. However, it would take us too far afield to dwell on all of'the proposed themes as they relate to women religious in general. Rather let us consider those that focus strictly on the life of women religious in Africa, their apostolates, and their relationship with the world around them. Presently, most of the countries in Africa have celebrated the centenary of the arrival of the early Catholic missionaries. The few July-August 1992 509 Nwag-wu ¯ Women Religious and the African Synod who have not will do so in the near future. Mmost everywhere the native indigenous clergy have assumed the direction of the particular churches, on both the diocesan and parish levels. Unfortunately the same cannot be said for all congregations of religious women in Africa.5 These factors and others highlight the growth of the church in Africa. Specifically, religious institutes are not left behind in the development. The momentous rise in the number of vocations to the religious life, especially in women's congregations, attests to this growth. Indeed the problem for many religious commu-nities is not so much trying to attract candidates but finding ways of adequately training and forming them in the spiritual and apos-tolic life. It is no wonder that foreign religious institutes endeavor to recruit girls from Africa to fill up their depleted ranks. Such recruiting, however, has been limited and conditioned by the authorities since it has often left a trail of disillusioned women who believed they were sent abroad for further studies, only to find that they were meant to supply domestic services. Though the road remains open for taking candidates abroad, yet some condi-tions must be fulfilled.6 The obvious growth of the church in Africa is one of the "signs of the times" that determine the form evangelization should assume in our midst. The evangelization that starts first with inte-rior conversion of hearts, matures to a personal witness of life, and finally develops into external commitments and service is the type that best suits the vocation of religious women. Before evan-gelizing others we must evangelize ourselves, for only after we have been converted can we support those around us.7 We shall be witnesses, yes, but only after an interior transformation of heart. Through such an authentic witness of the life of the evan-gelical counsels, we can make our own contribution to the new stage of evangelization required in Africa. With regard to reli-gious life, this first stage of evangelization involVes modeling to our people the values of total dedication and consecration to God with a hope of evoking a corresponding response from young women and men to embrace religious life. The second stage of renewed evangelization which suits our time is that of deepen-ing the faith of those who already believe and are baptized, We are already experiencing an influx of vocations, but how deep is their faith, how reliable is their commitment? Religious women, particularly, must ask probing questions, 510 Review for Religious admit the facts, and make worthwhile proposals. The point at issue is whether we realize that the effective contribution of women religious in the evangelization of Africa depends first on the genuine and generous commitments of our communities and second on the spiritual and apostolic formation we give our younger members. The vitality of religious life in Africa depends on these elements and on its being a true witness of the presence and love of God among our people. Such an objective compels us to examine some of the negative currents that undermine our abil-ity to evangelize our people in the manner referred to above. Primary among the negative currents is the wind of secularism that has blown through the world from the 1980s to the present day and has begun to register its presence in Africa. Some see it as materialism, others as atheistic humanism. Secularism, as Pope Paul VI has pointed out, views the world as entirely self-explanatory without any reference to God, who thus becomes unnecessary and is, as it were, an embarrassment. Secularism of this kind seeks to assert the power of humankind and leads to a situation in which God is ignored and denied.8 An allied expression is secularization. Where secularism is a theory and an ideology leading to denial of God, secularization is, instead, the fact and reality of experiencing life with a secular-ized mentality and attitude--that is, evaluating life from a worldly point of view. This, then, is the new form of atheism by which God is perceived to be less present, less necessary, less capable of providing a valid explanation of personal or social life experi-ences. In its undiluted form, secularization should not find a stronghold in Africa, given the characteristic spiritual vision of life within an African society wherein the divine permeates all aspects of life. However, what has invaded this sense of the sacred is the aftermath of secularization, revealed in such characteristics as superficiality, the desire for power and domination over others, autonomy and individualism, and a pleasure-loving orientation. Within our religious circles, when we lack an original experience of God and consequently fail to lead others to a similar experience, the evangelical counsels are confused or glossed over in various attempts to describe, them. We shall be witnesses only after an interior transformation of heart. j-~uly-August 1992 511 Nwag~u ¯ Women Religious and the African Synod Poverty is explained away in the tendency to acquire and accu-mulate in the name of the congregation; chastity in the necessity of having the comfort, convenience, and satisfaction of personal fulfillment; obedience in the assertion of autonomy and individ-uality as marks of our uniqueness and originality. In the maze of such ambiguity, the question for religious women to answer is whether at the present stage of their religious experience they can lay claim to preserving in full the religious sense and charac-ter of their consecration. Where secularization has made its mark, it is difficult to be a witness of the Gospel message. Secularism holds out to us the values of the world and urges us to conform; the Gospel offers us the mind and values of Christ. If we examine our situation and find out that our choices are secular in character, it is important for us to admit it, and so be able to discover what strategy to adopt con-cerning it. The type of choices we make and the attitudes we have clearly show whether we are evangelized at heart or not. On a secondary level the way we treat each other and the interpersonal regard we nurture in our communities would truly show if the Gospel values were operating among us. For when we continue to make discriminatory preferences between persons or congregations, then our witnessing cannot be anything but counterproductive to the task of evangelization. When we are carrying out a common objective, what should matter is the appre-ciation of a sister as a religious and the virtues she possesses for her to be entrusted with an undertaking which she will accomplish in the name of all, not whether she is a member of one congre-gation rather than another, or whether she has occupied a position of importance in her institute, or whether she has important con-nections, and so forth. Evangelizing witness on the community level is likely to be rendered nugatory as ~vell if, instead of the communion and unity which religious life signifies, we have the division and disunity of uncoordinated activity. The difficulties occasioned by lack of cooperation and coordination are most often seen between dif-ferent congregations rather than between members of the same institute. How often have we witnessed the complaints and dis-enchantment of institutes whose services are unceremoniously terminated in a place in favor of another institute--especially when the institute that takes up the apostolate in question may be completely ignorant of how the first institute left the scene! Such 512 Review for Religious a practice is exploitive and appears to be based on the availability of women religious. Apart from the circumstance related above in which two con-gregations of religious women are made to be victims at the same time, division of opinion among institutes is certainly a question that needs to be considered if the challenges of our times are to be adequately addressed. The church regards women religious as experts in communion both because of the communitarian quality of our consecration and because of our natural tendency to bond ourselves closely to oth-ers. Our best field of operation, therefore, is to work for unity and communion within our African church in all its various components. Women have a great capacity for personal adaptation in the face of the varied and often unexpected needs of the real life of societies and churches. We are thus often in a better position to ensure not merely the survival but even the development of evangelization.9 A determination to form deeper and stronger bonds of solidarity and sharing between our various institutes is the best way to confront the changing political, economic, and social conditions of our times. Such operative and meaningful solidarity will happen if various congregations are able to evolve while each institute retains its unique identity and character. As Pope Paul VI told us,'° we are missionaries to ourselves at this stage of the evangelization of Africa. We Africans are cat-echizing and witnessing t6 our own people in our home missions. We are also undertaking the evangelization of other African coun-tries outside our homeland--not overlooking, of course, the invaluable assistance offered by our foreign missionaries. Taking into account the greater number of women .religious, these foreign missions are mostly operated by religious sisters. We must ask ourselves, therefore, whether there exists a corresponding mis-sionary cooperation between the various religious congregations whose members labor on these foreign missions, or whether mis-sionaries carry along with them to the missions the lack of coop-eration and perhaps rivalry which possibly exists at home. We need to remember the call of John Paul II as he spoke about the problems facing evangelization in Africa: secularization has made its mark, it is difficult to be a witness of the Gospel message. July-August 1992 513 Nwagcvu ¯ Women Religious and the African Synod Let all form one unity. Let everything be done to smooth and multiply the ways of mutual esteem, of fraternity, of collaboration. May anything that might be the cause of suf-ferings or casting aside, for one group or another, be ban-ished! May all be penetrated with sentiments of humility and of mutual service! For Christ! For the witness of the church! For the progress of evangelization!'~ With a unified front, we religious could more easily discover new approaches to problems that arise in the apostolate. These problems include the challenge of Islam and the determination of Muslims to spread the Koran from coast to coast by whatever means available. Carrying arms and matching violence with vio-lence is definitely not what the church expects religious women to accomplish in this regard. Neither is it possible to close our eyes and imagine that the friction and conflict with Muslims will even-tually ease off while we do nothing. We must, however, evaluate our strength and discover unobtrusive ways to reduce the threat of Islam for our people. In the face of such an offensive, the church has in the past usually adopted the practice of intensified prayer and a rigorous asceticism lived with generous hearts. Some apostolic religious institutes were founded to labor in countries of Islamic faith. But there are relatively few, if any, contemplative orders founded exclusively for the propagation of faith among Muslims. Such contemplative orders, which by their i~rayers, works of penance, and sacrifices labor to effect the conversion of souls, are crucial for the growth of Christian faith amidst the increased onslaught of Islamic hostility. It would be a welcome endeavor if the tendency our religious folk have to found new religious institutes is allowed to mature into communities that will pitch their tents among the Muslims of our country despite foreseeable opposition and even death. If such an inspiration of the Spirit were to happen, it would cer-tainly respond to the needs of the times. The challenge of Islam requires a radical religious decision. It calls for active institutes to reawaken their consciousness of the value and practice of the con-templative dimension of religious life. The Sacred Congregation for Religious and Secular Institutes exhorts: The contemplative dimension is the real secret of renewal for every religious life. Being a reality of grace, it preserves in the religious the commitment to bear witness before the world to the primacy of a personal relationship with God. They can thus avoid the constant danger for apostolic work- 514 Review for Religious ers who often become so much involved in their work for the Lord as to forget the Lord ofalI work,~z Another area of concern is the proliferation of sects and evan-gelical movements. The increase in their adherents means that some other churches--the traditional Christian churches includ-ing the Catholic Church--are losing members. The sects usually direct their proselytizing toward those who are already Christians and offer them what they apparently cannot get from their mother churches. Again Paul VI sounded the alarm when he noted: It is well known that in some places the church in Africa runs the risk of the fidelity of its sons and daughters being subjected to dangers and struggles, and to being tempted by false teaching. Indeed, Christian faith must become some-thing interior like a personal possession of each individ-ual.' 3 In the face of such phenomena, congregations of women reli-gious can be of immense help to the church if they include this ground among their fields of apostolate for the second stage of evangelizing Africa. By identifying the reasons Christians are attracted to these sects and the group of Catholics that are easily influenced by them, they can develop a strategy for deepening the faith of those most affected. Often a shallow faith, which offers no reply to the vital questions of suffering and pain, poverty and misery, doubts and fears, insecurity and emptiness, sickness and death and so forth, is quickly abandoned for what seems a better way out of problems. Such defections occur where people seek a church that'proffers some human warmth and mutual con-cern, an experience the larger churches cannot easily provide.'4 Even if religious themselves do not minister directly to the sects and their adherents, they can train the Christian laity to assume their role of searching out and reevangelizing their brethren. Similarly, it is important to examine the variety of means of social communications available in order to determine the ones best suited for evangelization in Africa today. Every institute is able to evaluate the effect of each of the means on individual members and on the community. For while it is necessary to know what the world around us is saying through the media, we must not allow it to monopolize our attention and dictate our conver-sational exchanges. Growth in religious commitment does not follow from an indiscriminate and sometimes imprudent use of the mass media, or with the exaggerated and extroverted activism the 3~uly-August 1992 515 Nwag-wu ¯ Women Religious and the African Synod media can generate, or with an atmosphere of dissipation which contradicts the deepest expectations of religious life. The search for intimacy with God needs silence, never involving noise and confusion.~s Presently, however, our discussion on the media is not how much we adopt them in our communities, but how well we use them for evangelization. Since the various means are each an effi-cacious tool for communication, the message of faith can be divulged to millions of our people at the same time with their aid. What prevents us, for example, from publishing a magazine that focuses on African religious life? Other Christian groups take the lead in the use of media while Catholics lag behind. Sacred songs and music on the thousands of audiocassettes that flood the market are ahnost always produced by Protestant evangelical groups. In the past there used to be a festival of the arts for Catholic schools. Now the competitions organized for parish choirs do not seem to generate the same interest. When an institute chooses to engage some of its members in apostolates using more contemporary methodologies, the initial difficulty will be lack of trained personnel. Requisite educational competence is important; however, some religious superiors are reluctant to send sisters for further studies that take time to com-plete and cause financial constraint, especially in the face of past disappointments. All the same, such reservation should give way before the conditions of our times and the needs of the church, which demand specialized training in some fields of study. No field of study can be superfluous if it furthers the mission of the institute. And since evangelization is a common mission for all, then adequate preparation is necessary for its realization. We cannot meet our contemporaries handicapped. For priests and religious to grow in requisite skills and maturity, it is essen-tial for them to receive the type of formation usually done in cen-ters of study at the university level or in institutes of higher studies. Specialized studies undertaken by religious should be prompted not by a misdirected desire for self-fulfillment with a view to achieving personal ends, but with the sole intention of meeting the apostolic commitments of the religious family itself in the context of the needs of the church.16 In view of the renewed call to evangelize, some significant changes may have to be made in the initial stages of formation. This sensitive area touches the autonomy and identity of insti- 516 Review for Religious tutes. Nevertheless, some general criteria may be adopted on the intercongregational level while the exact details can be left to the creativity of each institute. A rereading of the conciliar guide-lines for renewal shows that there is no question of simple adap-tations of certain external forms such as the habit. There is question, rather, of a deep edu-cation in attitude and in lifestyle that makes it possible to remain true to oneself even in the new forms of being present--a presence as con-secrated persons who seek the full conversion of people and of society to the ways of the Gospel through personal witness and service.~7 The challenges presented to religious women by the forthcoming synod will demand prayer, discipline, and sacrifice. It will not be easy to effect changes because part of the pattern of life and action we have grown used to will have to be renounced. Though renun-ciation may be spiritually rewarding, it is never gratifying to the ego. All the same, the changes need be made. The "signs of the times" are ripe and they offer us incentives to renew and revise our pattern of life and to give a preferential treatment to the duty of evangelization. The traditional ministries carried out in hospi-tals, schools, and social centers remain important, but their rel-evance in meeting the people of our times and engaging them in faith encounters has diminished. Women religious who are solidly founded in faith and suffi-ciently prepared and who can use their feminine qualities of devo-tion, refinement, faithfulness, and patience and their great capacity to adapt to the unexpected demands of real life can transform sit-uations which would intimidate others who lacked the weapons of faith and culture. In conclusion, let us remember the call of John Paul II and our obligation to respond to his invitation: We cannot meet our contemporaries handicapped. You have lived a first great stage, an irreversible stage. A new stage is open to you. It is no less an exalted one, even if it necessarily involves new trials, and perhaps the temp-tation of discouragement. It is the stage of perseverance, in which it is necessary to pursue the strengthening of the faith, the conversion in depth of souls and ways of life, so that they will correspond better and better to your sublime Christian vocation.18 July-August 1992 517 Nwag-wu ¯ Women Religious and the African Synod Notes i The exact date for the synod has not been set, but observers do not expect it to take place before 1994 or 1993 at the earliest. ~" Lineamenta, General Secretariat of the Synod of Bishops, Vatican City, 1990. 3 Luke 5:4. 4 Lumen Gentium §44. s Some congregations of women religious still have nonindigenous administrative personnel. 6 This includes the establishment of a local community in the area, which in turn requires.that a diocesan bishop invite the institute in ques-tion to his diocese. 7 Luke 22:32. 8 Paul VI, Evangelii Nuntiandi, §55. 9 Sacred Congregation for the Evangelization of Peoples, Dans le Cadre, The Role of Women in Evangelization, in Vatican Council H Postconciliar Documents, vol. 2, p. 322. l0 Paul VI, Inaugural Session of SECAM, Kampala, 1969. llJohn Paul II, Address to Zairean Bishops 3 May 1980, in Origins 10, no. 1, p. 6. 12 SCRIS, La Plenaria, The Contemplative Dimension of Religious Life, January 1980, §§ 2, 4, and 30. 13 Paul VI, Address at the 4th Plenary Assembly of SECAM, September 1975. 14 Paul V-I, Evangelii Nuntiandi, §58. is SCRIS, La Plenaria, §14. 16 SCRIS, Mutuae Relationes, §31 and §26. ~7 SCRIS, La Scelte Evangeliche, On Religious and Human Development, January 1981, §32. is John Paul II, Address to Priests and Religious, Zaire, 1980. 518 Review for Religious JENNIFER MARY ALT Rerooting Religi ous Life in South Africa the dialogue has been to develop a religious-life spirituality that would be less foreign and more of a special flowering and inter-pretation of African human and spiritual values. These values encompass all of human life. The spiritual is never seen as apart from the material, and people are seen as depending on other people, and therefore on the Divine, for life and meaning. Outside of their social relationships, individuals are less than nothing. If religious life became better integrated with native African spiri-tual values, it would witness more clearly and bring greater hope to South Africa's strife-torn people. Religious life is not foreign to Africa. In fact, its cradle is to be found in North Africa in the early centuries of Christianity. Organized religious life took its conception from the life and work of the Desert Fathers and was rooted in the form of Christianity found among the rural tribal people of North Africa. This rural tribal Christian expression was eventually declared heretical and has since been known as the Donatist heresy.- St. Augustine, the well-known urban African, a man cut off from his Jennifer Mary Alt OP, a member of the Cabra Dominican Sisters, is director of the Catholic Centre for Spiritual Growth sponsored by the Southern African Catholic Bishops Conference. With her doctoral research in cross-cultural personality studies, she has worked with religious in developing an African religious spirituality. She may be addressed at the Catholic Centre for Human and Spiritual Growth; P.O. Box 53 505; Troyeville (JHB); 2139 South Africa. ~uly-August 1992 519 Alt . .Re~roo~ng Religious Life cultural roots, was chiefly responsible for the suppression of the Donatists. Early North African Christianity was predominantly rural. These rural Christians had been formed by their own primal reli-gion. This religion revolved around being in harmony with the spiritual in life. The Ancestors--important good people who had died and who then lived on in spirit in the living--were seen as important mediators of the spiritual. Life among humans was seen as essentially social, and people got their meaning and pur-pose from living and working in harmony with other people. To be in a group was part of life. Over fifteen hundred years separate us from these earlier times, and Africa south of the Sahara is in a different position today. Yet it too moves from a very strong primal religious back-ground. In parts of Africa, for instance South Africa, much of the primal past has disappeared, but the beauty of its spirit remains. Unless one pays attention to it, one will find it difficult to under-stand the modern movements in religious life in Africa. A primal outlook on life in terms of human values is'a profound way of looking at it. The work of the Divine is easily seen in it. The connectedness between this outlook and the teachings of Jesus is easy to recognize. Unfortunately, modern religious life has been presented in Africa south of the Sahara as something foreign and Western, as something that has nothing to do with African values. In fact, African values had to be somehow discarded as one entered a reli-gious order. Westerners find the intricacies of life in Africa very difficult to understand and, without ill will, have misjudged much of what they saw, dismissing it as primitive and pagan. It is exceedingly important for people entering religious life to realize the continuity between the values they were given in their families and the values outlined in their religious rule. African religious largely see religious life as divorced from their past, as something quite other. They see the rules and regula-tions of religious living as something totally new which has to be learned. Because of this the rules of religious life remain largely outside of them. The rules have little effect on their feelings and attitudes. The result is that religious life tends to lose its mean-ing and become more a drudgery than a life-giving program. There is a saying which is practically ubiquitous in Africa. It runs in South Africa: "People are made people through other 520 Review for Religious people." In Swahili a similar saying is: "I am, you are, and because you are, I am." This circular statement sums up the insight which Africans have about people depending on one another and the insight that without people the individual is nothing. This aware-ness of dependence and interdependence is a far cry from the individualism of the modern. Western outlook. Dependence on God is the source of all spir-ituality and is clearly discernible in the African outlook. Africa has a strong belief in the spiri-tual life. Death is seen not so much as an ending, but as a passing into a spiritual way of being. In Africa everything material has its spiritual equiv-alent. In fact, nothing exists without its spirit. It follows that religious life is seen as essentially for the purpose of bringing people into contact with the Divine in a special way. If this does not happen, then religious life for the individual tends to remain on a material and self-centered level. The religious vocation is a call to a special relationship with the spiritual realm. Religious with their vows of chastity, poverty, and obedience are marked as essentially different from others, for they are in a sense outside the primal group of family, clan, and nation. They live in an area of liminality in life and in this area make contact with the Divine. Everywhere in Africa the call to the spiritual is treated with great respect and reverence. The call is seen as mysterious and very important. It is not questioned. Take, for example, persons who discern that they are called to be a sangorna, to be one who understands the relationship between the material and the Divine and who is specially equipped to interpret rifts that occur between the human and the Divine, rifts that are seen as the cause of all mental and physical illness. Such calls will not be dismissed lightly, and people will undergo rigorous training to equip themselves for their special task as a sangoma. The religious call is seen in this context. It also comes from the Ancestors of the family, and therefore no one should interfere with it. The Ancestors will protect the person so called. Africans believe that when outstanding members of the family or the nation die, they join the living dead. They live on in spirit in another member of the family. As a human being casts a shadow, so each human in the flesh represents the spirit of an Ancestor. A parent 'People are made people through other people.' 3n-uly-Augus~ 1992 521 who first refused to allow a daughter to enter a convent remarked on her behavior: "I was fighting with the Ancestors." In Africa the spiritual revolves around the Ancestors, who mediate the Divine in life. The blessing of the Ancestors needs to be invoked in all circumstances. This ancient method of prayer might seem fundamentalist to a Western person, but it suits many people in the indigenous churches. They invoke God in all cir-cumstances: when getting up in the morning, at the beginning of all jobs--nothing, in fact, is done without prayer to the Ancestors. MI church services center on asking the Ancestors for blessing and healing of any rifts between the living dead and the humans in the flesh. Prayer then centers on the spirit of reverence and respect: through prayer, healing and forgiveness are brought to ordinary human relationships, and rifts with the Ancestors are healed. In this way the negative effects in our lives are resolved, and we become healthy again. Religious in this context are people who are especially moved by the spirit, in a charismatic sense. Prayer then is warm, spon-taneous, and real. But if religious life is seen by Africans as a bureaucratic organization in which material advantages follow the keeping of the rules, even though many of the rules may cen-ter on saying prayers; then it remains outside the person and will not lead to a true conversion of heart. Young people who enter often see a religious house as a house protected by God. They see religious as being protected by God, and the convent as a place of shelter from the storms of life; God will protect the people whom he has called. Many young people enter to be protected from the violence in the streets. Young girls come to escape being raped. Parents send children to convents in order to prevent .them from joining gangs. As people turn to sangomas (the spiritual healers) to protect themselves from the chaos around them, so they send their young girls to convents for the same protection. They feel that no evil can enter a reli-gious house. They also feel that God protects his religious from economic disaster. Young people and their parents see religious houses as places where people will be educated, fed, and housed; as places where the chaos of grinding poverty and ignorance will be kept at bay. Religious will be protected from thes~ material disasters. It is essential in these circumstances to help young people, through self-reflection, to an acceptance of their African values in 522 Review for Religious the light of the Gospel values. This helps to bring about a con-version of heart in which the person is moved to choose Jesus and break out into the wider world of other people and their needs. Young persons, in answering their call, answer it on behalf of their entire family and the Ancestors whom they embody in their life. Therefore, when young people join a religious order, they do not come as mere individuals with little significance. They come as deserving of great respect. They are not alienated people of no back-ground. They are not nobodies. God calls people through an entire network of relationships. Young religious who respond are responsible, therefore, for answering the call of the entire network. This gives the religious a great sense of sup-port and responsibility. To know that one bears the spirit of a beloved grandmother or grandfa-ther in one's life makes the path less precarious, less lonely, and more meaningful. Second, it gives the religious a great sense of dignity and worth. Religious need to respect their own call, and others must respect it too. Without this sense of reverence and respect, the young reli-gious fails to have any sense of liminality. Religious life then becomes more a question of obeying external laws which do not touch the heart and of obtaining an education. Instead of reli-gious life being a development or an exploration of the spiritual, it can become monotonous and meaningless. When the crises come, as come they must, the religious will not choose Jesus, but will make an easier, more selfish choice. A common saying in Africa expresses this lack of conviction and choice: "That person is a Christian by day and an African by night!" A difficulty inherent in the above outlook arises when a reli-gious wishes to leave the convent. Leaving is looked upon as a disaster: the religious loses her ties with God. Her relationship with him is broken. It is in the light of this broken relationship that all future troubles will be judged. The following example is typical: A young'sister left a religious congregation and then failed to pass her nursing examination. She moved to teaching and was equally unsuccessful. This was seen to be the result of leaving the convent, not the result of lack of sufficient talent. It is important to stress, therefore, that the divine call arises out of our baptismal God calls people through an entire network of relationships. j~ly-August 1992 523 Alt . Rerootin Reli "ous Life call. It is this call that must be answered, whether it is lived out in the context of religious life or not. In Africa, to be in a group is part of life. The richness of the human exchange in a community enriches the individual. The individual who is not included in this exchange is drained of life, so to speak. Group living is full of all that is human. Contentment, excitement, joy, happiness, and security are part of that living as are tensions, fears, suspicions, and disharmony. But the underly-ing attitudes of loyalty and respect can keep a group together through major emotional upheavals. In Africa, people truly live community. In the West, people tend to theorize and talk about community, but find it difficult to live it. Both lifestyles have their problems. In Africa, people are meant to live in harmony with one another and with the Ancestors. The individual is meant to enrich the lives of others and to be enriched in return. A religious group thatis not living a life filled With the Spirit will tend to exhibit the spirits of discord and chaos. In such close-knit and complex living together, the individual can feel very vul-nerable. Fear of one another, fear of authority figures, is a natural component of such living. Unless the group is living in the Spirit, fear instead of acceptance and warmth can dominate the group. Community life is held back by fear. Individuals will keep quiet at community meetings, for example. Many opinions which could build up a community are not stated. This can lead to seri-ous mistakes being made. Superiors can go unchallenged and do irresponsible things. Individuals who choose to live a life which is not in accordance with their vows are also left unchallenged because others are afraid to say anything. Those who have this fear feel humiliated and inferior; they grow depressed; in the end, tension shows itself as an illness. Such fear of disharmony, of expressing conflicting opinions, can cause great problems to social and group life in Africa. If disharmony and conflicts arise, the group tends to split and quickly polarize. This process is very evident in the histories of many of the African Independent Churches. African political leaders have generally chosen a one-party style of government in order to avoid disharmony. In so doing they have introduced a totalitarian system which in practice is marked by tribalism and greed. Modern urban societies demand that we learn to live with some disharmony and difference of opinion. In fact, differences of opin- 524 Review.for Religious ion can lead to positive growth, for without differences adaptation to changing times and circumstances cannot take place. In Africa the method of handling differences is for the entire group to°come together and to discuss fully the pros and cons of the different opinions. In these long conversations each person is listened to, and the conversation does not end until consensus is reached. This is like methods of conflict management in the West. The Gospel message of Jesus enhances and brings to fruition the message which Africa can give our world in terms of the interdependence of humans and their dependence on the Divine. The message of Jesus is close to the heart of the African experience of human living together. The message of the great religious founders like St. Benedict finds spontaneous resonance in Africa. The message of religious life, which strives to express the values of the Gospel of Jesus, is not much different from African value systems. The message of Jesus helps people choose less selfish values. In Africa, choices are made according to how a person feels. They tend to be made in terms of present time. A person might, there-fore, at one time choose some abstract Christian value and at another time choose against the same value. But people who are moved by the Spirit choose more responsibly. For instance, peo-ple might not feel like helping when help is needed, but if they are filled with the Spirit, they will go against that feeling and help nevertheless. Or, again, people may feel like getting revenge by not sharing, but if they are filled with the Spirit, they will share. The transcendent message of Jesus helps people to consider beyond this present moment. Christians need to think about the consequences of present actions: Would the future be better, more Christian, as a result of choices we might make now? Often enough, thoughtless pragmatic choices can bring immediate sat-isfaction in terms of money, goods, or pleasant feelings, but the long-term effects of these choices can be extremly destructive. Africa is full of examples of people who pragmatically and selfishly participated in their own destruction. Africans took part in the slave trade. African leaders have greedily plotted the economic ruin of the countries they govern. Tribal rural people have taken The message of Jesus is close to the heart of the African experience of human living together. AI~ o R~'ng Reli ~ou~ monetary handouts from the West, which have led to the destruc-tion of their way of life and to a dependency on further hand-outs. Other cultures can be less utilitarian and selfish by taking their heritage very seriously and protecting it. The Chinese, .Japanese, and Indians have not allowed Western materialism and individualism free access into their cultures, and they have been less enthusiastic in terms of cooperating with the West. Africa can be rather like Esau, who sold his birthright for a mess of pot-tage, because Africa does not appreciate the richness of its social and spiritual heritage for itself and for the world. The message of.jesus builds deeper trust. Christ has through his death and resurrection conquered death and despair. He is above all spirits. He is above all ancestors. There is no need for Christians to fear curses or sangomas or their neighbor. Life for Christians is secure because .jesus has already overcome the spirit of death and chaos. .Jesus speaks a message of love of one's neighbor and of one's enemy. Christians have to consider people who do not belong to their group or clan as nevertheless belonging to the family of .Jesus. Such "outsiders" are not objects, and they must be treated with love and respect. In this way the Christian message brings peace to the troubled area of ethnic and tribal violence--some-thing which has brought misery and death to many millions in Africa and has impoverished whole nations of people. If Christ's message is allowed to bring to fruition the values which the African people received from-God through the Ancestors, much that is unauthentic can be removed from African life even as its contact with the West increases. 526 Review for Religious ALBERT DI IANNI Religious Life and Religion Some recent discussions on "refounding" religious life in which I participated were passionate and at times ended in discord. Admittedly the groups involved were tired and overworked, but this was not the whole explanation. The heat manifested in exchanges about potential cures for the ills of contemporary religious life springs from a deeper source, from a basic disagreement about the nature of Christianity and of religion. When I first encountered the notion of"refounding" currently in vogue, I welcomed it as an improvement over "renewal" because it seemed to demand a deeper conver-sion and a more radical rebuilding. It brought to mind the Carmelite reform at the hands of Teresa of Avila and John of the Cross through an inventive retrieval of the spirit and discipline of the founders. Refounding seemed to invite us to set out once again upon a religious adven-ture demanding both great sacrifice and an engagement with the world that remained in some way separate from the world. Resistance to the notion mounted, however, with the repeated calls to identify "change agents" in the group who might encourage creativity in ministry and develop alternative community lifestyles. The more speakers lim-ited their discussions to talk about "delivery systems" for Albert DiIanni SM serves as vicar general of the Society of Mary (Marist). His address is Via Messandro Poerio 63; 00152 Rome; Italy. living religiously ~-uly-dug~_st 1992 527 Dilanni ¯ Religious Life and Religion change, namely, leadership models derived from anthropology and from corporate-reflection techniques borrowed from busi-ness psychology--the more they discussed only means--the more I felt I was being bundled down some primrose path. Before I discuss means, I want to discuss goals; before I accept help to move forward, I want to determine where I, where we, should want to go. This is possibly because I suspect that I do not want to go where some speakers want to lead me or that their advice about means carries some hidden freight about goals with which I do not concur. In a recent conversation about refounding, I found myself suddenly compelled to ask some strange, basic questions, not about religious life but about religion: What, for you, constitutes the heart of the Christian religion? What is its basic meaning or purpose? What engenders religion in the first place? Such ques-tions came to mind because I suddenly realized that our dis-agreement lay at a deep level, that we could not simply assume we would all answer such fundamental questions in the same way. This was not because anyone had expressly denied any belief which I held, but becaus{ they seemed to deflect or sidestep cer-tain ideas as old-fashioned or not in line with the particular action steps being recommended. The urge to ask fundamental questions comes upon me espe-cially when I sense that religion is being reduced to sociology, psychology, or even to morality, be it personal, social, or ecolog-ical morality. In fact, any tendency to reduce religion to morality fires me up more than sociological or psychological reductions because it is more subtle and plausible and thus more seductive. But let me put my own cards on the table. What do I believe is at the heart of the Christian religion? (I will ignore the eso-teric distinction drawn by some between faith and religion and the theory that Christianity is not a religion but.a faith.) Though Christianity like other religions is an amalgam of many compo-nents, I believe that its strictly religious aspect lies in its being an answer to the experience of human contingency and the con-tingency of the world. Most people at some time in their lives have felt wonder that the world exists at all and have faced into the void of their own death. They moved beyond the taken-for-grant-edness of the world and became frightened by the thought that nothing at all might have existed and no possibility of anything. They wondered if there were an ultimate meaning to life or if 528 Review for Religious humans were but a sport of nature. Christianity's central doctrine is that the world need not have existed and that it was the object of creation by a good God. A Christian believer is convinced that at the center of the universe is not a surd but a personal Love. The philosopher Ludwig Wittgenstein was not a believer. Norman Malcolm, his former student and biographer, says that he could not be called a religious person, but that he was passionately interested in religion and always seemed close to the possibility of religion. Wittgenstein once produced two examples of what he consid-ered bona fide religious experiences as opposed to moral or aesthetic ones. He respected them even if he thought that in entertaining them he was running up against the limits of language. One was the experi-ence of uncanniness that the world exists at all. The second was the conviction he some-times had that, whatever might happen, he would be safe. Neither of these experiences points of necessity to the existence of some transcen- The urge to ask fundamental questions comes upon me when I sense that religion is being reduced to sociology, psychology, or even to morality. dent reality, but they provide, the experiential ground from which many people move to affirm the existence of God. In such feelings and experiences, the affirmation that God exists is existentially grounded, becomes more than an intellectual proposition, takes root, finds a home. The first experience is the sense that a fleet-ing world must be rooted in a stable fundamental Reality. The second bespeaks a trust that cannot be explained without the pres-ence of a loving center of the universe. My own thoughts about religion center on experiences of this type. Admittedly my idea of religion has strong mystical over-tones; it is our response to radical contingency and, in its most primitive and deepest meaning, has little to do with morality. Religion refers primarily to a "holy" space out of which we and the world spring and gives rise to the imperative that each of us become holy, living our life in and for God. Beyond this I know that religion and morality are intimately intertwined and that a religious or holy person must also be morally good. One can hardly be holy and evil. Holiness means in part being extraordinarily kind, socially just, honest, temperate, a ~dy-Augvmt 1992 529 Dilanni ¯ Religious Life and Religion peacemaker. Yet it cannot be reduced to the practice of these moral virtues. For it is conceivable that someone could be morally good, could follow punctiliously the rules of a moral system, fos-ter social justice, be chaste and kind, and yet not be a religious per-son. He or she could be moral out of personal taste, by temperament, for aesthetic reasons, or out of natural sympathy toward others, and not because of his or her relationship to God. Philippa.Foot, an Oxford moral philosopher and avowed atheist, once told a seminar group that she was such a moral person and that she refused to be patronized by being called an "anonymous Christian." A Christian religious person not only acts morally, but also sees the world in a new way--that it is dependent for its very existence on a transcendent reality and that this makes all the dif-ference. Because it is focused upon the transcendent, the Christian vision has specific ethical implications different from Enlighteflment theories which place the human person or freedom at the center of the moral endeavor. For the Christian the pri-mary response to the world is not that of owner and Promethean creator, but of humble and obedient creature; not an entrepreneurial relishing of power and freedom, but a Marian gratitude before God for all that God has wrought. From this Christian gratitude is born the imperative to love God and God's creation, to allow God to express the divine mercy through us, especially toward the weak and the abandoned. This Christian gratitude and its ethical implications are nourished and deepened through a close union with God in prayer. It is this vision, it seems to me, which should be at the heart of the life of consecrated religious. If they are to be prophetic, it is in this: that in their lives they point constantly to the tran-scendent moment of the universe and try to develop what it means. It is up to each group to decide how it will express this. Christian meaning exists in--and is to be found in--religious sis-ters, brothers, and priests when they are rapt in contemplation of God as well as when they are picking up dying persons from the streets. When people see one of them unremittingly engaged in both, they believe they are in the presence of a saint. Some contemporary Catholic lay people and members of reli-gious congregations seem to have lost sight of the transcendent pole of Christianity. Their model of Christianity has become what Charles Davis labels "pragmatic." The pragmatic version of 530 Review for Religious Christianity arose, he says, when "the Christian religion ceased to function mythically as an overarching totality . The emphasis therefore shifted to Christianity as a practical way of life or eth-ical system. This is still conceived in religious terms, such as the fatherhood of God and the brotherhood of God's children, the kingdom of righteousness . But all these expressions are different ways of formulating the moral imperatives gov-erning human existence." ~ Both conservatives and liberals have made this pragmatic shift in Christianity. Conservatives stress per-sonal and family morality and such questions as abortion and euthanasia, and progressives stress social justice, ecology, and women's rights. Future historians may judge that the Vatican itself, but to a lesser degree, has been drawn into what I am characterizing as an overemphasis of morality. They may well remember Pope John Paul II as the "morality pope" because of his repeated statements about both per-sonal and social morality. In practice if not in theory, love of neighbor and enemy seem to have taken precedence over con-cern about union with God. Today's heresies all seem to be moral heresies. Not many Catholics seem concerned about dogmas, about trinitarian, soteriological, or Christological errors. And yet the history of the early church reveals that this was not always so. (I am at times tempted to fashion a brand-new trinitarian heresy to spur people to think more about God and less about themselves!) In this excessive emphasis on morality, the modern church reflects our secularized times, the age that mistook the world for God. In the late sixties, a time noted for its air of revolution, our seminary faculty once gathered the seminarians for a discussion on the question: W'hat are the most important qualities for being a priest and religious today? Some suggested approachability, oth-ers learning and competence, still others kindness or some other human virtue. I was surprised that no one spoke of holiness--a sure candidate just ten years before--and I pointed this out to Someone could be morally good, could follow punctiliously the rules of a moral system, foster social justice, be chaste and kind, and yet not be a religious person. ~dy-August 1992 531 Dilanni ¯ Religious Life and Religion the group. One of the seminarians fixed me with a stare and said with an air of disdain: "Just be human, Father!" Recently I had the pleasure of interviewing Kiko ArgOello, the Spanish layman and artist who founded the Neo- Catechumenate movement, which offers a series of steps, a way, for modern Catholics to rediscover their baptism and be com-mitted to evangelization. I played the devil's advocate and asked whether his way (camino) of training lay people over a period of years did not produce an arrogant elite and end up creating more division than unity in parishes. His answer was in strict contrast to the seminarian's. He insisted that becoming a Christian today was not easy, regardless of what many priests trained since Vatican II seemed to believe. It did not suffice to simply shout the love slo-gan. Belief that God exists and that Jesus is in some way the son of God was difficult in a secularized culture. Besides, our world of drugs and violence, suburban adultery and abortion, euthana-sia and consumerism, was full of snares. It would not be suffi-cient simply to limit our preaching to a form of positive reinforcement. People had to be called to a public confession of their belief in God and Jesus, be brought to a felt need for con-version, be tested in their resolve, b~ supported by a tightly knit community, and be nourished by an adequate participative' liturgy. Needed, in his view, was a method, a way, a structure, a catechu-menate, 'to bring people squarely before their baptism and its implications for their lives. In so many words he was saying that it was simplistic for the 1968 seminarian to have said: "Just be human, Father." Yes, Christ is at work in the world wherever human good is being done, and we have to recognize and foster such work wher-ever we find it; but we must be aware, too, that fostering human-istic values and being a Christian are not in every way identical. Besides demanding that we be thoroughly moral, Christianity demands belief in many strange things, like the incarnation, the need for redemption, the resurrection, the presence of Jesus in the Eucharist, and the role of Mary. For a time in my adolescence, I wished I had been brought up neutral vis-~a-vis religion so that at the age of twenty-one I might consider all the major religions and choose among them without the prejudice of early Catholic training or brainwashing. But I know now that this is naive, for I have recognized that young people who have not been brought up in any religion end up by 532 Review for Religious having no religious sentiment or religiosity. They tend to remain religion-neutral, unable to make a choice in favor of any religion. George Lindbeck, a Protestant theologian, believes that, unless some religion is taught to us when we are young, unless we are brought up in some religious prac-tices, we might not even be capable of religious experience. This may be exaggerated, but I am sure it contains a grain of truth. One thing is certain: People are never brought up in a vac-uum of vision and values. If they do not absorb religious vision and val-ues, they absorb the secular vision and religion-neutral values of the movies and television. Especially in Europe several new lay Christian movements and reli-gious orders have been born in full awareness of this: the Focolarini, the Sant' Egidio community, the Neo- Catechumenate, the Lion of Juda, the Legionaries of Christ, and so forth. They all believe that becoming Christian in a secularized world is especially difficult and demands a way, a method, an entry through a kind of Christian subculture. It means leaving behind a lot of things that can seem very important from the world's point of view, but really are not. It demands kenosis, emptying oneself, in preparation for a radical decision in favor of Christ and God. Karl Rahner once declared: "A Christian in today's world will be a mys-tic or else he will not exist." And he went on to speak of mystagogy, the need of a method to lead people to see everything in God. I believe that one reason why religious congregations are in a mere survival situation today is that, in their admirable effort to take a positive view of the world, they have identified religion too strongly with a humanistic morality that tends to be secular-istic, individualistic, and overly egalitarian. History shows that almost all religious congregations enjoyed strong growth at their beginnings. They were exciting and attractive in part because they were new, but part of their attraction lay elsewhere. The early members had a sense of a religious adventure and cause larger than themselves which rendered them willing to forgo many personal rights and privileges.~They were members of what Besides demanding that we be thoroughly moral, Christianity demands belief in many strange things, like the incarnation, the need for redemption, the resurrection. July-August 1992 533 Dilanni ¯ Religious Life and Religion have been called "intentional" communities as opposed to various "associational" and "bureaucratic" ones that have come into exis-tence since Vatican II.2 They were quite unconcerned with self-expression and equality, not because they were naive and subservient (today's caricature), but because they were caught up in a higher religious vision that enhanced and focused their ener-gies for God and the church. Most religious congregations were founded for three main purposes, the salvation of the members, the salvation of others, and dedication to a devotion or a way of the apostolate. Their charism did not lie only in the third element but in all three. Their purposes were decidedly religious and eschatological as well as incarnational. Today the eschatological has been pushed aside by an incarnational theology interpreted too secularistically and humanistically. Transcendent themes have been toned down in favor of an emphasis on egalitarian rights, on a type of justice interpreted not only as equity but as evenness, a kind of unifor-mity without differences. Everyone knows that only in unity is strength. But egalitarianism, by its very definition, effects an atomism and separateness within a group inasmuch as it deems individual rights and desires more important than the group's religious cause and adventure. Such stress upon egalitarian and humanistic ideals is an ide-ology. It is one way--and only one way--of interpreting democ-racy and justice in society and in religious groups. To oppose that ideology is not to give up democracy but to give it another inter-pretation. This was brought home to me recently as I overheard a conversation between an Mnerican priest--a born-again egali-tarian- and a young female member of the lay Sant' Egidio com-munity in Rome.3 Describing how the community functioned, she mentioned that in her particular community, because of its makeup and history, only certain men and no women were asked to speak at the prayer services. The American priest objected that this was a grave error, that it was supremely important--as a sym-bol and sign to others if not for her personally--that women be allowed to preach in every community. She answered that the Sant' Egidio community did not approach questions ideologi-cally, but pragmatically. Some of the other communities did have women preachers, but because of its particular history and tal-ents, her group preferred not to have them and she was happy with things as they were. She explained that for the Sant' Egidio 534 Review for Religious group three things were of paramount importance: (1) prayer together over the word of God, (2) friendship or mutual support, and (3) work for and with the poor. All else must cede before the achievement of these goals. The American priest's voice rose as he insisted that she was wrong and that the American interpretation of women's rights was correct. But she stood her ground and deftly changed the sub-ject. We have come full circle. In the 1960s, after many years of repression and an exaggerated supernaturalism, we needed to stress personal free-dom and responsibility and a true equality among the races and sexes. We had to recognize our duty before God to take responsibility to build up a world of justice and peace. But this did.not mean that such concerns should come to prevail in reli-gious congregations and sweep all else away in their wake. Now that we have seen the shadow side of such emphases in religious life, we can bet-ter take stock and rediscover that our involvement with the world must begin beyond the world. While the psychological and political agendas were very important for religious life, neither of them was the "one thing necessary." Religious life should center upon that in Christianity which relates our lives to the transcendent. It is here that we must seek its prophecy. It is in reminding people of the divine enchant-ment of the world that it must be countercultural. It is upon this that reflection on refounding religious life must insist. In her arti-cle "Religious Life and the Need for Salt,''4 Joan Chittister asks the right questions regarding contemporary religious life. She wisely concludes that the project of encouraging self-expression in traditionally repressed religious has now been achieved. She says we must now move to questions about the group and how it can be prophetic in today's world. But her answers, giving her interpretation of prophecy, are still too much centered on ecology, social assistance, and human rights and thus, by remaining within a pragmatic model of Christianity, seem but another reiteration of the program of liberal politics. These liberal concerns are impor-tant and must be addressed by the church: the laity, the clergy, and the religious. But addressing such issues, in my opinion, is not going to be the salvation of religious life. Its problems do not 'A Christian in today's world will be a mystic or else he will not exist.' .July-August 1992 535 Dilanni ¯ Religious Life and Relig4on arise from a neglect of them. Religious lack, not moral outreach, but religious centering. They fail to realize what the poor them-selves realize and express in their popular religions, that our union with God through Jesus is central, that we must work at it, and that it is primarily in this that we will be countercultural. Which is more countercultural--to say we must strive to save planet earth or to say we truly believe that the dead are with God because Jesus rose from the dead and that this makes all the difference? I have made some hard remarks and asked some hard ques-tions, and I would welcome a dialogue about them. I am sure I have not expressed them adequately, but I am convinced that they contain at least a grain of truth. I am encouraged in uttering them by the swing of young people in both Europe and North America toward an interest in the mystical sense of religion. In the 1960s the young were caught up in the humanistic values of psychol-ogy and sociology, but today's youth exhibit a great interest in mysticism, religious cults and movements, apparitions and heal-ings, the afterlife; and even reincarnation and the satanic. Does this not indicate that they are experiencing a deep void of mean-ing in an anorexic and bulimic world where money, notoriety, power, individualism, and equality have become the primary val-ues? Does not this cultural change signal that secular humanism for all its ethical achievements has also been an impoverishment by reason of a dearth of religious imagination? Is it not a sign of the times when people living in sophisticated technological cul-tures begin to be attracted to religious beliefs interpreted in a most .simplistic fashion? I know the good responses to the distinction I draw within Christianity between morality and religion. Most will describe it as dualistic--for contemporary pundits the most damning of epi-thets. They will say, "You are separating things that are essen-tially linked." Love of God and love of neighbor are two aspects of the same thing. If you do not care for the person you see, how can you say you love the God you do not see? Those who love God should find their love's primary expression in their dedica-tion to caring for their neighbor, whether friend or enemy. Prayer is missionary and missionary activity is prayer--and on and on. Others will say that I give a false description of the present sit-uation of religious life; they will deny that those engaged in social justice and ecology tend to pray less and to be less interested in the transcendent, in sacraments, and in the eschatological. 536 Reviezv for Religious I know these rejoinders are partly true, but also that they are partly false. I know that the two aspects of Christianity, religion and morality, love of God and love of neighbor, are very closely intertwined, and I am aware of Karl Rahner's brilliant attempt to conjoin them.5 But I know too that they are conceptually distinct because I have seen them separated in the history of the church. At times the church has experienced the extreme of quietism, an overem-phasis on faith without good works, and other times the heresy of action, a hectic involvement in important works of justice and charity to the detriment of prayer and interiority, the soul of the apostolate. It is up to each of us to examine our life to determine where we are. But I am convinced that the problems of religious life stem only partly from a lack of adequate delivery systems and from ignorance about psychol-ogy, social systemics, and anthropo-logical models in an age of rapid change. I am convinced that their deeper source lies in the confusion between religion and morality and in an insistence upon moral-ity because of a loss of faith and interest in religion. If Christian religion is centered almost exclusively upon doing the moral good, upon promoting social justice and ecology, or upon fighting pornography and abortion, then what is the mean-ing of doctrines and dogmas? Are they but religious, accouter-ments? If so, why not be honest and simply drop them? What is the meaning of the redemption through Christ for a religion reduced to morality? What is the meaning of the Eucharist? Are these dogmas and sacraments only stimuli for action, stories and symbols subtly swaying us to do what is truly important: foster-ing the construction of a socially just and ecologically sound world, creating the. kingdom of morality? Is the resurrection just a story whose real cash value is all those smaller resurrections which can occur in a society, in history, or in each human life? How is a religious congregation which centers so strongly on morality to be differentiated from such groups as UNICEF or the Which is more countercultural - to say we must strive ~ to save planet earth or to say we truly believe that the dead are with God because Jesus rose from the dead and that this makes all the difference ? ~dy-Augzlst 1992 537 Dilanni ¯ Religious Life and Religion A life steeped in prayer will produce something we may have lost: a solid number of holy men and women whose life clearly is centered on God. FAO wherein men and women devote themselves to humanitarian causes at times for wages far lower than they could obtain else-where? I know that, since Vatican II, theologians including Rahner and Schillebeeckx have highlighted the thesis that Christ is at work in the world wherever good is. being done and humane causes are fostered. I am acquainted with the theories that the work of building up the kingdom of God is primarily a matter of our present life in the world, that salvation is not only after death but begins here, that the glory of God is man and woman fully alive. I am in sympathy with such emphases, but must also admit that they do not set me on fire; and judging from the vocation statistics of "progressive" congregations, I know that they have not stirred the young. For in my heart I suspect that such emphases are quite incomplete and were (in part) born of a loss of faith in the transcendent. For me Christianity centers not on us but on God. It demands a different vision of the world and reality, which generates a humble gratitude to the God who is responsible for all that is. One of Christianity's concerns is our inborn tendency to distort our freedom, arising from what Luther called the "in-curvedness" of our will. Christianity is about God and sin and the need for God's grace-ful hand to help us make proper use of our freedom. Christian religion must be about God and our relationship with God not only implicitly but also explicitly. It is from a union with God in prayer that light will emanate on how we are to relate to God, the world, and each other. And if a life is to be devoted to religion in a special way, if it is to be a consecrated religious life, it must be lived primarily in view of this relationship to God, not only in ideal but also in structure. It must be structured in such a way that the life of,the group abets in its members this concern about each one's relationship to God and gives witness of it to others. Such a life steeped in prayer will produce something we may have lost: a solid number of holy men and women whose life clearly is centered on God. If this proves true, young people will surely again be attracted to this kind of life, not so much because 538 Review for Religious it is relevant or more interesting than the world, but simply because religious life so construed and so lived is what it purports to be--religious. Notes ~ What is Living, What is Dead in Christianity Today? (San Francisco: Harper and Row, 1986), p. 39. -' See Patricia Wittberg SC, Creating a Future for Religious Life (New York: Paulist Press, 1991